DOCSLIB.ORG

SWAY AWAY:Layout 1 11/22/13 2:04 PM Page 1

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
SWAY AWAY:Layout 1 11/22/13 2:04 PM Page 1 SWAY AWAY:Layout 1 11/22/13 2:04 PM Page 1 AfleetSAleWx—SeAattlYe ShiAmmWer, byASeaY tle Slew First foals arrive in 2014 A son of AFLEET ALEX , the 2005 Belmont S. (G1) winner & Eclipse Champion Three-Year-Old Male. At 2, a winner on his debut & 2nd in Del Mar’s Best Pal S. (G2) . At 3, defeated 2013 G1 winner Sahara Sky, 2nd in Santa Anita’s San Vicente S. (G2) & ran in the Preakness S. (G1) . At 4, 2nd in Santa Anita’s San Carlos S. (G2) , defeating multiple G1 winner The Factor & Amazombie, the 2011 Breeders’ Cup Sprint (G1) winner and Eclipse Champion Male Sprinter. Recorded Beyer Speed Figures of 101 in the San Vincente & 103 in the San Carlos. Out of a daughter of SEATTLE SLEW whose dam was a GRADE 2 winner. 2014 FEE: $2,500-LIVE FOAL First foals arrive in 2014 Standing at PREMIER THOROUGHBREDS Inquiries to Mersad Metanovic 10940 26 Mile Road, Oakdale, California 95361 (650) 653-1259/FAX (650) 348-1474 e-mail: [email protected] or website: www.premierthoroughbeds.com 158 California Thoroughbred 2014 Stallion Directory www.ctba.com SwayAwaycs405103ORIGJockeyClubPageSent11-8-2013-NoChangeLoretta11-27-2013-1105am:Layout 1 11/27/13 11:06 AM Page1 SWAY AWAY 2008 Bay - Height 15.3 - Dosage Profile: 6-0-8-0-0; DI: 2.50; CD: +0.86 Raise a Native RACE AND (STAKES) RECORD Mr. Prospector Gold Digger Age Starts 1st 2nd 3rd Earnings Afleet Venetian Jester 2 2 1 1(1) 0 $45,100 1382 foals, 67 SWs Polite Lady Friendly Ways 3 5 1 1(1) 0 112,700 Northern Afleet Northern Dancer 4 3 0 1(1) 0 49,000 1015 foals, 61 SWs Nureyev Special 10 2 3(3) 0 $206,800 Nuryette Tentam 9 foals, 3 SWs Stellarette Square Angel Afleet Alex (2002) At 2, WON a maiden special weight race at Pleasanton (5 Roberto 476 foals, 22 SWs fur., by 3 1/4 lengths, defeating Roman Power, Hit Run Silver Hawk Gris Vitesse Hawkster and Win, El Gaucho, etc.), 2nd Best Pal S.-G2 at Del Chieftain 256 foals, 4 SWs Strait Lane Level Sands Mar (6 1/2 fur., to J P's Gusto, defeating Western Mood, Maggy Hawk Utrillo II Comma to the Top, etc.). 9 foals, 2 SWs *Hawaii Ethane Qualique At 3, WON an allowance race at Hollywood Park (7 fur., *Sensitivo 11 foals, 0 SWs defeating Da Ruler, Sahara Sky, Price, etc.), 2nd San Dorothy Gaylord Gaylord's Touch Vicente S.-G2 at Santa Anita Park (7 fur., to The Fac- Bold Ruler Boldnesian Alanesian tor, defeating Premier Pegasus, Surrey Star (IRE), etc.). Bold Reasoning Hail to Reason At 4, 2nd San Carlos S.