Charles River
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Table of Contents Meet-At-A-Glance
Santa Anita Park 2017 Spring Media Guide Table of Contents Meet-At-A-Glance . 2 The Gold Cup at Santa Anita . 28-29 Information Resources . 3 Honeymoon Stakes . 30-31 Santa Anita Spring Attendance and Handle . 4 Kona Gold Stakes . 31 Santa Anita Spring Opening Day Statistics . 4 Landaluce Stakes . 32-33 Michael Wrona Biography . 4 Lazaro Barrera Stakes . 33 Santa Anita Spring Meet Attendance . 5 Lennyfrommalibu Stakes . 33 Santa Anita Spring 2016 Meet Handle, Payoffs & Top Five Days . 5 Los Angeles Stakes . 34-35 Santa Anita Spring Meet Annual Media Poll . 6 Melair Stakes . 36 Santa Anita Track Records . 7 Monrovia Stakes . 36 Leaders at Previous Santa Anita Spring Meets . 8 Precisionist Stakes . 37-38 Santa Anita 2016 Spring Meet Standings . 9 San Carlos Stakes . 38-39 Roster of Santa Anita Jockeys . 10 San Juan Capistrano Stakes . 40-41 Roster of Santa Anita Trainers . 11 Santa Anita Juvenile . 42-43 2016 Santa Anita Spring Meet Stakes Winners . 12 Santa Barbara Stakes . 44-45 2016 Santa Anita Spring Meet Longest Priced Stakes Winners . 12 Senorita Stakes . 46 Stakes Histories . 13 Shoemaker Mile . 47-48 Adoration Stakes . 14-15 Snow Chief Stakes . 49 Affirmed Stakes . 15 Summertime Oaks . 50-51 American Stakes . 16-17 Thor's Echo Stakes . 51 Beholder Mile . 18-19 Thunder Road Stakes . 51 Californian Stakes . 20-21 Wilshire Stakes . 52 Charles Whittingham Stakes . 22 Satellite Wagering Directory . 53 Crystal Water Stakes . 23 Los Angeles Turf Inc . Club Officers/Administration . 54-55 Daytona Stakes . 23 Visitors Guide/Map of Los Angeles Freeways . 56 Desert Stormer Stakes . 24 Local Hotels and Restaurants . -
Graydar Oxbow
GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition. -
KENNEDY Entered Stud in 2012
KEKENNNNEEDYDY 2008 Dark Bay or Brown - Dosage Profile: 6-12-18-0-0; DI: 3.00; CD: +0.67 Bold Ruler RACE AND (STAKES) RECORD Boldnesian Alanesian Age Starts 1st 2nd 3rd Earnings Bold Reasoning Hail to Reason 2 2 0 1 0 $6,869 Reason to Earn Sailing Home 3 5 1 0 0 23,720 Seattle Slew Round Table 7 1 1 0 $30,589 Poker Glamour My Charmer Jet Action At 3, WON a maiden special weight race at Penn National Fair Charmer Myrtle Charm A.P. Indy (1989) (1 mi., defeating Runforhonor, Volo Del Vento, H W *Nasrullah Bold Ruler Goodie, etc.). Miss Disco Secretariat *Princequillo Somethingroyal IN THE STUD Imperatrice Weekend Surprise Tom Fool KENNEDY entered stud in 2012. His first foals will arrive in Buckpasser Busanda 2013. Lassie Dear Sir Gaylord Gay Missile Missy Baba MALE LINE Kennedy Nearctic Northern Dancer KENNEDY is by A.P. INDY, classic winner of 8 races to 3, Natalma Vice Regent *Menetrier $2,979,815, horse of the year, champion 3-year-old Victoria Regina Victoriana colt, Belmont S.-G1, Breeders’ Cup Classic-G1, etc. Deputy Minister Bunty Lawless Leading sire twice, sire of 147 stakes winners, incl.-- Bunty's Flight Broomflight Mint Copy BERNARDINI. 6 wins in 8 starts at 3, $3,060,480, cham- Jabneh Shakney pion 3-year-old colt, Preakness S.-G1, Travers S.-G1, Grass Shack Lovely Regina (2001) Mr. Prospector Jockey Club Gold Cup-G1, Jim Dandy S.-G2, Withers Fappiano Killaloe S.-G3, 2nd Breeders’ Cup Classic-G1. Sire. Quiet American Dr. -
Bay Filly Barn 12 Hip No
