DOCSLIB.ORG

(MLF1) (NM 001130156) Human Tagged ORF Clone Product Data

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(MLF1) (NM 001130156) Human Tagged ORF Clone Product Data OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC225308 Myeloid leukemia factor 1 (MLF1) (NM_001130156) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Myeloid leukemia factor 1 (MLF1) (NM_001130156) Human Tagged ORF Clone Tag: Myc-DDK Symbol: MLF1 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC225308 representing NM_001130156 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTCAGGATGCTGAACAGCAGTTTTGAGGATGACCCCTTCTTCTCTGAGTCCATTCTTGCACACCGAG AAAATATGCGACAGATGATAAGAAGTTTTTCTGAACCCTTTGGAAGAGACTTGCTCAGTATCTCTGATGG TAGAGGGAGAGCTCATAATCGTAGAGGACATAATGATGGTGAAGATTCTTTGACTCATACAGATGTCAGC TCTTTCCAGACAATGGACCAAATGGTGTCAAATATGAGAAACTATATGCAGAAATTAGAAAGAAACTTCG GTCAACTTTCAGTGGATCCAAATGGACATTCATTTTGTTCTTCCTCAGTTATGACTTATTCCAAAATAGG AGATGAACCGCCAAAGGTTTTTCAGGCCTCAACTCAAACTCGTCGAGCTCCAGGAGGAATAAAGGAAACC AGGAAAGCAATGAGAGATTCTGACAGTGGACTAGAAAAAATGGCTATTGGTCATCATATCCATGACCGAG CTCATGTCATTAAAAAGTCAAAGAACAAGAAGACTGGAGATGAAGAGGTCAACCAGGAGTTCATCAATAT GAATGAAAGTGATGCTCATGCTTTTGATGAGGAGTGGCAAAGTGAGGTTTTGAAGTACAAACCAGGACGA CACAATCTAGGAAACACTAGAATGAGAAGTGTTGGCCATGAGAATCCTGGCTCCCGAGAACTTAAAAGAA GGGAGAAACCTCAACAAAGTCCAGCCATTGAACATGGAAGGAGATCAAATGTTTTGGGGGACAAACTCCA CATCAAAGGCTCATCTGTGAAAAGCAACAAAAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Myeloid leukemia factor 1 (MLF1) (NM_001130156) Human Tagged ORF Clone – RC225308 Protein Sequence: >RC225308 representing NM_001130156 Red=Cloning site Green=Tags(s) MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVS SFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKET RKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK myc-FLAG tag Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_001130156 ORF Size: 807 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Myeloid leukemia factor 1 (MLF1) (NM_001130156) Human Tagged ORF Clone – RC225308 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001130156.1, NM_001130156.2, NP_001123628.1 RefSeq Size: 2263 bp RefSeq ORF: 732 bp Locus ID: 4291 UniProt ID: P58340, A0A140VKD2, Q5HYH4 Protein Families: Druggable Genome MW: 30.6 kDa Gene Summary: This gene encodes an oncoprotein which is thought to play a role in the phenotypic determination of hemopoetic cells. Translocations between this gene and nucleophosmin have been associated with myelodysplastic syndrome and acute myeloid leukemia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • Exploring the Relationship Between Gut Microbiota and Major Depressive Disorders
    E3S Web of Conferences 271, 03055 (2021) https://doi.org/10.1051/e3sconf/202127103055 ICEPE 2021 Exploring the Relationship between Gut Microbiota and Major Depressive Disorders Catherine Tian1 1Shanghai American School, Shanghai, China Abstract. Major Depressive Disorder (MDD) is a psychiatric disorder accompanied with a high rate of suicide, morbidity and mortality. With the symptom of an increasing or decreasing appetite, there is a possibility that MDD may have certain connections with gut microbiota, the colonies of microbes which reside in the human digestive system. In recent years, more and more studies started to demonstrate the links between MDD and gut microbiota from animal disease models and human metabolism studies. However, this relationship is still largely understudied, but it is very innovative since functional dissection of this relationship would furnish a new train of thought for more effective treatment of MDD. In this study, by using multiple genetic analytic tools including Allen Brain Atlas, genetic function analytical tools, and MicrobiomeAnalyst, I explored the genes that shows both expression in the brain and the digestive system to affirm that there is a connection between gut microbiota and the MDD. My approach finally identified 7 MDD genes likely to be associated with gut microbiota, implicating 3 molecular pathways: (1) Wnt Signaling, (2) citric acid cycle in the aerobic respiration, and (3) extracellular exosome signaling. These findings may shed light on new directions to understand the mechanism of MDD, potentially facilitating the development of probiotics for better psychiatric disorder treatment. 1 Introduction 1.1 Major Depressive Disorder Major Depressive Disorder (MDD) is a mood disorder that will affect the mood, behavior and other physical parts.
