(MLF1) (NM 001130156) Human Tagged ORF Clone Product Data

(MLF1) (NM 001130156) Human Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC225308 Myeloid leukemia factor 1 (MLF1) (NM_001130156) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Myeloid leukemia factor 1 (MLF1) (NM_001130156) Human Tagged ORF Clone Tag: Myc-DDK Symbol: MLF1 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC225308 representing NM_001130156 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTCAGGATGCTGAACAGCAGTTTTGAGGATGACCCCTTCTTCTCTGAGTCCATTCTTGCACACCGAG AAAATATGCGACAGATGATAAGAAGTTTTTCTGAACCCTTTGGAAGAGACTTGCTCAGTATCTCTGATGG TAGAGGGAGAGCTCATAATCGTAGAGGACATAATGATGGTGAAGATTCTTTGACTCATACAGATGTCAGC TCTTTCCAGACAATGGACCAAATGGTGTCAAATATGAGAAACTATATGCAGAAATTAGAAAGAAACTTCG GTCAACTTTCAGTGGATCCAAATGGACATTCATTTTGTTCTTCCTCAGTTATGACTTATTCCAAAATAGG AGATGAACCGCCAAAGGTTTTTCAGGCCTCAACTCAAACTCGTCGAGCTCCAGGAGGAATAAAGGAAACC AGGAAAGCAATGAGAGATTCTGACAGTGGACTAGAAAAAATGGCTATTGGTCATCATATCCATGACCGAG CTCATGTCATTAAAAAGTCAAAGAACAAGAAGACTGGAGATGAAGAGGTCAACCAGGAGTTCATCAATAT GAATGAAAGTGATGCTCATGCTTTTGATGAGGAGTGGCAAAGTGAGGTTTTGAAGTACAAACCAGGACGA CACAATCTAGGAAACACTAGAATGAGAAGTGTTGGCCATGAGAATCCTGGCTCCCGAGAACTTAAAAGAA GGGAGAAACCTCAACAAAGTCCAGCCATTGAACATGGAAGGAGATCAAATGTTTTGGGGGACAAACTCCA CATCAAAGGCTCATCTGTGAAAAGCAACAAAAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Myeloid leukemia factor 1 (MLF1) (NM_001130156) Human Tagged ORF Clone – RC225308 Protein Sequence: >RC225308 representing NM_001130156 Red=Cloning site Green=Tags(s) MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVS SFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKET RKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK myc-FLAG tag Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_001130156 ORF Size: 807 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Myeloid leukemia factor 1 (MLF1) (NM_001130156) Human Tagged ORF Clone – RC225308 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001130156.1, NM_001130156.2, NP_001123628.1 RefSeq Size: 2263 bp RefSeq ORF: 732 bp Locus ID: 4291 UniProt ID: P58340, A0A140VKD2, Q5HYH4 Protein Families: Druggable Genome MW: 30.6 kDa Gene Summary: This gene encodes an oncoprotein which is thought to play a role in the phenotypic determination of hemopoetic cells. Translocations between this gene and nucleophosmin have been associated with myelodysplastic syndrome and acute myeloid leukemia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us