Consigned by Sunrise Stables South Hip No. Barn 484 Bay Filly 12 Storm Bird Storm Cat ......................... Terlingua Lake Austin....................... Seattle Slew Lakeway............................ Bay Filly Milliardaire March 30, 2003 Lyphard Dahar................................ Dahlia Last Number ..................... (1989) Northjet (IRE) Jibberish........................... Jibber Jabber By LAKE AUSTIN (1997). Winner of 3 races at 3, $124,373. Half-brother to stakes winner Sluice. His first foals are 2-year-olds of 2005. Son of stakes winner Storm Cat, leading sire twice, sire of 128 stakes winners, 7 champions, including Giant's Causeway (Esat Digifone Irish Champion S. [G1], etc.), Storm Flag Flying (to 4, 2004, $1,951,828, Long John Silver's Breeders' Cup Juvenile Fillies [G1] (AP, $520,000), etc.), Sweet Catomine ($1,059,600, Breeders' Cup Juvenile Fillies [G1] (LS, $520,000), etc.). 1st dam LAST NUMBER, by Dahar. Dam of 3 other registered foals, 3 of racing age, 3 to race, 2 winners, including-- Storm Number Nine (g. by Future Storm). 4 wins, 2 to 4, $59,359, 3rd West Virginia House of Delegates Speaker's Cup (MNR, $3,074). 2nd dam JIBBERISH, by Northjet (IRE). Unraced. Dam of 1 other foal, which has not raced. 3rd dam JIBBER JABBER, by Jacinto. Unraced. Sister to JACKAL. Dam of 7 other foals, 6 to race, 4 winners, including-- LAWYER TALK. 6 wins, 2 to 5, $374,960, Gardenia H. [G3], Wintergreen S. (TP, $19,923), 2nd Budweiser H. [G3], Queens H. [G3], Fleur de Lis H. [G3], Ak-Sar-Ben Budweiser Breeders' Cup H. [L] (AKS, $30,770), 3rd Delaware H. [G1], Falls City H. -
HUNTING SEASON Barn 28 Hip No
Consigned by Bluegrass Thoroughbred Services Inc., Agent I Hip No. HUNTING SEASON Barn 662 Dark Bay or Brown Filly; foaled 2016 28 Unbridled Empire Maker ........................ Toussaud Pioneerof the Nile ................ Lord At War (ARG) Star of Goshen ...................... Castle Eight HUNTING SEASON Storm Cat Giant's Causeway ................ Mariah's Storm Flying Spur .......................... (2006) Seattle Slew Lakeway ................................ Milliardaire By PIONEEROF THE NILE (2006). Black-type winner of $1,634,200, CashCall Futurity [G1] (HOL, $400,000), etc. Among the leading sires, sire of 8 crops of racing age, 717 foals, 452 starters, 32 black-type winners, 311 winners of 843 races and earning $43,004,430, 4 champions, including American Pharoah (Triple Crown, 9 wins, $8,650,300, Kentucky Derby [G1] (CD, $1,- 418,800), etc.), Classic Empire ($2,520,220, Breeders' Cup Juvenile [G1] (SA, $1,100,000), etc.), and of Midnight Storm [G1] (10 wins, $1,783,110). 1st dam Flying Spur , by Giant's Causeway. Winner at 3, $198,821, 2nd Fair Grounds Oaks [G2] (FG, $80,000), 3rd Kentucky Oaks [G1] (CD, $54,341). Sister to Front Range . Dam of 3 other registered foals, 2 of racing age, 1 to race-- Admiral Shepard (g. by Malibu Moon). Winner at 4 and 5, $79,452. 2nd dam LAKEWAY , by Seattle Slew. 7 wins in 14 starts, 2 to 4, $965,330, Mother Goose S. [G1] , Santa Anita Oaks [G1] , Hollywood Oaks [G1] , Las Virgenes S. [G1] , Churchill Downs Budweiser Breeders' Cup H. [G2] , 2nd Kentucky Oaks [G1] , Alabama S. [G1] , Chula Vista H. [G2] , etc. Sister to Devine [L], half-sister to Monarchoftheglen [L]. -
GOLDEN SLEW 1999 Bay - Height 17.2 - Dosage Profile: 13-1-12-2-0; DI: 2.50; CD: +0.89