    [Show full text]
  • Identification of Novel Diagnostic Biomarkers for Thyroid Carcinoma
    www.impactjournals.com/oncotarget/ Oncotarget, 2017, Vol. 8, (No. 67), pp: 111551-111566 Research Paper Identification of novel diagnostic biomarkers for thyroid carcinoma Xiliang Wang1,2, Qing Zhang1, Zhiming Cai1, Yifan Dai3 and Lisha Mou1 1Shenzhen Xenotransplantation Medical Engineering Research and Development Center, Institute of Translational Medicine, Shenzhen Second People's Hospital, First Affiliated Hospital of Shenzhen University, Shenzhen 518035, China 2Department of Biochemistry in Zhongshan School of Medicine, Sun Yat-Sen University, Guangzhou 510080, China 3Jiangsu Key Laboratory of Xenotransplantation, Nanjing Medical University, Nanjing 210029, China Correspondence to: Lisha Mou, email: [email protected] Keywords: thyroid carcinoma; bioinformatics; dysregulation network; biomarker Received: June 27, 2017 Accepted: November 19, 2017 Published: December 04, 2017 Copyright: Wang et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT Thyroid carcinoma (THCA) is the most universal endocrine malignancy worldwide. Unfortunately, a limited number of large-scale analyses have been performed to identify biomarkers for THCA. Here, we conducted a meta-analysis using 505 THCA patients and 59 normal controls from The Cancer Genome Atlas. After identifying differentially expressed long non-coding RNA (lncRNA) and protein coding genes (PCG), we found vast difference in various lncRNA-PCG co-expressed pairs in THCA. A dysregulation network with scale-free topology was constructed. Four molecules (LA16c-380H5.2, RP11-203J24.8, MLF1 and SDC4) could potentially serve as diagnostic biomarkers of THCA with high sensitivity and specificity.
    [Show full text]
  • Predicting Environmental Chemical Factors Associated with Disease-Related Gene Expression Data
    UCSF UC San Francisco Previously Published Works Title Predicting environmental chemical factors associated with disease-related gene expression data. Permalink https://escholarship.org/uc/item/1kj3j6m8 Journal BMC medical genomics, 3(1) ISSN 1755-8794 Authors Patel, Chirag J Butte, Atul J Publication Date 2010-05-06 DOI 10.1186/1755-8794-3-17 Peer reviewed eScholarship.org Powered by the California Digital Library University of California Patel and Butte BMC Medical Genomics 2010, 3:17 http://www.biomedcentral.com/1755-8794/3/17 RESEARCH ARTICLE Open Access PredictingResearch article environmental chemical factors associated with disease-related gene expression data Chirag J Patel1,2,3 and Atul J Butte*1,2,3 Abstract Background: Many common diseases arise from an interaction between environmental and genetic factors. Our knowledge regarding environment and gene interactions is growing, but frameworks to build an association between gene-environment interactions and disease using preexisting, publicly available data has been lacking. Integrating freely-available environment-gene interaction and disease phenotype data would allow hypothesis generation for potential environmental associations to disease. Methods: We integrated publicly available disease-specific gene expression microarray data and curated chemical- gene interaction data to systematically predict environmental chemicals associated with disease. We derived chemical- gene signatures for 1,338 chemical/environmental chemicals from the Comparative Toxicogenomics Database (CTD). We associated these chemical-gene signatures with differentially expressed genes from datasets found in the Gene Expression Omnibus (GEO) through an enrichment test. Results: We were able to verify our analytic method by accurately identifying chemicals applied to samples and cell lines. Furthermore, we were able to predict known and novel environmental associations with prostate, lung, and breast cancers, such as estradiol and bisphenol A.
