Leigh Syndrome Associated with Mitochondrial Complex I Deficiency Due to a Novel Mutation in the NDUFS1 Gene

Total Page:16

File Type:pdf, Size:1020Kb

Load more

OBSERVATION Leigh Syndrome Associated With Mitochondrial Complex I Deficiency Due to a Novel Mutation in the NDUFS1 Gene Miguel A. Martín, PhD; Alberto Blázquez, BSc; Luis G. Gutierrez-Solana, MD; Daniel Fernández-Moreira, PharmB; Paz Briones, PhD; Antoni L. Andreu, MD, PhD; Rafael Garesse, PhD; Yolanda Campos, PhD; Joaquín Arenas, PhD Background: Mutations in the nuclear-encoded sub- Results: Muscle biochemistry results showed a com- units of complex I of the mitochondrial respiratory chain plex I defect of the mitochondrial respiratory chain. Se- are a recognized cause of Leigh syndrome (LS). Re- quencing analysis of the mitochondrial DNA–encoded cently, 6 mutations in the NDUFS1 gene were identified ND genes, the nuclear DNA–encoded NDUFV1, NDUFS1, in 3 families. NDUFS2, NDUFS4, NDUFS6, NDUFS7, NDUFS8, and NDUFAB1 genes, and the complex I assembly factor CIA30 Objective: To describe a Spanish family with LS, com- gene revealed a novel homozygous L231V mutation plex I deficiency in muscle, and a novel mutation in the (c.691C→G) in the NDUFS1 gene. The parents were het- NDUFS1 gene. erozygous carriers of the L231V mutation. Design: Using molecular genetic approaches, we iden- Conclusions: Identifying nuclear mutations as a cause tified the underlying molecular defect in a patient with of respiratory chain disorders will enhance the possibil- LS with a complex I defect. ity of prenatal diagnosis and help us understand how mo- lecular defects can lead to complex I deficiency. Patient: The proband was a child who displayed the clini- cal features of LS. Arch Neurol. 2005;62:659-661 EIGH SYNDROME (LS) (ON- in the NDUFS1 gene were identified in 3 line Mendelian Inheritance families with LS or Leigh-like disease and in Man 256000) is a devas- complex I deficiency (Online Mendelian In- tating neurodegenerative heritance in Man 157655).5 Herein, we de- disorder characterized neu- scribe a Spanish patient with LS, complex Lropathologically by focal bilaterally sym- I deficiency in muscle, and a novel muta- metrical lesions, especially in the thala- tion in the NDUFS1 gene. mus and brainstem regions, and clinically by psychomotor retardation, respiratory dif- METHODS ficulties, nystagmus, ophthalmoparesis, op- tic atrophy, ataxia, and dystonia.1 In most patients, mitochondrial respiratory chain REPORT OF A CASE defects and pyruvate dehydrogenase com- The first child (a girl) of healthy nonconsan- plex deficiency are the underlying causes 2 guineous parents (aged 30 years) of Spanish of the disease. Mitochondrial respiratory origin was born after a term pregnancy (birth chain complex I (nicotinamide adenine di- weight, 3560 g). She was hospitalized at age 8½ nucleotide:ubiquinone oxidoreductase) months for recurrent episodes of vomiting, contains at least 46 subunits, 7 of which are floppiness, and growth retardation. She pre- encoded by mitochondrial DNA (mtDNA).2 sented with irritability, horizontal nystagmus, Various mutations in a few subunits of com- and generalized hypotonia. Tendon reflexes plex I encoded by nuclear DNA (nDNA) were hyperactive and symmetric. Babinski sign (NDUFV1, NDUFV2, NDUFS1, NDUFS2, was negative. An electroencephalogram dis- NDUFS3, NDUFS4, NDUFS7, and played a normal pattern. Brain magnetic reso- 3-10 nance imaging showed bilateral lesions affect- NDUFS8) are associated with LS or ing the substantia