GOLDEN SLEW 1999 Bay - Height 17.2 - Dosage Profile: 13-1-12-2-0; DI: 2.50; CD: +0.89 RACE AND (STAKES) RECORD *Nasrullah Bold Ruler Miss Disco Age Starts 1st 2nd 3rd Earnings Boldnesian Polynesian 2 unraced Alanesian Alablue 3 5100 $27,720 Bold Reasoning *Turn-to 4 5000 360 Hail to Reason Nothirdchance 10 100 $28,080 Reason to Earn Wait a Bit Sailing Home Marching Home Seattle Slew (1974) At 3, WON a maiden special weight race at Belmont Park (1 *Princequillo Round Table 1/16 mi., defeating This Guns for Hire, Foreign Authori- *Knight’s Daughter Poker ty, Indiana Knight, etc.). *Nasrullah Glamour Striking My Charmer IN THE STUD Jet Pilot Jet Action Busher GOLDEN SLEW entered stud in 2004. Fair Charmer Alsab Myrtle Charm Crepe Myrtle STATISTICAL SUMMARY Golden Slew Native Dancer (Through September 28, 2009) Raise a Native Raise You Mr. Prospector 3 crops Lifetime Lifetime 2yo Nashua Gold Digger Foals of racing age 30 30 Sequence Gold Alert Starters (/Fls) 12(40%) 8(27%) *Ribot Arts and Letters Winners (/Str) 2(17%) 0(0%) All Beautiful Croquis Total Starts 67 25 Cyane Unity Hall Total Wins (/Starts) 2(3%) 0(0%) Rum Bottle Bay Golden Bri (1992) Total Earnings $78,898 $26,493 Nearco Nearctic *Lady Angela Avg. Earnings (/Str) $6,575 $3,312 Briartic Round Table Avg. Earnings (/Start) $1,178 $1,060 Sweet Lady Briar Parading Lady Stakes Wnrs (/Str) 0(0%) 0(0%) Princess Bri Raise a Native Stakes Horses (/Str) 0(0%) 0(0%) Majestic Prince Gay Hostess Avg. -
AUTONOMY (IRE) Bay Horse; Foaled 1997 Never Bend Mill Reef
AUTONOMY (IRE) Bay Horse; foaled 1997 Never Bend Mill Reef .......................... Milan Mill Doyoun ............................ Kashmir II Dumka .............................. Faizebad (FR) AUTONOMY (IRE) *Sea-Bird Arctic Tern ........................ Bubbling Beauty Debbie's Next .................... (1986) Raise a Native Babes Sis .......................... Sleek Dancer By DOYOUN (1985). Classic winner of $356,189, General Accident Two Thou - sand Guineas [G1] , etc. Sire of 15 crops of racing age, 446 foals, 319 starters, 25 black-type winners, 202 winners of 695 races and earning $16,577,070, 5 champions, including Daylami ($4,614,762, Dubai Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Kalanisi ($2,148,836, Breeders' Cup Turf [G1] , etc.), and of Manndar (IRE) [G1] (4 wins, $1,128,835), Margarula [G1] ($280,244), Manntari [G1] ($105,496). 1st dam DEBBIE'S NEXT, by Arctic Tern. Placed at 3 in England. Dam of 16 registered foals, 16 of racing age, 14 to race, 11 winners, including-- CAFFE LATTE (IRE) (f. by Seattle Dancer). 2 wins in 3 starts at 3, 34,758, in France, Prix Melisande; 3 wins at 4, $640,137, in N.A./U.S., €Ramona H. [G1] , Santa Barbara H. [G2] , 2nd Yellow Ribbon S. [G1] , San Clemente H. [G2] . (Total: $676,885). Dam of 5 winners, including-- Expresso Star (c. by War Chant). 4 wins at 3 and 4, £104,432, in Eng - land, 3rd Extrabet.com Huxley S. [G3] . (Total: $156,624). AUTONOMY (IRE) (c. by Doyoun). Black-type winner, see record. La Gomera (IRE) (f. by Hamas (IRE)). Winner at 4, 23,650, in France. (Total: $25,283). -
(USA) Alluvial Buckpasser Bayou Alydar Raise a Native S
From Knockainey Stud 855 855 Bold Reasoning Slew O' Gold Seattle Slew My Charmer (USA) Buckpasser MERMAID BEACH Alluvial (GB) Bayou (1991) Raise A Native Alydar Chesnut Mare Haiati (USA) Sweet Tooth (1985) Northern Dancer Northern Fable Fairway Fable 1st dam Haiati (USA): 4 wins, £29,904 viz. 2 wins and placed twice viz. 2nd Hoover Fillies' Mile, Gr.2 and Sheraton Park Tower Lupe S., L.; also 2 wins in U.S.A. and placed 4 times inc. 2nd Distaff H., Gr.2, Shirley Jones H., Gr.3 and 3rd Johnnie Walker Black Classic H., Gr.2; dam of 6 winners inc.: HALEAKALA (IRE) (f. by Kris): 3 wins at 3 to 5 at home and in U.S.A. and £53,988 inc. Bug Brush S., L., placed 3rd Bushel-n-Peck H., L.; dam of 2 winners. Blue