    [Show full text]
  • A Mouse Model of Rhabdomyosarcoma Originating from the Adipocyte Lineage
    Cancer Cell Article A Mouse Model of Rhabdomyosarcoma Originating from the Adipocyte Lineage Mark E. Hatley,1,2,5 Wei Tang,3 Matthew R. Garcia,1,2,5 David Finkelstein,6 Douglas P. Millay,1 Ning Liu,1 Jonathan Graff,3 Rene L. Galindo,1,2,4,* and Eric N. Olson1,* 1Department of Molecular Biology 2Department of Pediatrics 3Department of Developmental Biology 4Department of Pathology University of Texas Southwestern Medical Center, 5323 Harry Hines Boulevard, Dallas, TX 75390, USA 5Department of Oncology 6Department of Biostatistics St. Jude Children’s Research Hospital, 262 Danny Thomas Place, Memphis, TN 38105, USA *Correspondence: [email protected] (R.L.G.), [email protected] (E.N.O.) http://dx.doi.org/10.1016/j.ccr.2012.09.004 SUMMARY Rhabdomyosarcoma (RMS) is an aggressive skeletal muscle-lineage tumor composed of malignant myoblasts that fail to exit the cell cycle and are blocked from fusing into syncytial muscle. Rhabdomyosar- coma includes two histolopathologic subtypes: alveolar rhabdomyosarcoma, driven by the fusion protein PAX3-FOXO1 or PAX7-FOXO1, and embryonal rhabdomyosarcoma (ERMS), which is genetically heteroge- neous. Here, we show that adipocyte-restricted activation of Sonic hedgehog signaling through expression of a constitutively active Smoothened allele in mice gives rise to aggressive skeletal muscle tumors that display the histologic and molecular characteristics of human ERMS with high penetrance. Our findings suggest that adipocyte progenitors can be a cell of origin for Sonic hedgehog-driven ERMS, showing that RMS can originate from nonskeletal muscle precursors. INTRODUCTION vation domain of FOXO1A (Barr, 2001). Because PAX3 and PAX7 have critical roles in normal muscle development, the fusion Rhabdomyosarcoma (RMS) is an aggressive skeletal muscle- proteins presumably use the DNA binding domains of the PAX lineage malignancy and the most common soft tissue sarcoma proteins to drive malignant myogensis-related developmental in children (Barr and Womer, 2009).
    [Show full text]
  • Systems Genetics in Diversity Outbred Mice Inform BMD GWAS and Identify Determinants of Bone Strength
    ARTICLE https://doi.org/10.1038/s41467-021-23649-0 OPEN Systems genetics in diversity outbred mice inform BMD GWAS and identify determinants of bone strength Basel M. Al-Barghouthi 1,2,8, Larry D. Mesner1,3,8, Gina M. Calabrese1,8, Daniel Brooks4, Steven M. Tommasini 5, Mary L. Bouxsein 4, Mark C. Horowitz5, Clifford J. Rosen 6, Kevin Nguyen1, ✉ Samuel Haddox2, Emily A. Farber1, Suna Onengut-Gumuscu 1,3, Daniel Pomp7 & Charles R. Farber 1,2,3 1234567890():,; Genome-wide association studies (GWASs) for osteoporotic traits have identified over 1000 associations; however, their impact has been limited by the difficulties of causal gene iden- tification and a strict focus on bone mineral density (BMD). Here, we use Diversity Outbred (DO) mice to directly address these limitations by performing a systems genetics analysis of 55 complex skeletal phenotypes. We apply a network approach to cortical bone RNA-seq data to discover 66 genes likely to be causal for human BMD GWAS associations, including the genes SERTAD4 and GLT8D2. We also perform GWAS in the DO for a wide-range of bone traits and identify Qsox1 as a gene influencing cortical bone accrual and bone strength. In this work, we advance our understanding of the genetics of osteoporosis and highlight the ability of the mouse to inform human genetics. 1 Center for Public Health Genomics, School of Medicine, University of Virginia, Charlottesville, VA, USA. 2 Department of Biochemistry and Molecular Genetics, School of Medicine, University of Virginia, Charlottesville, VA, USA. 3 Department of Public Health Sciences, School of Medicine, University of Virginia, Charlottesville, VA, USA.
