DOCSLIB.ORG

Bay Filly Barn 12 Hip No

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Bay Filly Barn 12 Hip No Consigned by Sunrise Stables South Hip No. Barn 484 Bay Filly 12 Storm Bird Storm Cat ......................... Terlingua Lake Austin....................... Seattle Slew Lakeway............................ Bay Filly Milliardaire March 30, 2003 Lyphard Dahar................................ Dahlia Last Number ..................... (1989) Northjet (IRE) Jibberish........................... Jibber Jabber By LAKE AUSTIN (1997). Winner of 3 races at 3, $124,373. Half-brother to stakes winner Sluice. His first foals are 2-year-olds of 2005. Son of stakes winner Storm Cat, leading sire twice, sire of 128 stakes winners, 7 champions, including Giant's Causeway (Esat Digifone Irish Champion S. [G1], etc.), Storm Flag Flying (to 4, 2004, $1,951,828, Long John Silver's Breeders' Cup Juvenile Fillies [G1] (AP, $520,000), etc.), Sweet Catomine ($1,059,600, Breeders' Cup Juvenile Fillies [G1] (LS, $520,000), etc.). 1st dam LAST NUMBER, by Dahar. Dam of 3 other registered foals, 3 of racing age, 3 to race, 2 winners, including-- Storm Number Nine (g. by Future Storm). 4 wins, 2 to 4, $59,359, 3rd West Virginia House of Delegates Speaker's Cup (MNR, $3,074). 2nd dam JIBBERISH, by Northjet (IRE). Unraced. Dam of 1 other foal, which has not raced. 3rd dam JIBBER JABBER, by Jacinto. Unraced. Sister to JACKAL. Dam of 7 other foals, 6 to race, 4 winners, including-- LAWYER TALK. 6 wins, 2 to 5, $374,960, Gardenia H. [G3], Wintergreen S. (TP, $19,923), 2nd Budweiser H. [G3], Queens H. [G3], Fleur de Lis H. [G3], Ak-Sar-Ben Budweiser Breeders' Cup H. [L] (AKS, $30,770), 3rd Delaware H. [G1], Falls City H. [G3], Budweiser H. [G3], Turfway Budweiser Breeders' Cup H. [L] (TP, $15,595). Producer. 4th dam ALANESIAN, by Polynesian. 9 wins, 2 to 4, $136,997, New Castle S., etc. Half-sister to MIDDLE BROTHER ($119,544). Dam of 8 winners, incl.-- PRINCESSNESIAN. 11 wins to 5, $332,035, Hollywood Gold Cup H., etc. BOLDNESIAN. 4 wins in 5 starts at 3, $107,625, Santa Anita Derby. Sire. JACKAL. 4 wins at 2 and 3, $36,382, National Stallion S. Sire. Flush. 3 wins at 3 and 4, $27,786, 3rd Gotham S.-G2. Sire. Quillesian. Placed at 3, $3,325. Dam of REVIDERE ($330,019, champion 3-year-old filly). Granddam of BIO ($516,957, Sapling S. [G2], etc.), etc. Herbalesian. Unraced. Dam of RIDE THE RAILS [L] (4 wins, $255,096, sire), SEEKER'S JOURNEY ($237,191, sire), FORLAURUS [G3] (sire). Stay At Home. Unraced. Dam of HOME GUARD (sire), BOONES CABIN. Table of Contents. Unraced. Dam of INDEX’S (dam of ZEDE [L], $232,111; Nostra [G3]; granddam of VEEDOR [G1], champion twice in Chile). Granddam of MISS DOMINIQUE [L] ($385,678), SAGASIOUS [G2], etc. RACE RECORD: Has not started. Engagements: OBS Championship S., Florida Stallion S., Sunshine Mil- lions. Registered Florida-bred..