nigra and midbrain. Leigh-like disease in patients with com- Cardiologic and ophthalmologic examination plex I deficiency. The NDUFS1 gene en- findings were normal. Laboratory data revealed Author Affiliations are listed at codes the largest (75-kDa subunit) pro- increased lactate levels in blood (24 mg/dL; the end of this article. tein of complex I.11 Recently, 6 mutations normal, Ͻ20 mg/dL) and in cerebrospinal fluid (REPRINTED) ARCH NEUROL / VOL 62, APR 2005 WWW.ARCHNEUROL.COM 659 ©2005 American Medical Association. All rights reserved. Downloaded From: https://jamanetwork.com/ on 10/02/2021 A 1234 B T A GGT GCCCT AA CCT Table. Activities of Mitochondrial Respiratory Chain ∗ Complexes in Muscle Homogenate* 312 bp 180 bp 132 bp Control Subjects, TTTAGGT GGCCAA CC Mean (SD) ∗ Activity Patient (n = 100) Nicotinamide adenine dinucleotide: 5.0 20.0 (4.5) ubiquinone oxidoreductase L231V C Succinate dehydrogenase 8.7 10.3 (3.5) Homo sapiens SGN I ID I CPVGALTSKPYAFTARPWETRKTESIDVMDAVG Decylubiquinol–cytochrome c oxidoreductase 50.7 63.0 (18.0) Bos taurus SGN I ID I CPVGALTSKPYAFTARPWETRKTESIDVMDAVG Cytochrome c oxidase 22.8 42.0 (12.1) Solanum tuberosum SGN V ID I CPVGALTSKPFAFKARNWELKGTESIDV T DAVG Rhodobacter capsulatus QGN I IDLCPVGALTSKPYAFTARPWELVKTESIDVMDALG *Data are given as percentage of citrate synthase activity. Activities were Neurospora crassa SGN V IDLCPVGALTSKPYAFRARPWELKKTESIDV L DGLG measured as nanomoles per minute per milligram of protein. Paracoccus denetrificans QGN I IDLCPVGALVSKPYAFTARPWELT KTESIDVMDALG Rickettsia prowazekii SGN MID I CPVGALNSKPYAFKARKWELKHTASIGV H DAEG Figure. Polymerase chain reaction–restriction fragment length polymorphism results (A), sequencing (B), and sequence alignment of the RESULTS NDUFS1 protein from various species (C). A, Lane 1: control DNA. Lane 2: muscle DNA from the patient. Lane 3: blood DNA from the mother. Lane 4: blood DNA from the father. The L231V mutation was detected by digesting The activities of respiratory chain complexes in muscle the NDUFS1 exon 8 fragment with the restriction enzyme Sdu I. The showed a single defect of nicotinamide adenine dinucleo- 312–base pair (bp) wild-type DNA was digested by Sdu I into 2 fragments of tide:ubiquinone oxidoreductase (complex I), account- 180 and 132 bp, whereas the 312-bp fragment remained uncut in the patient, Table who was homozygous for the mutation. B, Electrophoretograms showing the ing for 25% of the mean of the control subjects ( ). change in the patient (top) and the normal sequence in a control subject Given the clinical picture and the biochemical findings, (bottom). Asterisk represents the nucleotide substitution. C, Evolutionary we searched for the underlying molecular alteration of conservation of the 231 amino acid residue (arrow) of the NDUFS1 protein. this defect. Sequencing analysis of the genes listed in the “Methods” section showed a novel homozygous mis- (30 mg/dL; normal, Ͻ15 mg/dL). In fibroblasts, pyruvate dehy- sense mutation (L231V) that replaces a leucine by a va- drogenase activity was normal, and pyruvate oxidation was in the line in the 231 amino acid residue of the protein as a re- lower reference limit. Muscle morphologic structure was nor- sult of a c.691C→G transversion in exon 8 of the NDUFS1 mal except for mild atrophy of type 2 fibers. Her status wors- gene (Figure). Additional nucleotide changes were not ened 5 months later, when she developed respiratory insuffi- found. The parents were heterozygous carriers of the ciency and horizontal