    [Show full text]
  • 393LN V 393P 344SQ V 393P Probe Set Entrez Gene
    393LN v 393P 344SQ v 393P Entrez fold fold probe set Gene Gene Symbol Gene cluster Gene Title p-value change p-value change chemokine (C-C motif) ligand 21b /// chemokine (C-C motif) ligand 21a /// chemokine (C-C motif) ligand 21c 1419426_s_at 18829 /// Ccl21b /// Ccl2 1 - up 393 LN only (leucine) 0.0047 9.199837 0.45212 6.847887 nuclear factor of activated T-cells, cytoplasmic, calcineurin- 1447085_s_at 18018 Nfatc1 1 - up 393 LN only dependent 1 0.009048 12.065 0.13718 4.81 RIKEN cDNA 1453647_at 78668 9530059J11Rik1 - up 393 LN only 9530059J11 gene 0.002208 5.482897 0.27642 3.45171 transient receptor potential cation channel, subfamily 1457164_at 277328 Trpa1 1 - up 393 LN only A, member 1 0.000111 9.180344 0.01771 3.048114 regulating synaptic membrane 1422809_at 116838 Rims2 1 - up 393 LN only exocytosis 2 0.001891 8.560424 0.13159 2.980501 glial cell line derived neurotrophic factor family receptor alpha 1433716_x_at 14586 Gfra2 1 - up 393 LN only 2 0.006868 30.88736 0.01066 2.811211 1446936_at --- --- 1 - up 393 LN only --- 0.007695 6.373955 0.11733 2.480287 zinc finger protein 1438742_at 320683 Zfp629 1 - up 393 LN only 629 0.002644 5.231855 0.38124 2.377016 phospholipase A2, 1426019_at 18786 Plaa 1 - up 393 LN only activating protein 0.008657 6.2364 0.12336 2.262117 1445314_at 14009 Etv1 1 - up 393 LN only ets variant gene 1 0.007224 3.643646 0.36434 2.01989 ciliary rootlet coiled- 1427338_at 230872 Crocc 1 - up 393 LN only coil, rootletin 0.002482 7.783242 0.49977 1.794171 expressed sequence 1436585_at 99463 BB182297 1 - up 393
    [Show full text]
  • Domestic Turkey (Meleagris Gallopavo): Genome Assembly and Analysis
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Cold Spring Harbor Laboratory Institutional Repository Multi-Platform Next-Generation Sequencing of the Domestic Turkey (Meleagris gallopavo): Genome Assembly and Analysis Rami A. Dalloul1., Julie A. Long2., Aleksey V. Zimin3., Luqman Aslam4, Kathryn Beal5, Le Ann Blomberg2, Pascal Bouffard6, David W. Burt7, Oswald Crasta8,9, Richard P. M. A. Crooijmans4, Kristal Cooper8, Roger A. Coulombe10, Supriyo De11, Mary E. Delany12, Jerry B. Dodgson13, Jennifer J. Dong14, Clive Evans8, Karin M. Frederickson6, Paul Flicek5, Liliana Florea15, Otto Folkerts8,9, Martien A. M. Groenen4, Tim T. Harkins6, Javier Herrero5, Steve Hoffmann16,17, Hendrik-Jan Megens4, Andrew Jiang12, Pieter de Jong18, Pete Kaiser19, Heebal Kim20, Kyu-Won Kim20, Sungwon Kim1, David Langenberger16, Mi-Kyung Lee14, Taeheon Lee20, Shrinivasrao Mane8, Guillaume Marcais3, Manja Marz16,21, Audrey P. McElroy1, Thero Modise8, Mikhail Nefedov18,Ce´dric Notredame22, Ian R. Paton7, William S. Payne13, Geo Pertea15, Dennis Prickett19, Daniela Puiu15, Dan Qioa23, Emanuele Raineri22, Magali Ruffier24, Steven L. Salzberg25, Michael C. Schatz25, Chantel Scheuring14, Carl J. Schmidt26, Steven Schroeder27, Stephen M. J. Searle24, Edward J. Smith1, Jacqueline Smith7, Tad S. Sonstegard27, Peter F. Stadler16,28,29,30,31, Hakim Tafer16,30, Zhijian (Jake) Tu32, Curtis P. Van Tassell27,33, Albert J. Vilella5, Kelly P. Williams8, James A. Yorke3, Liqing Zhang23, Hong-Bin Zhang14, Xiaojun Zhang14, Yang Zhang14,
    [Show full text]
  • Number 11 November 2020 Atlas of Genetics and Cytogenetics in Oncology and Haematology
    Volume 1 - Number 1 May - September 1997 Volume 24 - Number 11 November 2020 Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL INIST-CNRS Scope The Atlas of Genetics and Cytogenetics in Oncology and Haematology is a peer reviewed on-line journal in open access, devoted to genes, cytogenetics, and clinical entities in cancer, and cancer-prone diseases. It is made for and by: clinicians and researchers in cytogenetics, molecular biology, oncology, haematology, and pathology. One main scope of the Atlas is to conjugate the scientific information provided by cytogenetics/molecular genetics to the clinical setting (diagnostics, prognostics and therapeutic design), another is to provide an encyclopedic knowledge in cancer genetics. The Atlas deals with cancer research and genomics. It