Load more

Recommended publications
  • Kentucky Moon (2014)
    TesioPower Rancho San Antonio Kentucky Moon (2014) Intentionally Intent 8 In Reality My Recipe 5-j My Dear Girl Rough 'n Tumble 1 Relaunch (1976) Iltis 21-a THE AXE II MAHMOUD 9 Foggy Note Blackball 1 Silver Song Royal Note 12 Cee's Tizzy (1987) Beadah 3 NORTHERN DANCER Nearctic 14 LYPHARD Natalma 2 Goofed Court Martial 1 Tizly (1981) Barra II 17 Trevieres Worden II 13 Tizna Vamarie 4 Noris Licencioso 12-a Tiznow (1997) Nizarda 9-g Bold Reasoning Boldnesian 4 SEATTLE SLEW Reason To Earn 1-k My Charmer Poker 1 Seattle Song (1981) Fair Charmer 13-c Prince Blessed PRINCEQUILLO 1 Incantation Dog Blessed 21-a Magic Spell Flushing II 14-f Cee's Song (1986) Subterranean 4 NORTHERN DANCER Nearctic 14 Nice Dancer Natalma 2 Nice Princess Le Beau Prince 12-e Lonely Dancer (1975) Happy Night II 1-e Pia Star OLYMPIA 4 Sleep Lonely Inquisitive 5-j Sulenan Tompion A1 Gemologist (2009) Blue Canary 26 Polynesian Unbreakable 4 NATIVE DANCER Black Polly 14-a Geisha Discovery 23 Raise A Native (1961) Miyako 5-f Case Ace Teddy 2 Raise You Sweetheart 1-k Lady Glory American Flag 7 MR PROSPECTOR (1970) Beloved 8-f NASRULLAH NEARCO 4 Nashua Mumtaz Begum 9 Segula Johnstown 17 Gold Digger (1962) Sekhmet 3-m Count Fleet Reigh Count 2 Sequence Quickly 6 Miss Dogwood BULL DOG 16 Crystal Shard (1994) Myrtlewood 13 NEARCO Pharos 13 Nearctic Nogara 4 Lady Angela Hyperion 6 NORTHERN DANCER (1961) Sister Sarah 14 NATIVE DANCER Polynesian 14 Natalma Geisha 5-f Almahmoud MAHMOUD 9 Sulemeif (1980) Arbitrator 2-d OLYMPIA Heliopolis 8 Creme Dela Creme Miss Dolphin 4-p Judy
    [Show full text]
  • Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’S Plate 3RD Belmont Stakes
    Northern Dancer 90th May 2, 1964 THE WINNER’S PEDIGREE AND CAREER HIGHLIGHTS Pharos Nearco Nogara Nearctic *Lady Angela Hyperion NORTHERN DANCER Sister Sarah Polynesian Bay Colt Native Dancer Geisha Natalma Almahmoud *Mahmoud Arbitrator YEAR AGE STS. 1ST 2ND 3RD EARNINGS 1963 2 9 7 2 0 $ 90,635 1964 3 9 7 0 2 $490,012 TOTALS 18 14 2 2 $580,647 At 2 Years WON Summer Stakes, Coronation Futurity, Carleton Stakes, Remsen Stakes 2ND Vandal Stakes, Cup and Saucer Stakes At 3 Years WON Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’s Plate 3RD Belmont Stakes Horse Eq. Wt. PP 1/4 1/2 3/4 MILE STR. FIN. Jockey Owner Odds To $1 Northern Dancer b 126 7 7 2-1/2 6 hd 6 2 1 hd 1 2 1 nk W. Hartack Windfields Farm 3.40 Hill Rise 126 11 6 1-1/2 7 2-1/2 8 hd 4 hd 2 1-1/2 2 3-1/4 W. Shoemaker El Peco Ranch 1.40 The Scoundrel b 126 6 3 1/2 4 hd 3 1 2 1 3 2 3 no M. Ycaza R. C. Ellsworth 6.00 Roman Brother 126 12 9 2 9 1/2 9 2 6 2 4 1/2 4 nk W. Chambers Harbor View Farm 30.60 Quadrangle b 126 2 5 1 5 1-1/2 4 hd 5 1-1/2 5 1 5 3 R. Ussery Rokeby Stables 5.30 Mr. Brick 126 1 2 3 1 1/2 1 1/2 3 1 6 3 6 3/4 I.