and vertical nystagmus. Her tendon reflexes L231V mutation. became highly hyperactive, with a surface area enlargement and presence of Babinski sign. She died at age 14 months. Her younger brother had a similar clinical picture and died at age 8 months, COMMENT after an acute episode of respiratory failure. Mutations in the nDNA-encoded complex I NDUFV1, BIOCHEMICAL AND MOLECULAR NDUFV2, NDUFS1, NDUFS2, NDUFS3, NDUFS4, GENETIC STUDIES NDUFS7, and NDUFS8 genes have been documented in patients with LS, although often the underlying molecu- An appropriate institutional review board approved this work, lar defect remains unknown.3-10 In 3 nonrelated fami- and informed consent was obtained from the child’s parents. lies, Bénit et al5 identified 6 mutations in the NDUFS1 Respiratory chain enzymes in muscle homogenate were mea- gene, which encodes the largest subunit of complex I. sured by methods reported elsewhere.12 Interestingly, 3 of these mutations (amino acids 222, 241, DNA was isolated from muscle and blood from the patient and 252) lie in a highly evolutionary conserved stretch and from blood from her parents. The mtDNA-encoded ND sub- 13 of the protein encompassing the most C-terminal cyste- units were amplified using suitable primers. The coding re- ine residue, potentially involved in the ligation of iron- gion and exon and intron boundaries of the nuclear-encoded 5 complex I subunits of the NDUFV1, NDUFS1, NDUFS2, sulfur clusters. NDUFS3, NDUFS4, NDUFS7, NDUFS8, and NDUFAB1 genes, We describe a Spanish girl with LS, whose younger as well as the complex I assembly factor CIA30 gene, were am- brother died of a similar condition. The proband had a plified as previously described3-10,14,15 or by using novel in- complex I defect in muscle and harbored a novel homo- tronic primers. Polymerase chain reaction products were pu- zygous missense mutation (L231V) in the NDUFS1 gene. rified by electrophoresis in 2% agarose gel and sequenced The mutation was consistently heterozygous in blood directly, using the ABI PRISM dRhodamine Terminator Cycle DNA from the healthy parents, suggesting autosomal re- Sequencing Kit in an ABI PRISM 310 genetic analyzer (Ap- cessive inheritance. Several lines of evidence support the plied Biosystems, Foster City, Calif). Nucleotide changes were pathogenicity of the mutation, including the following: further confirmed by polymerase chain reaction–restriction frag- (1) the patient had a single complex I defect in muscle; ment length polymorphism methods (Figure). One hundred healthy control subjects (200 alleles) were screened by poly- (2) it was the only nucleotide change found in the en- merase chain reaction–restriction fragment length polymor- tire coding region and in the intron and exon bound- phism methods to rule out the presence of the mutation in the aries of the gene; (3) no additional pathogenic muta- healthy population. Unfortunately, tissue specimens were not tions were found in the other complex I genes analyzed; available from the proband’s brother. (4) the mutation was absent in 200 alleles from 100 (REPRINTED) ARCH NEUROL / VOL 62, APR 2005 WWW.ARCHNEUROL.COM 660 ©2005 American Medical Association. All rights reserved. Downloaded From: https://jamanetwork.com/ on 10/02/2021 healthy controls of similar ethnic background; and (5) Fernández-Moreira, and Arenas.
Recommended publications
  • DNA Breakpoint Assay Reveals a Majority of Gross Duplications Occur in Tandem Reducing VUS Classifications in Breast Cancer Predisposition Genes