-G2 at Santa Anita Park (7 fur., to 61 foals, 10 SWs Reason to Earn Sailing Home Seattle Slew The Factor, defeating Amazombie, Canonize, etc.). Round Table 1050 foals, 114 SWs Poker Glamour IN THE STUD My Charmer Jet Action 12 foals, 4 SWs SWAY AWAY entered stud in 2013. His first foals arrive in Fair Charmer Myrtle Charm Seattle Shimmer (1999) Northern Dancer 2014. 6 foals, 0 SWs Storm Bird South Ocean Summer Squall Secretariat MALE LINE 335 foals, 37 SWs Weekend Surprise Lassie Dear SWAY AWAY is by AFLEET ALEX, classic winner of 8 Golden Gale Raise a Native 7 foals, 0 SWs races in 12 starts, $2,765,800, Champion 3-year-old Mr. Prospector Gold Digger Gold Whirl colt, Belmont S.-G1, etc. Sire of 22 stakes winners-- Irish Lancer 12 foals, 1 SWs CUQUI'S LOVE. 16 wins, 2 to 5, $240,483, Champion Irish Whirl Narola imported 3-year-old filly in Puerto Rico, Clasico Wiso G.-G2, Clasico Dia de la Mujer-G2, etc. ADVIER. 6 wins at 2 and 3, 2013, $99,589, Copa Quatro Bailzee (f. by Grand Slam). 2 wins at 3, $152,580, 2nd AFLEET EXPRESS. 4 wins in 7 starts to 3, $835,140, de Julio-G1, Jose de Diego S., etc. Lottsa Talc S.-R. Travers S.-G1, Pegasus S.-G3, 3rd Jim Dandy S.-G2. QUEEN AFLEET. 6 wins in 8 starts at 2 and 4 in Panama, Golden Gulch. 4 wins at 3 and 4, $250,414. AFLEET AGAIN. 4 wins, $695,470, Breeders' Cup Mara- Clasico German Ruiz Barrancos-G3. Crazy Charlie. 4 wins at 3 and 4, $55,479. thon-G2, Withers S.-G3, 2nd Pegasus S.-G3, Green- A BRILLIANT IDEA. Winner at 2, $90,665, Junior Cham- 3rd dam wood Cup S.-L, Whirlaway S.-L, 3rd Spend a Buck S.-L. pion S.-L, 2nd Tropical Park Oaks. GOLD WHIRL, by Mr. Prospector. 2 wins at 4, $24,650. MISS VALENTINE. 9 wins, 2 to 5, 2013, $567,500, Sere- ADMIRAL ALEX. 2 wins at 3, $76,764, Arts and Letters S. Dam of 12 foals, 11 to race, 10 winners, incl.-- na's Song S.-L, Chase the Dream S.-LR, Mom's Shesabronxbomber. 3 wins at 3, placed at 4, 2013, GOLDEN GALE. Stakes winner, above. Command S., Princess Dixie S.-R, etc. $220,992, 2nd Sonia's Scamp S.-R, etc. Foggy Launch. 15 wins, 3 to 8, $90,624, 2nd Mid- AFLEETING LADY. 7 wins at 4 and 5, $473,526, Falls City Sway Away. Subject stallion. west Sprint Budweiser H., 3rd Beulah Park Inau- H.-G2, Turnback the Alarm H.-G3, Lady's Secret S.-L, Runfor Ro. Winner at 2 and 3, placed at 4, 2013, $196,- gural S. Etr at River Downs, 5 fur. in :58. Etr at Beu- 2nd Falls City H.-G2, Fleur de Lis H.-G2, etc. 597, 2nd My Dear S.-L, OBS Sprint S.-R, etc. lah Park, 6 fur. in 1:08 4/5. HARISSA. 6 wins, 2 to 4, $468,966, Barbara Fritchie H.- Cascabella. 6 wins, $192,352, 2nd Lighthouse S.-L, etc. Campbell Slewp. 4 wins, 3 to 5, $81,097, 3rd April G2, Sunland Park Oaks-L, Langhorne S.-L, Sleigh Ride Oh So Bella. 3 wins, $178,630, 3rd Go for Wand S.-L. Run S. Dam of Just Simmering (2nd Blue S.-L, 2nd Iowa Oaks-G3, 3rd Indiana Oaks-G2. Scampering. 3 wins at 3 and 4, 2013, $168,070, 3rd Glens Mountain Futurity-LR). CALLED TO SERVE. 