Burner (USA) (c. by French Deputy (USA)): 4 wins in U.S.A. and $338,300, placed 2nd Florida Derby, Gr.1 and 3rd Fountain of Youth S., Gr.1. Highgain (USA): 4 wins in U.S.A. and $137,109 and placed 17 times. Swift Thunder (USA): 3 wins at 3 in U.S.A. and £27,691 and placed 3 times. Haiaccept (USA): 2 wins at 3 and 4, 2005 in U.S.A. 2nd dam NORTHERN FABLE (USA): 5 wins in U.S.A. and $176,000 inc. Palomar H., Gr.3; dam of 7 winners inc.: Haiati (USA) (f. by Alydar (USA)): see above. Quiet Mike (USA): 10 wins in U.S.A. and $295,433. -
DEVINE COZZENE Barn 7 Hip No. 3368
Consigned by Greenfield Farm (B. D. Gibbs Farm LLC), Agent I Barn Hip No. 7 DEVINE COZZENE 3368 Dark Bay or Brown Colt; foaled 2002 Fortino II Caro (IRE)............................. Chambord Cozzene ................................ Prince John Ride the Trails....................... Wildwook DEVINE COZZENE Bold Reasoning Seattle Slew.......................... My Charmer Devine................................... (1995) Alydar Milliardaire ........................... Priceless Fame By COZZENE (1980). Champion grass horse, stakes winner of $978,152, Breeders' Cup Mile [G1], etc. Leading sire, sire of 17 crops of racing age, 845 foals, 649 starters, 66 stakes winners, 481 winners of 1627 races and earning $43,585,677 & $294,970(CAN) in N.A., including champions Ad- mire Cozzene (in Japan, Yasuda Kinen, etc.), Cozzene's Prince ($1,- 270,057, River City H. [L] (CD, $73,060), etc.), Santa Amelia [L] ($475,- 230), Hasten To Add ($294,981, in N.A., Laurel Turf Cup S. [G3], etc.). 1st dam Devine, by Seattle Slew. 3 wins at 3 and 4, $94,575, 2nd Wild Rose H. [L] (PRM, $10,000). Sister to LAKEWAY. Dam of 3 other registered foals, 3 of racing age, including a 2-year-old of 2006, none to race. 2nd dam MILLIARDAIRE, by Alydar. 2 wins in 2 starts at 4, $17,400. Sister to SARATOGA SIX, Priceless Pearl [G3], half-sister to DUNBEATH, Khwlah. Dam of-- LAKEWAY (f. by Seattle Slew). 7 wins in 14 starts, 2 to 4, $965,330, Mother Goose S. [G1], Santa Anita Oaks [G1], Hollywood Oaks [G1], Las Virgenes S. [G1], Churchill Downs Budweiser Breeders' Cup H. [G2], 2nd Kentucky Oaks [G1], Alabama S. [G1], Chula Vista H. -
Santa Anita Park
S ANTA A NITA P ARK 2015 Spring/Summer Media Guide Table of Contents Stakes Schedule ............................................ Inside Front Cover Last Tycoon Stakes .................................................. 30 Meet-At-A-Glance ........................................................ 2 Lazaro Barbara Stakes ............................................... 31 Information Resources..................................................... 3 Los Angeles Handicap ................................................ 32 Santa Anita Track Records and Statistics ....................................... 4 Melair Stakes ...................................................... 33 Santa Anita Spring Meeting Attendance and Handle............................... 5 Mizdirection Stakes.................................................. 34 Santa Anita Spring Meeting Stakes Winners .................................... 6 Precisionist Stakes .................................................. 34 Santa Anita Spring Meeting Media Poll ........................................ 7 Royal Heroine Stakes ................................................ 35 Santa Anita Spring Meeting Leaders .......................................... 8 San Juan Capistrano Stakes ........................................ 36-39 Roster of Santa Anita Jockeys ............................................... 9 Santa Anita Juvenile .............................................. 40-41 Roster of Santa Anita Trainers .............................................. 10 Senorita Stakes.................................................... -