    DNA Breakpoint Assay Reveals a Majority of Gross Duplications Occur in Tandem Reducing VUS Classifications in Breast Cancer Predisposition Genes

    © American College of Medical Genetics and Genomics ARTICLE Corrected: Correction DNA breakpoint assay reveals a majority of gross duplications occur in tandem reducing VUS classifications in breast cancer predisposition genes Marcy E. Richardson, PhD1, Hansook Chong, PhD1, Wenbo Mu, MS1, Blair R. Conner, MS1, Vickie Hsuan, MS1, Sara Willett, MS1, Stephanie Lam, MS1, Pei Tsai, CGMBS, MB (ASCP)1, Tina Pesaran, MS, CGC1, Adam C. Chamberlin, PhD1, Min-Sun Park, PhD1, Phillip Gray, PhD1, Rachid Karam, MD, PhD1 and Aaron Elliott, PhD1 Purpose: Gross duplications are ambiguous in terms of clinical cohort, while the remainder have unknown tandem status. Among interpretation due to the limitations of the detection methods that the tandem gross duplications that were eligible for reclassification, cannot infer their context, namely, whether they occur in tandem or 95% of them were upgraded to pathogenic. are duplicated and inserted elsewhere in the genome. We Conclusion: DBA is a novel, high-throughput, NGS-based method investigated the proportion of gross duplications occurring in that informs the tandem status, and thereby the classification of, tandem in breast cancer predisposition genes with the intent of gross duplications. This method revealed that most gross duplica- informing their classifications. tions in the investigated genes occurred in tandem and resulted in a Methods: The DNA breakpoint assay (DBA) is a custom, paired- pathogenic classification, which helps to secure the necessary end, next-generation sequencing (NGS) method designed to treatment options for their carriers. capture and detect deep-intronic DNA breakpoints in gross duplications in BRCA1, BRCA2, ATM, CDH1, PALB2, and CHEK2. Genetics in Medicine (2019) 21:683–693; https://doi.org/10.1038/s41436- Results: DBA allowed us to ascertain breakpoints for 44 unique 018-0092-7 gross duplications from 147 probands.
  • Progressive Encephalopathy and Central Hypoventilation Related to Homozygosity of NDUFV1 Nuclear Gene, a Rare Mitochondrial Disease

    Progressive Encephalopathy and Central Hypoventilation Related to Homozygosity of NDUFV1 Nuclear Gene, a Rare Mitochondrial Disease

    Avens Publishing Group Inviting Innovations Open Access Case Report J Pediatr Child Care August 2019 Volume:5, Issue:1 © All rights are reserved by AL-Buali MJ, et al. AvensJournal Publishing of Group Inviting Innovations Progressive Encephalopathy Pediatrics & and Central Hypoventilation Child Care AL-Buali MJ*, Al Ramadhan S, Al Buali H, Al-Faraj J and Related to Homozygosity of Al Mohanna M Pediatric Department , Maternity Children Hospital , Saudi Arabia *Address for Correspondence: NDUFV1 Nuclear Gene, a Rare Al-buali MJ, Pediatric Consultant and Consultant of Medical Genetics, Deputy Chairman of Medical Genetic Unite, Pediatrics Department , Maternity Children Hospital, Al-hassa, Hofuf city, Mitochondrial Disease Saudi Arabia; E-mail: [email protected] Submission: 15 July 2019 Accepted: 5 August 2019 Keywords: Progressive encephalopathy; Central hypoventilation; Published: 9 August 2019 Nuclear mitochondrial disease; NDUFV1 gene Copyright: © 2019 AL-Buali MJ, et al. This is an open access article distributed under the Creative Commons Attribution License, which Abstract permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Background: Mitochondrial diseases are a group of disorders caused by dysfunctional organelles that generate energy for our body. Mitochondria small double-membrane organelles found in of the most common groups of genetic diseases with a minimum every cell of the human body except red blood cells. Mitochondrial diseases are sometimes caused by mutations in the mitochondrial DNA prevalence of greater than 1 in 5000 in adults. Mitochondrial diseases that affect mitochondrial function. Other mitochondrial diseases are can be present at birth but can be manifested also at any age [2].
  • High-Throughput, Pooled Sequencing Identifies Mutations in NUBPL And