4 wins at 3, placed at 4, 2013, Falls S.-L. Thelma Jean. 3 wins at 3, $31,774, 2nd Lakeway S., $455,430, Discovery H.-G3, Broad Brush S.-L, 2nd Profiteroles. 3 wins, $161,092, 2nd Twin Lights S.-L, etc. Chandler H. Producer. Granddam of Big Cat Walks Late (4 wins, $108,860, 3rd Walking in Da Temperence Hill S.-L, 3rd Santa Anita H.-G1, etc. FEMALE LINE DUBLIN. 2 wins, $438,949, Three Chimneys Hopeful S.- Sun S., Trenton S.). G1, 2nd Southwest S.-G3, 3rd Arkansas Derby-G1, etc. 1st dam Slewperlative. 7 wins, 2 to 6, $103,452. Dam of Pent- BIZZY CAROLINE. 4 wins, $347,935, Regret S.-G3, Early SEATTLE SHIMMER, by Seattle Slew. Unraced. Dam of 7 house Promise (13 wins, $124,314, 3rd Inaugu- Times Mint Julep H.-G3, 2nd Mrs. Revere S.-G2, etc. foals, 5 to race, 4 winners, including-- ral S.). Granddam of FLEET VALID (9 wins, $382,- LA GRAN BAILADORA. 6 wins to 4, $339,049, Distorted Sway Away. Subject stallion. 516, Teddy Drone S.-L, Icecapade S.-L, 3rd Frank Humor Kentucky Cup Distaff S.-G3, My Charmer S., etc. Inverness (f. by More Than Ready). 2 wins in 3 starts at J. De Francis Memorial Dash S.-G1). DANCING AFLEET. 3 wins in 6 starts at 3, 2013, $286,- 2, $47,800. Gold Pack. 8 wins, 3 to 5, $145,368. Sire. 250, Delaware Oaks-G2. Spring Moon (f. by Zensational). Winner in 1 start at 2, Whirley. 4 wins, 3 to 6, $110,720. FAST ALEX. 4 wins to 4, $222,990, Tenacious H., 2nd 2013, $45,000. Whirlacat. 6 wins, 4 to 6, $100,797. Mineshaft H.-G3, Golden Bear S.-L, Louisiana H.-L. Broodmare Sire Fire in the Hole. 7 wins, 3 to 6, $57,256. IOTAPA. 3 wins in 6 starts to 3, 2013, $203,490, Railbird SEATTLE SLEW, 1974. Leading broodmare sire 3 4th dam S., 2nd Santa Anita Oaks-G1, Hollywood Oaks-G2, etc. times in U.A.E. and U.S., sire of 503 dams of IRISH WHIRL, by Irish Lancer. 3 wins at 4, $16,750. Sister SHIMMERING MOMENT. Winner in England; winner in 3531 foals, 2728 rnrs (77%), 1922 wnrs (54%), to Irish Saga (7 wins in France, 3rd Prix Rohan). Ireland, Carlingford S.; placed in U.A.E.; winner, $73,- 542 2yo wnrs (15%), 1.68 AEI, 1.48 CI, 229 stakes Dam of 7 foals, 6 to race, 5 winners, including-- 460, in N.A., 2nd Taylor Made Matchmaker S.-G3, etc. winners. IRISH JOY. 7 wins, 2 to 5, $164,377, Boiling Springs ALEX'S VISION. 4 wins, 3 to 6, 2013, $163,114, Peppy 2nd dam H.-G3, Femme Fatale S., Bal Harbour S., 2nd Rum- Addy S.-LR, 3rd Danzig S.-LR. GOLDEN GALE, by Summer Squall. 7 wins to 4, $261,- son H., Open Fire S., Chris Evert H.-R, 3rd La Pre- RUTHVILLE. 4 wins to 5, $148,518, Lady Canterbury S.-L. 062, Beaumont S.-G2, Opa-Locka S., 2nd Sabin voyante H.-G3, Old Hat S., Orange Blossom H.-R. GO ASK ALEX. 2 wins at 3, $144,304, Indiana Downs H.-G3. Dam of 7 other foals, 6 to race, 4 winners-- Producer.