    [Show full text]
  • 23 Bay Filly
    Barn 3D Hip No. Property of Tenlane Farm, Trackside Farm (Tom Evans), Agent 23 Bay Filly Quiet American Real Quiet . { Really Blue Midnight Lute . Dehere { Candytuft . { Bolt From the Blue Bay Filly . Hold Your Peace March 16, 2010 Meadowlake . { Suspicious Native {Ma Kitty . In Reality (1998) { Taruma . { Table of Contents By MIDNIGHT LUTE (2003), black type wnr of 6 races, $2,690,600, champ- ion, Breeders’ Cup Sprint [G1] twice, Forego S. [G1], Perryville S. [G3]- ntr, 2nd Cigar Mile H. [G1], San Fernando Breeders’ Cup [G2], 3rd Mali- bu S. [G1]. Son of Real Quiet, $3,271,802, champion, Ky. Derby [G1], etc., sire of 15 black type winners. His first foals are yearlings of 2011. 1st dam Ma Kitty, by Meadowlake. Winner at 3 and 4, $159,644, 3rd Belle Mahone S. [L] (WO, $11,550-CAN). Dam of 4 foals of racing age, including a 2- year-old of 2011, three to race, including-- One Brave Cat (c. by Lion Heart). Winner at 2, 2010, $10,209. 2nd dam TARUMA, by In Reality. Dam of 9 winners, including-- SAGASIOUS (f. by Quest for Fame-GB). 3 wins at 3, $115,122, Reeve Schley, Jr. S. [G2], 3rd Sands Point H. [L] (BEL, $12,232). MISS DOMINIQUE (f. by Private Account). 6 wins at 4 and 5, $385,678, Vieille Vigne H. [L] (DMR, $36,770), Run for the Roses H. [L] (SA, $35,- 200), 2nd Reminiscing H. [L], Commissary H.-R, Ladyhawke Ranch H. [R], 3rd Breeders’ Cup Distaff [G1], Spinster S. [G1]. Producer. Ma Kitty (f.
    [Show full text]
  • Table of Contents Meet-At-A-Glance
    Santa Anita Park 2017 Spring Media Guide Table of Contents Meet-At-A-Glance . 2 The Gold Cup at Santa Anita . 28-29 Information Resources . 3 Honeymoon Stakes . 30-31 Santa Anita Spring Attendance and Handle . 4 Kona Gold Stakes . 31 Santa Anita Spring Opening Day Statistics . 4 Landaluce Stakes . 32-33 Michael Wrona Biography . 4 Lazaro Barrera Stakes . 33 Santa Anita Spring Meet Attendance . 5 Lennyfrommalibu Stakes . 33 Santa Anita Spring 2016 Meet Handle, Payoffs & Top Five Days . 5 Los Angeles Stakes . 34-35 Santa Anita Spring Meet Annual Media Poll . 6 Melair Stakes . 36 Santa Anita Track Records . 7 Monrovia Stakes . 36 Leaders at Previous Santa Anita Spring Meets . 8 Precisionist Stakes . 37-38 Santa Anita 2016 Spring Meet Standings . 9 San Carlos Stakes . 38-39 Roster of Santa Anita Jockeys . 10 San Juan Capistrano Stakes . 40-41 Roster of Santa Anita Trainers . 11 Santa Anita Juvenile . 42-43 2016 Santa Anita Spring Meet Stakes Winners . 12 Santa Barbara Stakes . 44-45 2016 Santa Anita Spring Meet Longest Priced Stakes Winners . 12 Senorita Stakes . 46 Stakes Histories . 13 Shoemaker Mile . 47-48 Adoration Stakes . 14-15 Snow Chief Stakes . 49 Affirmed Stakes . 15 Summertime Oaks . 50-51 American Stakes . 16-17 Thor's Echo Stakes . 51 Beholder Mile . 18-19 Thunder Road Stakes . 51 Californian Stakes . 20-21 Wilshire Stakes . 52 Charles Whittingham Stakes . 22 Satellite Wagering Directory . 53 Crystal Water Stakes . 23 Los Angeles Turf Inc . Club Officers/Administration . 54-55 Daytona Stakes . 23 Visitors Guide/Map of Los Angeles Freeways . 56 Desert Stormer Stakes . 24 Local Hotels and Restaurants .