    High-Throughput, Pooled Sequencing Identifies Mutations in NUBPL And

    ARTICLES High-throughput, pooled sequencing identifies mutations in NUBPL and FOXRED1 in human complex I deficiency Sarah E Calvo1–3,10, Elena J Tucker4,5,10, Alison G Compton4,10, Denise M Kirby4, Gabriel Crawford3, Noel P Burtt3, Manuel Rivas1,3, Candace Guiducci3, Damien L Bruno4, Olga A Goldberger1,2, Michelle C Redman3, Esko Wiltshire6,7, Callum J Wilson8, David Altshuler1,3,9, Stacey B Gabriel3, Mark J Daly1,3, David R Thorburn4,5 & Vamsi K Mootha1–3 Discovering the molecular basis of mitochondrial respiratory chain disease is challenging given the large number of both mitochondrial and nuclear genes that are involved. We report a strategy of focused candidate gene prediction, high-throughput sequencing and experimental validation to uncover the molecular basis of mitochondrial complex I disorders. We created seven pools of DNA from a cohort of 103 cases and 42 healthy controls and then performed deep sequencing of 103 candidate genes to identify 151 rare variants that were predicted to affect protein function. We established genetic diagnoses in 13 of 60 previously unsolved cases using confirmatory experiments, including cDNA complementation to show that mutations in NUBPL and FOXRED1 can cause complex I deficiency. Our study illustrates how large-scale sequencing, coupled with functional prediction and experimental validation, can be used to identify causal mutations in individual cases. Complex I of the mitochondrial respiratory chain is a large ~1-MDa ­assembly factors are probably required, as suggested by the 20 factors macromolecular machine composed of 45 protein subunits encoded necessary for assembly of the smaller complex IV9 and by cohort by both the nuclear and mitochondrial (mtDNA) genomes.
  • Autism Multiplex Family with 16P11.2P12.2 Microduplication Syndrome in Monozygotic Twins and Distal 16P11.2 Deletion in Their Brother

    Autism Multiplex Family with 16P11.2P12.2 Microduplication Syndrome in Monozygotic Twins and Distal 16P11.2 Deletion in Their Brother

    European Journal of Human Genetics (2012) 20, 540–546 & 2012 Macmillan Publishers Limited All rights reserved 1018-4813/12 www.nature.com/ejhg ARTICLE Autism multiplex family with 16p11.2p12.2 microduplication syndrome in monozygotic twins and distal 16p11.2 deletion in their brother Anne-Claude Tabet1,2,3,4, Marion Pilorge2,3,4, Richard Delorme5,6,Fre´de´rique Amsellem5,6, Jean-Marc Pinard7, Marion Leboyer6,8,9, Alain Verloes10, Brigitte Benzacken1,11,12 and Catalina Betancur*,2,3,4 The pericentromeric region of chromosome 16p is rich in segmental duplications that predispose to rearrangements through non-allelic homologous recombination. Several recurrent copy number variations have been described recently in chromosome 16p. 16p11.2 rearrangements (29.5–30.1 Mb) are associated with autism, intellectual disability (ID) and other neurodevelopmental disorders. Another recognizable but less common microdeletion syndrome in 16p11.2p12.2 (21.4 to 28.5–30.1 Mb) has been described in six individuals with ID, whereas apparently reciprocal duplications, studied by standard cytogenetic and fluorescence in situ hybridization techniques, have been reported in three patients with autism spectrum disorders. Here, we report a multiplex family with three boys affected with autism, including two monozygotic twins carrying a de novo 16p11.2p12.2 duplication of 8.95 Mb (21.28–30.23 Mb) characterized by single-nucleotide polymorphism array, encompassing both the 16p11.2 and 16p11.2p12.2 regions. The twins exhibited autism, severe ID, and dysmorphic features, including a triangular face, deep-set eyes, large and prominent nasal bridge, and tall, slender build. The eldest brother presented with autism, mild ID, early-onset obesity and normal craniofacial features, and carried a smaller, overlapping 16p11.2 microdeletion of 847 kb (28.40–29.25 Mb), inherited from his apparently healthy father.
  • A Minimum-Labeling Approach for Reconstructing Protein Networks Across Multiple Conditions

    A Minimum-Labeling Approach for Reconstructing Protein Networks Across Multiple Conditions