is at the crossroads of research, virtual medical university (university and post-university e-learning), and telemedicine. It contributes to "meta-medicine", this mediation, using information technology, between the increasing amount of knowledge and the individual, having to use the information. Towards a personalized medicine of cancer. It presents structured review articles ("cards") on: 1- Genes, 2- Leukemias, 3- Solid tumors, 4- Cancer-prone diseases, and also 5- "Deep insights": more traditional review articles on the above subjects and on surrounding topics. It also present 6- Case reports in hematology and 7- Educational items in the various related topics for students in Medicine and in Sciences. The Atlas of Genetics
    [Show full text]
  • Myeloid Leukaemia Factor 1 and Haemopoiesis: Aspects of Mlf1's
    Myeloid Leukaemia Factor 1 and haemopoiesis: Aspects of Mlf1’s regulation and function Clare Morgan BA BSc (Hons) This thesis is presented for the degree of Doctor of Philosophy September 2010 School of Medicine & Pharmacology, University of Western Australia Centre for Medical Research, Western Australian Institute for Medical Research Table of Contents Abstract _____________________________________________________________ i Declaration _________________________________________________________ iii Statement of Candidate Contribution ____________________________________ iv Publications__________________________________________________________v Acknowledgements __________________________________________________vii List of Non-Standard Abbreviations ____________________________________ viii 1. Literature Review__________________________________________________1 1.1 Haemopoiesis _______________________________________________ 1 1.1.1 Primitive and definitive haemopoiesis___________________________ 1 1.1.2 Haemopoietic stem cells_____________________________________ 3 1.1.3 Purification of murine HSCs by fluorescence-activated cell sorting ____ 4 1.1.4 Lineage commitment and plasticity_____________________________ 7 1.1.5 Leukaemia and cancer stem cells ____________________________ 11 1.2 Myeloid Leukaemia Factor 1 __________________________________ 13 1.3 MicroRNAs_________________________________________________ 20 1.3.1 microRNAs in haemopoiesis and leukaemia ____________________ 25 1.3.2 miRNA-29 family__________________________________________
    [Show full text]
  • Multi-Study Reanalysis of 2213 Acute Myeloid Leukemia Patients Reveals
    www.nature.com/scientificreports OPEN Multi-study reanalysis of 2,213 acute myeloid leukemia patients reveals age- and sex-dependent Received: 18 December 2018 Accepted: 14 August 2019 gene expression signatures Published: xx xx xxxx Raeuf Roushangar1,2 & George I. Mias 1,2 In 2019 it is estimated that more than 21,000 new acute myeloid leukemia (AML) patients will be diagnosed in the United States, and nearly 11,000 are expected to die from the disease. AML is primarily diagnosed among the elderly (median 68 years old at diagnosis). Prognoses have signifcantly improved for younger patients, but as much as 70% of patients over 60 years old will die within a year of diagnosis. In this study, we conducted a reanalysis of 2,213 acute myeloid leukemia patients compared to 548 healthy individuals, using curated publicly available microarray gene expression data. We carried out an analysis of normalized batch corrected data, using a linear model that included considerations for disease, age, sex, and tissue. We identifed 974 diferentially expressed probe sets and 4 signifcant pathways associated with AML. Additionally, we identifed 375 age- and 70 sex-related probe set expression signatures relevant to AML. Finally, we trained a k nearest neighbors model to classify AML and healthy subjects with 90.9% accuracy. Our fndings provide a new reanalysis of public datasets, that enabled the identifcation of new gene sets relevant to AML that can potentially be used in future experiments and possible stratifed disease diagnostics. Acute myeloid leukemia (AML) is a heterogeneous malignant disease of the hematopoietic system myeloid cell lineage1–5.