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • 01/22/14 12:10:50 ET Equineline.Com Product 39B - Zede Page 1 of 13 Northern Dancer 61
    01/22/14 12:10:50 ET equineline.com Product 39B - Zede Page 1 of 13 Northern Dancer 61 Nijinsky II 67 Flaming Page 59 Whiskey Road 72 Sailor 52 Bowl of Flowers 58 Flower Bowl 52 Strawberry Road (AUS) 79 =Princely Gift (GB) 51 =Rich Gift (GB) 59 =Riccal 53 Giftisa (NZ) 74 =Red Jester (NZ) 48 =Wahkeena 63 ZEDE =Royal Souci (NZ0 52 Dark Bay or Brown Horse Foaled May 6, 1994 in Kentucky Nearctic 54 Northern Dancer 61 Natalma 57 Storm Bird 78 New Providence 56 South Ocean 67 Shining Sun 62 Index's 84 *Princequillo 40 Round Table 54 *Knight's Daughter 41 Table of Contents 71 Polynesian 42 Alanesian 54 Alablue 45 RACE RECORD for Zede: At 2, one win in 2 starts; at 3, two wins (Tampa Bay Derby [L] (TAM, $90,000)), 4 times 2nd (Peter Pan S. [G2]); at 4, one win, twice 3rd. Totals: 4 wins, 4 times 2nd, twice 3rd. Earned $232,111. Statistical summary for Zede Registered progeny in North America and all available foreign data: 2001 first year of crop 500 starts 10 crops of racing age 68 wins 45 foals of racing age 1 blacktype winners 32 starters $1,205,456 earnings 20 winners 01/22/14 12:10:50 ET equineline.com Product 39B - Zede Page 2 of 13 ZEDE'S TOP 20 FOALS ARE: COUNTRY OF ORIGIN TOTAL EARNINGS NAME, YOB WINS EARNINGS CONVERTED TO USA$ Queezee Deezee, 03 5 $162,890 USA$ (USA) Azalea S.-R, etc. Oriza, 04 21 $255,191 USA$ (USA) Zenato, 03 7 $155,105 USA$ (USA) Zede's Pineline, 04 4 $102,374 USA$ (USA) Theze, 03 7 $79,653 USA$ (USA) Go Zede Go, 01 1 $71,282 (NA) Zezak, 02 5 $59,354 USA$ (USA) Zip Zip Zede, 05 2 $47,022 USA$ (USA) Fearless Firl,
    [Show full text]
  • KENNEDY Entered Stud in 2012
    KEKENNNNEEDYDY 2008 Dark Bay or Brown - Dosage Profile: 6-12-18-0-0; DI: 3.00; CD: +0.67 Bold Ruler RACE AND (STAKES) RECORD Boldnesian Alanesian Age Starts 1st 2nd 3rd Earnings Bold Reasoning Hail to Reason 2 2 0 1 0 $6,869 Reason to Earn Sailing Home 3 5 1 0 0 23,720 Seattle Slew Round Table 7 1 1 0 $30,589 Poker Glamour My Charmer Jet Action At 3, WON a maiden special weight race at Penn National Fair Charmer Myrtle Charm A.P. Indy (1989) (1 mi., defeating Runforhonor, Volo Del Vento, H W *Nasrullah Bold Ruler Goodie, etc.). Miss Disco Secretariat *Princequillo Somethingroyal IN THE STUD Imperatrice Weekend Surprise Tom Fool KENNEDY entered stud in 2012. His first foals will arrive in Buckpasser Busanda 2013. Lassie Dear Sir Gaylord Gay Missile Missy Baba MALE LINE Kennedy Nearctic Northern Dancer KENNEDY is by A.P. INDY, classic winner of 8 races to 3, Natalma Vice Regent *Menetrier $2,979,815, horse of the year, champion 3-year-old Victoria Regina Victoriana colt, Belmont S.