    A Minimum-Labeling Approach for Reconstructing Protein Networks across Multiple Conditions Arnon Mazza1, Irit Gat-Viks2, Hesso Farhan3, and Roded Sharan1 1 Blavatnik School of Computer Science, Tel Aviv University, Tel Aviv 69978, Israel. Email: [email protected]. 2 Dept. of Cell Research and Immunology, Tel Aviv University, Tel Aviv 69978, Israel. 3 Biotechnology Institute Thurgau, University of Konstanz, Unterseestrasse 47, CH-8280 Kreuzlingen, Switzerland. Abstract. The sheer amounts of biological data that are generated in recent years have driven the development of network analysis tools to fa- cilitate the interpretation and representation of these data. A fundamen- tal challenge in this domain is the reconstruction of a protein-protein sub- network that underlies a process of interest from a genome-wide screen of associated genes. Despite intense work in this area, current algorith- mic approaches are largely limited to analyzing a single screen and are, thus, unable to account for information on condition-specific genes, or reveal the dynamics (over time or condition) of the process in question. Here we propose a novel formulation for network reconstruction from multiple-condition data and devise an efficient integer program solution for it. We apply our algorithm to analyze the response to influenza in- fection in humans over time as well as to analyze a pair of ER export related screens in humans. By comparing to an extant, single-condition tool we demonstrate the power of our new approach in integrating data from multiple conditions in a compact and coherent manner, capturing the dynamics of the underlying processes. 1 Introduction With the increasing availability of high-throughput data, network biol- arXiv:1307.7803v1 [q-bio.QM] 30 Jul 2013 ogy has become the method of choice for filtering, interpreting and rep- resenting these data.
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • NDUFS6 Mutations Are a Novel Cause of Lethal Neonatal Mitochondrial Complex I Deficiency Denise M

    NDUFS6 Mutations Are a Novel Cause of Lethal Neonatal Mitochondrial Complex I Deficiency Denise M

    Related Commentary, page 760 Research article NDUFS6 mutations are a novel cause of lethal neonatal mitochondrial complex I deficiency Denise M. Kirby,1,2,3 Renato Salemi,1 Canny Sugiana,1,3 Akira Ohtake,4 Lee Parry,1 Katrina M. Bell,1 Edwin P. Kirk,5 Avihu Boneh,1,2,3 Robert W. Taylor,6 Hans-Henrik M. Dahl,1,3 Michael T. Ryan,4 and David R. Thorburn1,2,3 1Murdoch Childrens Research Institute and 2Genetic Health Services Victoria, Royal Children’s Hospital, Melbourne, Victoria, Australia. 3Department of Paediatrics, University of Melbourne, Melbourne, Victoria, Australia. 4Department of Biochemistry, LaTrobe University, Melbourne, Victoria, Australia. 5Department of Medical Genetics, Sydney Children’s Hospital, Sydney, New South Wales, Australia. 6Mitochondrial Research Group, School of Neurology, Neurobiology and Psychiatry, University of Newcastle upon Tyne, Newcastle upon Tyne, United Kingdom. Complex I deficiency, the most common respiratory chain defect, is genetically heterogeneous: mutations in 8 nuclear and 7 mitochondrial DNA genes encoding complex I subunits have been described. However, these genes account for disease in only a minority of complex I–deficient patients. We investigated whether there may be an unknown common gene by performing functional complementation analysis of cell lines from 10 unrelated patients. Two of the patients were found to have mitochondrial DNA mutations. The other 8 repre- sented 7 different (nuclear) complementation groups, all but 1 of which showed abnormalities of complex I assembly. It is thus unlikely that any one unknown gene accounts for a large proportion of complex I cases. The 2 patients sharing a nuclear complementation group had a similar abnormal complex I assembly profile and were studied further by homozygosity mapping, chromosome transfers, and microarray expression analysis.
  • Mouse Ndufab1 Knockout Project (CRISPR/Cas9)

    Mouse Ndufab1 Knockout Project (CRISPR/Cas9)

    https://www.alphaknockout.com Mouse Ndufab1 Knockout Project (CRISPR/Cas9) Objective: To create a Ndufab1 knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Ndufab1 gene (NCBI Reference Sequence: NM_028177 ; Ensembl: ENSMUSG00000030869 ) is located on Mouse chromosome 7. 5 exons are identified, with the ATG start codon in exon 1 and the TAA stop codon in exon 4 (Transcript: ENSMUST00000033157). Exon 2~4 will be selected as target site. Cas9 and gRNA will be co-injected into fertilized eggs for KO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 2 starts from about 36.11% of the coding region. Exon 2~4 covers 64.1% of the coding region. The size of effective KO region: ~5146 bp. The KO region does not have any other known gene. Page 1 of 9 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 2 3 4 5 Legends Exon of mouse Ndufab1 Knockout region Page 2 of 9 https://www.alphaknockout.com Overview of the Dot Plot (up) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section upstream of Exon 2 is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the Dot Plot (down) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section downstream of Exon 4 is aligned with itself to determine if there are tandem repeats.
  • In Vitro Treatment of Hepg2 Cells with Saturated Fatty Acids Reproduces