Pedigree Insights by Andrew Caulfield
Andrew Caulfield, July 13, 2010-Gio Ponti PEDIGREE INSIGHTS BY ANDREW CAULFIELD Saturday, Belmont Park MAN O' WAR S.-GI, $600,000, BEL, 7-10, 3yo/up, 1 3/8mT, 2:16 1/5, fm. 1--GIO PONTI, 120, h, 5, by Tale of the Cat 1st Dam: Chipeta Springs (SP), by Alydar 2nd Dam: Salt Spring (Arg), by Salt Marsh 3rd Dam: Jungle Mythologic (Arg), by Mount Athos (GB) ($95,000 RNA yrl '06 KEESEP; $45,000 RNA 2yo >07 FTFFEB). O-Castleton Lyons; B-Kilboy Estate Inc (KY); T-Christophe Clement; J-Ramon A Dominguez; $360,000. Lifetime Record: Ch. Older Horse & Ch. Turf Horse, 19-10-6-0, $4,123,800. *1/2 to Fisher Pond (A.P. Indy), SW & MGSP, $251,490; and Bon Jovi Girl (Malibu Moon), MSW & GISP, $512,443. Click for the eNicks report & 5-cross pedigree. Werk Nick Rating: A. Click for the brisnet.com chart, the brisnet.com PPs o r the free brisnet.com catalogue-style pedigree. Video, sponsored by Taylor Made. As it is now nearly 20 years since the magnificent Alydar met his horrific death at Calumet, we cannot expect to see him cropping up as the broodmare sire of many more Grade I winners of the calibre of Gio Ponti. This champion turf horse recently repeated his 2009 victory in the Man O= War S. and this welcome return to the winner=s circle has pushed the Tale of the Cat horse=s earnings past the $4-million mark. With his youngest daughters already 19 years old, the number of active producers among Alydar=s 320 broodmare daughters must be dwindling fast, so we are nearing the end of a very productive era. -
2012 Stallion Register
WESTERN EXPRESSION Gone West—Tricky Game, by Majestic Light Barbara Livingston photo Barbara Ranks Among Oklahoma’s Top Ten Sires by Lifetime AEI Sire of Multiple Graded Stakes Winner I LOST MY CHOO-NTR one of the World’s Fastest Milers - 1:33 2/5 Exceptional Sale Prices in 2011, $52,000, $22,000, $20,000, etc. buyers include: David Ross, Hidden Brook Farm, Alan Quartucci, Kirk & Judy Robison, Adena Springs & Midwest Thoroughbreds A G1-Pl of GONE WEST in Oklahoma, sire of leading International sires: Elusive Quality, Grand Slam, Proud Cititzen, Speightstown, Canadian Frontier, etc. A consistent source of durable runners-16 stakes horses and 24 earners of $100,000 or more from his first five crops. HIGHCLIFF FARM NATIONALLY RANKED Inquires to Bill Kirton Delanson, New York KIRTON FARMS email: [email protected] Inquiries to Suzie O’Cain (518) 573-2304 or C. Lynwood O’Cain, D.V.M., Farm Mgr. & Resident Veterinarian, HIGHCLIFF 944 Eatons Corners Rd., Delanson, NY 12053 | Phone (518) 875-6168 | Fax (518) 875-6298 Rt. 2, Box 107 • Turpin, OK 73950 Nominated to Breeders’ Cup, Oklahoma Stallions Stakes E-mail: [email protected] | Web Site: www.highcliff.com 580-778-3123 Accredited Oklahoma-BredFarm Stallion Owned by Danny R. Caldwell Earned $68,035 (918) 658-8284 Sold for $475,000 in Standing Stud at 2004 Keeneland Yearling Sunlight Farms Sale Sallisaw, Oklahoma (918) 775-3501 Accredited Oklahoma Stud Fee: $500 Stallion AAIFRF ICROMMAMTAIFNDER 20062004 BayBay -- DosageDosage Profile:Profile: 9-8-13-2-2;3-0-7-0-0; DI: DI: 1.86; 2.24; CD: CD: +0.60 +0.59 RACE AND (STAKES) RECORD RaiseRaise a a Native Native RACE AND (STAKES) RECORD Mr.Mr.