-G1, Breeders’ Cup Classic-G1, etc. Deputy Minister Bunty Lawless Leading sire twice, sire of 147 stakes winners, incl.-- Bunty's Flight Broomflight Mint Copy BERNARDINI. 6 wins in 8 starts at 3, $3,060,480, cham- Jabneh Shakney pion 3-year-old colt, Preakness S.-G1, Travers S.-G1, Grass Shack Lovely Regina (2001) Mr. Prospector Jockey Club Gold Cup-G1, Jim Dandy S.-G2, Withers Fappiano Killaloe S.-G3, 2nd Breeders’ Cup Classic-G1. Sire. Quiet American Dr.
    [Show full text]
  • HUNTING SEASON Barn 28 Hip No
    Consigned by Bluegrass Thoroughbred Services Inc., Agent I Hip No. HUNTING SEASON Barn 662 Dark Bay or Brown Filly; foaled 2016 28 Unbridled Empire Maker ........................ Toussaud Pioneerof the Nile ................ Lord At War (ARG) Star of Goshen ...................... Castle Eight HUNTING SEASON Storm Cat Giant's Causeway ................ Mariah's Storm Flying Spur .......................... (2006) Seattle Slew Lakeway ................................ Milliardaire By PIONEEROF THE NILE (2006). Black-type winner of $1,634,200, CashCall Futurity [G1] (HOL, $400,000), etc. Among the leading sires, sire of 8 crops of racing age, 717 foals, 452 starters, 32 black-type winners, 311 winners of 843 races and earning $43,004,430, 4 champions, including American Pharoah (Triple Crown, 9 wins, $8,650,300, Kentucky Derby [G1] (CD, $1,- 418,800), etc.), Classic Empire ($2,520,220, Breeders' Cup Juvenile [G1] (SA, $1,100,000), etc.), and of Midnight Storm [G1] (10 wins, $1,783,110). 1st dam Flying Spur , by Giant's Causeway. Winner at 3, $198,821, 2nd Fair Grounds Oaks [G2] (FG, $80,000), 3rd Kentucky Oaks [G1] (CD, $54,341). Sister to Front Range . Dam of 3 other registered foals, 2 of racing age, 1 to race-- Admiral Shepard (g. by Malibu Moon). Winner at 4 and 5, $79,452. 2nd dam LAKEWAY , by Seattle Slew. 7 wins in 14 starts, 2 to 4, $965,330, Mother Goose S. [G1] , Santa Anita Oaks [G1] , Hollywood Oaks [G1] , Las Virgenes S. [G1] , Churchill Downs Budweiser Breeders' Cup H. [G2] , 2nd Kentucky Oaks [G1] , Alabama S. [G1] , Chula Vista H. [G2] , etc. Sister to Devine [L], half-sister to Monarchoftheglen [L].