    In Vitro Treatment of Hepg2 Cells with Saturated Fatty Acids Reproduces

    © 2015. Published by The Company of Biologists Ltd | Disease Models & Mechanisms (2015) 8, 183-191 doi:10.1242/dmm.018234 RESEARCH ARTICLE In vitro treatment of HepG2 cells with saturated fatty acids reproduces mitochondrial dysfunction found in nonalcoholic steatohepatitis Inmaculada García-Ruiz1,*, Pablo Solís-Muñoz2, Daniel Fernández-Moreira3, Teresa Muñoz-Yagüe1 and José A. Solís-Herruzo1 ABSTRACT INTRODUCTION Activity of the oxidative phosphorylation system (OXPHOS) is Nonalcoholic fatty liver disease (NAFLD) represents a spectrum of decreased in humans and mice with nonalcoholic steatohepatitis. liver diseases extending from pure fatty liver through nonalcoholic Nitro-oxidative stress seems to be involved in its pathogenesis. The steatohepatitis (NASH) to cirrhosis and hepatocarcinoma that occurs aim of this study was to determine whether fatty acids are implicated in individuals who do not consume a significant amount of alcohol in the pathogenesis of this mitochondrial defect. In HepG2 cells, we (Matteoni et al., 1999). Although the pathogenesis of NAFLD analyzed the effect of saturated (palmitic and stearic acids) and remains undefined, the so-called ‘two hits’ model of pathogenesis monounsaturated (oleic acid) fatty acids on: OXPHOS activity; levels has been proposed (Day and James, 1998). Whereas the ‘first hit’ of protein expression of OXPHOS complexes and their subunits; gene involves the accumulation of fat in the liver, the ‘second hit’ expression and half-life of OXPHOS complexes; nitro-oxidative stress; includes oxidative stress resulting in inflammation, stellate cell and NADPH oxidase gene expression and activity. We also studied the activation, fibrogenesis and progression of NAFLD to NASH effects of inhibiting or silencing NADPH oxidase on the palmitic-acid- (Chitturi and Farrell, 2001).
  • Proteomic and Metabolomic Analyses of Mitochondrial Complex I-Deficient

    Proteomic and Metabolomic Analyses of Mitochondrial Complex I-Deficient

    THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 287, NO. 24, pp. 20652–20663, June 8, 2012 © 2012 by The American Society for Biochemistry and Molecular Biology, Inc. Published in the U.S.A. Proteomic and Metabolomic Analyses of Mitochondrial Complex I-deficient Mouse Model Generated by Spontaneous B2 Short Interspersed Nuclear Element (SINE) Insertion into NADH Dehydrogenase (Ubiquinone) Fe-S Protein 4 (Ndufs4) Gene*□S Received for publication, November 25, 2011, and in revised form, April 5, 2012 Published, JBC Papers in Press, April 25, 2012, DOI 10.1074/jbc.M111.327601 Dillon W. Leong,a1 Jasper C. Komen,b1 Chelsee A. Hewitt,a Estelle Arnaud,c Matthew McKenzie,d Belinda Phipson,e Melanie Bahlo,e,f Adrienne Laskowski,b Sarah A. Kinkel,a,g,h Gayle M. Davey,g William R. Heath,g Anne K. Voss,a,h René P. Zahedi,i James J. Pitt,j Roman Chrast,c Albert Sickmann,i,k Michael T. Ryan,l Gordon K. Smyth,e,f,h b2 a,h,m,n3 David R. Thorburn, and Hamish S. Scott Downloaded from From the aMolecular Medicine Division, gImmunology Division, and eBioinformatics Division, Walter and Eliza Hall Institute of Medical Research, Parkville, Victoria 3052, Australia, the bMurdoch Childrens Research Institute, Royal Children’s Hospital and Department of Paediatrics, University of Melbourne, Parkville, Victoria 3052, Australia, the cDépartement de Génétique Médicale, Université de Lausanne, 1005 Lausanne, Switzerland, the dCentre for Reproduction and Development, Monash Institute of Medical Research, Clayton, Victoria 3168, Australia, the hDepartment of Medical Biology
  • Health Effects Support Document for Perfluorooctanoic Acid (PFOA)