Load more

Recommended publications
  • GRAY OR ROAN COLT Barn 26 Hip No. 1933
    Consigned by Ballysax Bloodstock, Agent V Hip No. GRAY OR ROAN COLT Barn 1933 Foaled March 15, 2020 26 Unbridled Unbridled's Song .................. Trolley Song Midshipman .......................... Avenue of Flags Fleet Lady .............................. Dear Mimi GRAY OR Northern Afleet ROAN COLT Afleet Alex ............................ Maggy Hawk Oh So Bella .......................... (2008) Wild Again Lucky Again .......................... Countess Jig By MIDSHIPMAN (2006). Champion 2-year-old, black-type winner of $1,584,- 600, Breeders' Cup Juvenile [G1] (OSA, $1,150,200), etc. Sire of 7 crops of racing age, 666 foals, 460 starters, 34 black-type winners, 325 winners of 896 races and earning $24,006,888, including Royal Ship (BRZ) (5 wins, $50,805, Estado do Rio de Janeiro [G1] , etc.), Tanganyka ($34,301, Zelia Gonzaga Peixoto de Castro [G1] , etc.), Tweet (2 wins, Grande Premio Joao Cecilio Ferraz [G1] , etc.), Princess Warrior [G2] (4 wins, $456,664). 1st dam Oh So Bella , by Afleet Alex. 3 wins at 3, $178,630, 3rd Go for Wand S. [L] (DEL, $8,250). Sister to AFLEET AGAIN . Dam of 4 registered foals, 3 of racing age, 2 to race, 1 winner-- Bella Be Ready (f. by More Than Ready). 2 wins at 3, $52,240. 2nd dam LUCKY AGAIN , by Wild Again. 4 wins at 3 and 4, $139,545, Sham Say S.-R (PIM, $24,000), 2nd Holiday Inaugural S. [L] (TP, $12,000), Meafara S.- R (GP, $15,000), Singing Beauty S.-R (LRL, $8,645), etc. Dam of-- AFLEET AGAIN (c. by Afleet Alex). 4 wins, 2 to 4, $686,470, in N.A./U.S., Breeders' Cup Marathon [G2] (CD, $270,000), Withers S.
    [Show full text]
  • Kentucky Moon (2014)
    TesioPower Rancho San Antonio Kentucky Moon (2014) Intentionally Intent 8 In Reality My Recipe 5-j My Dear Girl Rough 'n Tumble 1 Relaunch (1976) Iltis 21-a THE AXE II MAHMOUD 9 Foggy Note Blackball 1 Silver Song Royal Note 12 Cee's Tizzy (1987) Beadah 3 NORTHERN DANCER Nearctic 14 LYPHARD Natalma 2 Goofed Court Martial 1 Tizly (1981) Barra II 17 Trevieres Worden II 13 Tizna Vamarie 4 Noris Licencioso 12-a Tiznow (1997) Nizarda 9-g Bold Reasoning Boldnesian 4 SEATTLE SLEW Reason To Earn 1-k My Charmer Poker 1 Seattle Song (1981) Fair Charmer 13-c Prince Blessed PRINCEQUILLO 1 Incantation Dog Blessed 21-a Magic Spell Flushing II 14-f Cee's Song (1986) Subterranean 4 NORTHERN DANCER Nearctic 14 Nice Dancer Natalma 2 Nice Princess Le Beau Prince 12-e Lonely Dancer (1975) Happy Night II 1-e Pia Star OLYMPIA 4 Sleep Lonely Inquisitive 5-j Sulenan Tompion A1 Gemologist (2009) Blue Canary 26 Polynesian Unbreakable 4 NATIVE DANCER Black Polly 14-a Geisha Discovery 23 Raise A Native (1961) Miyako 5-f Case Ace