    [Show full text]
  • La Militante (2015)
    TesioPower Rancho San Antonio La Militante (2015) Mr Prospector Raise A Native 8 Fappiano Gold Digger 13 Killaloe Dr Fager 1 Cryptoclearance (1984) Grand Splendor 16-a Hoist The Flag Tom Rolfe 9 Naval Orange Wavy Navy 5-i Mock Orange Dedicate 23-b Ride The Rails (1991) ALABLUE 4 Vandale Plassy 13 HERBAGER Vanille 3-c Flagette Escamillo 14-a Herbalesian (1969) Fidgette 16-c Polynesian Unbreakable 4 ALANESIAN Black Polly 14-a ALABLUE BLUE LARKSPUR 8 Candy Ride (1999) Double Time 4-m Red God NASRULLAH 9 Blushing Groom Spring Run 8-c Runaway Bride Wild Risk 3 Candy Stripes (1982) Aimee 22-d Lyphard NORTHERN DANCER 2 Bubble Company Goofed 17 Prodice Prominer 8 Candy Girl (1990) Euridice 1-b Good Manners Nashua 3 Farnesio Fun House 5-j La Farnesina Cardanil 13 City Girl (1982) La Dogana 3-b Utopico Pronto 20 Cithara Unna 3-d Cithere Marino 4 Sidney's Candy (2007) Baloo 13 NEARCTIC NEARCO 4 NORTHERN DANCER Lady Angela 14-c Natalma Native Dancer 5 Storm Bird (1978) Almahmoud 2 New Providence Bull Page 4-m South Ocean Fair Colleen 9-d Shining Sun Chop Chop 2 Storm Cat (1983) Solar Display 4-j BOLD RULER NASRULLAH 9 Secretariat Miss Disco 8 Somethingroyal PRINCEQUILLO 1 Terlingua (1976) Imperatrice 2-s Crimson Satan SPY SONG 2 Crimson Saint Papila 26 Bolero Rose Bolero 6 Fair Exchange (1997) First Rose 8 NEARCO Pharos 13 NEARCTIC Nogara 4 Lady Angela HYPERION 6 Explodent (1969) Sister Sarah 14 Mel Hash Hash A13 Venomous Cordicay 7 Spiteful Sue Heather Broom 13 Exchange (1988) Saucy Sue 14-e BOLD RULER NASRULLAH 9 Irish Stronghold Miss Disco 8 Castle
    [Show full text]
  • GOLDEN SLEW 1999 Bay - Height 17.2 - Dosage Profile: 13-1-12-2-0; DI: 2.50; CD: +0.89
    GOLDEN SLEW 1999 Bay - Height 17.2 - Dosage Profile: 13-1-12-2-0; DI: 2.50; CD: +0.89 RACE AND (STAKES) RECORD *Nasrullah Bold Ruler Miss Disco Age Starts 1st 2nd 3rd Earnings Boldnesian Polynesian 2 unraced Alanesian Alablue 3 5100 $27,720 Bold Reasoning *Turn-to 4 5000 360 Hail to Reason Nothirdchance 10 100 $28,080 Reason to Earn Wait a Bit Sailing Home Marching Home Seattle Slew (1974) At 3, WON a maiden special weight race at Belmont Park (1 *Princequillo Round Table 1/16 mi., defeating This Guns for Hire, Foreign Authori- *Knight’s Daughter Poker ty, Indiana Knight, etc.). *Nasrullah Glamour Striking My Charmer IN THE STUD Jet Pilot Jet Action Busher GOLDEN SLEW entered stud in 2004. Fair Charmer Alsab Myrtle Charm Crepe Myrtle STATISTICAL SUMMARY Golden Slew Native Dancer (Through September 28, 2009) Raise a Native Raise You Mr. Prospector 3 crops Lifetime Lifetime 2yo Nashua Gold Digger Foals of racing age 30 30 Sequence Gold Alert Starters (/Fls) 12(40%) 8(27%) *Ribot Arts and Letters Winners (/Str) 2(17%) 0(0%) All Beautiful Croquis Total Starts 67 25 Cyane Unity Hall Total Wins (/Starts) 2(3%) 0(0%) Rum Bottle Bay Golden Bri (1992) Total Earnings $78,898 $26,493 Nearco Nearctic *Lady Angela Avg. Earnings (/Str) $6,575 $3,312 Briartic Round Table Avg. Earnings (/Start) $1,178 $1,060 Sweet Lady Briar Parading Lady Stakes Wnrs (/Str) 0(0%) 0(0%) Princess Bri Raise a Native Stakes Horses (/Str) 0(0%) 0(0%) Majestic Prince Gay Hostess Avg.