    Health Effects Support Document for Perfluorooctanoic Acid (PFOA)

    United States Office of Water EPA 822-R-16-003 Environmental Protection Mail Code 4304T May 2016 Agency Health Effects Support Document for Perfluorooctanoic Acid (PFOA) Perfluorooctanoic Acid – May 2016 i Health Effects Support Document for Perfluorooctanoic Acid (PFOA) U.S. Environmental Protection Agency Office of Water (4304T) Health and Ecological Criteria Division Washington, DC 20460 EPA Document Number: 822-R-16-003 May 2016 Perfluorooctanoic Acid – May 2016 ii BACKGROUND The Safe Drinking Water Act (SDWA), as amended in 1996, requires the Administrator of the U.S. Environmental Protection Agency (EPA) to periodically publish a list of unregulated chemical contaminants known or anticipated to occur in public water systems and that may require regulation under SDWA. The SDWA also requires the Agency to make regulatory determinations on at least five contaminants on the Contaminant Candidate List (CCL) every 5 years. For each contaminant on the CCL, before EPA makes a regulatory determination, the Agency needs to obtain sufficient data to conduct analyses on the extent to which the contaminant occurs and the risk it poses to populations via drinking water. Ultimately, this information will assist the Agency in determining the most appropriate course of action in relation to the contaminant (e.g., developing a regulation to control it in drinking water, developing guidance, or deciding not to regulate it). The PFOA health assessment was initiated by the Office of Water, Office of Science and Technology in 2009. The draft Health Effects Support Document for Perfluoroctanoic Acid (PFOA) was completed in 2013 and released for public comment in February 2014.
  • Low Abundance of the Matrix Arm of Complex I in Mitochondria Predicts Longevity in Mice

    Low Abundance of the Matrix Arm of Complex I in Mitochondria Predicts Longevity in Mice

    ARTICLE Received 24 Jan 2014 | Accepted 9 Apr 2014 | Published 12 May 2014 DOI: 10.1038/ncomms4837 OPEN Low abundance of the matrix arm of complex I in mitochondria predicts longevity in mice Satomi Miwa1, Howsun Jow2, Karen Baty3, Amy Johnson1, Rafal Czapiewski1, Gabriele Saretzki1, Achim Treumann3 & Thomas von Zglinicki1 Mitochondrial function is an important determinant of the ageing process; however, the mitochondrial properties that enable longevity are not well understood. Here we show that optimal assembly of mitochondrial complex I predicts longevity in mice. Using an unbiased high-coverage high-confidence approach, we demonstrate that electron transport chain proteins, especially the matrix arm subunits of complex I, are decreased in young long-living mice, which is associated with improved complex I assembly, higher complex I-linked state 3 oxygen consumption rates and decreased superoxide production, whereas the opposite is seen in old mice. Disruption of complex I assembly reduces oxidative metabolism with concomitant increase in mitochondrial superoxide production. This is rescued by knockdown of the mitochondrial chaperone, prohibitin. Disrupted complex I assembly causes premature senescence in primary cells. We propose that lower abundance of free catalytic complex I components supports complex I assembly, efficacy of substrate utilization and minimal ROS production, enabling enhanced longevity. 1 Institute for Ageing and Health, Newcastle University, Newcastle upon Tyne NE4 5PL, UK. 2 Centre for Integrated Systems Biology of Ageing and Nutrition, Newcastle University, Newcastle upon Tyne NE4 5PL, UK. 3 Newcastle University Protein and Proteome Analysis, Devonshire Building, Devonshire Terrace, Newcastle upon Tyne NE1 7RU, UK. Correspondence and requests for materials should be addressed to T.v.Z.