    [Show full text]
  • Bioinformatic Gene Analysis for Potential Biomarkers And
    Zou et al. J Transl Med (2019) 17:45 https://doi.org/10.1186/s12967-019-1790-x Journal of Translational Medicine RESEARCH Open Access Bioinformatic gene analysis for potential biomarkers and therapeutic targets of atrial fbrillation-related stroke Rongjun Zou1†, Dingwen Zhang1†, Lei Lv1†, Wanting Shi2, Zijiao Song3, Bin Yi1, Bingjia Lai4, Qian Chen5, Songran Yang6,7* and Ping Hua1* Abstract Background: Atrial fbrillation (AF) is one of the most prevalent sustained arrhythmias, however, epidemiological data may understate its actual prevalence. Meanwhile, AF is considered to be a major cause of ischemic strokes due to irregular heart-rhythm, coexisting chronic vascular infammation, and renal insufciency, and blood stasis. We studied co-expressed genes to understand relationships between atrial fbrillation (AF) and stroke and reveal potential biomarkers and therapeutic targets of AF-related stroke. Methods: AF-and stroke-related diferentially expressed genes (DEGs) were identifed via bioinformatic analysis Gene Expression Omnibus (GEO) datasets GSE79768 and GSE58294, respectively. Subsequently, extensive target prediction and network analyses methods were used to assess protein–protein interaction (PPI) networks, Gene Ontology (GO) terms and pathway enrichment for DEGs, and co-expressed DEGs coupled with corresponding predicted miRNAs involved in AF and stroke were assessed as well. Results: We identifed 489, 265, 518, and 592 DEGs in left atrial specimens and cardioembolic stroke blood samples at < 3, 5, and 24 h, respectively. LRRK2, CALM1, CXCR4, TLR4, CTNNB1, and CXCR2 may be implicated in AF and the hub- genes of CD19, FGF9, SOX9, GNGT1, and NOG may be associated with stroke. Finally, co-expressed DEGs of ZNF566, PDZK1IP1, ZFHX3, and PITX2 coupled with corresponding predicted miRNAs, especially miR-27a-3p, miR-27b-3p, and miR-494-3p may be signifcantly associated with AF-related stroke.
    [Show full text]
  • The Genetic Basis of Susceptibility to Therapy-Related Leukemia in Mice" (2014)
    Washington University in St. Louis Washington University Open Scholarship All Theses and Dissertations (ETDs) Spring 4-11-2014 The Genetic Basis of Susceptibility to Therapy- related Leukemia in Mice Megan Janke Washington University in St. Louis Follow this and additional works at: https://openscholarship.wustl.edu/etd Recommended Citation Janke, Megan, "The Genetic Basis of Susceptibility to Therapy-related Leukemia in Mice" (2014). All Theses and Dissertations (ETDs). 1240. https://openscholarship.wustl.edu/etd/1240 This Dissertation is brought to you for free and open access by Washington University Open Scholarship. It has been accepted for inclusion in All Theses and Dissertations (ETDs) by an authorized administrator of Washington University Open Scholarship. For more information, please contact [email protected]. WASHINGTON UNIVERSITY IN ST. LOUIS Division of Biology and Biomedical Sciences Molecular Cell Biology Dissertation Examination Committee: Timothy A. Graubert, Chair Jason Weber, Co-Chair Steven Brody John Russell Mark Sands Matthew Walter The Genetic Basis of Susceptibility to Therapy-related Leukemia in Mice by Megan Renee Janke A dissertation presented to the Graduate School of Arts and Sciences of Washington University in partial fulfillment of the requirements for the degree of Doctor of Philosophy May, 2014 St. Louis, Missouri TABLE OF CONTENTS LIST OF FIGURES ...................................................................................................................... iv LIST OF TABLES ...........................................................................................................................v
    [Show full text]