    [Show full text]
  • Breeding Intelligence 20/20 Broodmare Analysis 20/20 Broodmare Analysis
    Breeding Intelligence 20/20 Broodmare Analysis 20/20 Broodmare Analysis Deceptive Vision (CAN, 2010, A.p. Indy X Eye Of The Sphynx) Location Prepared for Kentucky, USA David Whitford Fee Range Date USD 20,000 - USD 225,000 23/12/2020 Specied Stallions Stallion Match Explained The Stallion Match page shows Graded Results List Columns Stakes Winners from around the world CSI or “Common Similarity Index” is a measure of how close the pedigree of the Graded Stakes Winner that have a similar pedigree to your matches the hypo-mating. In general, values above 18 proposed mating. Based on the indicate a strong similarity. As a rule of thumb, if the concept of “Dig for Gold where Gold results list shows 4 or more horses with CSI of 18 or above, it is usually a good mating. If it shows 2 or has been found before”, it makes sense more horses with CSI above 20, it is usually an that your breeding plans should look exceptional mating. (The Results List is sorted by the CSI column, so the closest matches will appear at the to replicate pedigrees of champion top.) runners and the analysis should look at the entire pedigree. Exact Matches E is for “Exact” matches - this column shows a count of the number of ancestors in the 5-gen pedigree Results List which appear in Exactly the same position. This list will appear on the left side of the page after you click the “Match Similar Pedigrees” button. It A 20/20 Mating shows Graded Stakes winning horses that have a A 20/20 mating occurs when a pattern has two or similar pedigree to your proposed mating more Graded Stakes Winners with CSI values above 20.
    [Show full text]
  • BROODMARE ANALYSIS REPORT a Broodmare’S Nicking Analysis with up to 50 Potential Stallions
    COMPILED SPECIFICALLY FOR Tempo BROODMARE ANALYSIS REPORT A broodmare’s nicking analysis with up to 50 potential stallions Copyright © 2011 The Jockey Club Information Systems, Inc. BROODMARE ANALYSIS REPORT TrueNicks: An Explanation Nicks in History Compatibilities between stallions from one sire line with mares of another sire line has helped shape the breed since the Eclipse/Herod cross of the late 18th century. These successful crosses, called nicks, have impacted Thoroughbred development through such examples as Hermit/Stockwell, Lexington/Glencoe, Bend Or/Macaroni, and Phalaris/Chaucer. In the modern era, the prolific Mr. Prospector/Northern Dancer cross has produced outstanding racehorses and sires such as Kingmambo, Distorted Humor, and Elusive Quality. Fast-Forward to the 21st Century Computer databases have made it possible to measure and rate nicks, giving rise to a commercial market for such statistics. The first nick ratings offered to the public, though popular, were compromised by incomplete data and yielded results based on hypothetical rather than actual opportunity. This statistical gap was the impetus behind the development of TrueNicks. A Statistically Valid Approach Unlike other ratings that are calculated based on hypothetical opportunity within a limited group of horses, TrueNicks references the international database of The Jockey Club—the world’s most complete record of Thoroughbreds and their performance—to produce a sophisticated rating based on all starters and stakes winners on a given cross. The Statistics The TrueNicks rating is derived from two statistical elements: the Sire Improvement Index (SII) and the Broodmare Sire Improvement Index (BSII). Each figure compares the percentage of progeny stakes winners to starters.
    [Show full text]