Teddy 2 Raise You Sweetheart 1-k Lady Glory American Flag 7 MR PROSPECTOR (1970) Beloved 8-f NASRULLAH NEARCO 4 Nashua Mumtaz Begum 9 Segula Johnstown 17 Gold Digger (1962) Sekhmet 3-m Count Fleet Reigh Count 2 Sequence Quickly 6 Miss Dogwood BULL DOG 16 Crystal Shard (1994) Myrtlewood 13 NEARCO Pharos 13 Nearctic Nogara 4 Lady Angela Hyperion 6 NORTHERN DANCER (1961) Sister Sarah 14 NATIVE DANCER Polynesian 14 Natalma Geisha 5-f Almahmoud MAHMOUD 9 Sulemeif (1980) Arbitrator 2-d OLYMPIA Heliopolis 8 Creme Dela Creme Miss Dolphin 4-p Judy
    [Show full text]
  • HORSES, KENTUCKY DERBY (1875-2019) Kentucky Derby
    HORSES, KENTUCKY DERBY (1875-2019) Kentucky Derby Winners, Alphabetically (1875-2019) HORSE YEAR HORSE YEAR Affirmed 1978 Kauai King 1966 Agile 1905 Kingman 1891 Alan-a-Dale 1902 Lawrin 1938 Always Dreaming 2017 Leonatus 1883 Alysheba 1987 Lieut. Gibson 1900 American Pharoah 2015 Lil E. Tee 1992 Animal Kingdom 2011 Lookout 1893 Apollo (g) 1882 Lord Murphy 1879 Aristides 1875 Lucky Debonair 1965 Assault 1946 Macbeth II (g) 1888 Azra 1892 Majestic Prince 1969 Baden-Baden 1877 Manuel 1899 Barbaro 2006 Meridian 1911 Behave Yourself 1921 Middleground 1950 Ben Ali 1886 Mine That Bird 2009 Ben Brush 1896 Monarchos 2001 Big Brown 2008 Montrose 1887 Black Gold 1924 Morvich 1922 Bold Forbes 1976 Needles 1956 Bold Venture 1936 Northern Dancer-CAN 1964 Brokers Tip 1933 Nyquist 2016 Bubbling Over 1926 Old Rosebud (g) 1914 Buchanan 1884 Omaha 1935 Burgoo King 1932 Omar Khayyam-GB 1917 California Chrome 2014 Orb 2013 Cannonade 1974 Paul Jones (g) 1920 Canonero II 1971 Pensive 1944 Carry Back 1961 Pink Star 1907 Cavalcade 1934 Plaudit 1898 Chant 1894 Pleasant Colony 1981 Charismatic 1999 Ponder 1949 Chateaugay 1963 Proud Clarion 1967 Citation 1948 Real Quiet 1998 Clyde Van Dusen (g) 1929 Regret (f) 1915 Count Fleet 1943 Reigh Count 1928 Count Turf 1951 Riley 1890 Country House 2019 Riva Ridge 1972 Dark Star 1953 Sea Hero 1993 Day Star 1878 Seattle Slew 1977 Decidedly 1962 Secretariat 1973 Determine 1954 Shut Out 1942 Donau 1910 Silver Charm 1997 Donerail 1913 Sir Barton 1919 Dust Commander 1970 Sir Huon 1906 Elwood 1904 Smarty Jones 2004 Exterminator
    [Show full text]
  • Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’S Plate 3RD Belmont Stakes
    Northern Dancer 90th May 2, 1964 THE WINNER’S PEDIGREE AND CAREER HIGHLIGHTS Pharos Nearco Nogara Nearctic *Lady Angela Hyperion NORTHERN DANCER Sister Sarah Polynesian Bay Colt Native Dancer Geisha Natalma Almahmoud *Mahmoud Arbitrator YEAR AGE STS. 1ST 2ND 3RD EARNINGS 1963 2 9 7 2 0 $ 90,635 1964 3 9 7 0 2 $490,012 TOTALS 18 14 2 2 $580,647 At 2 Years WON Summer Stakes, Coronation Futurity, Carleton Stakes, Remsen Stakes 2ND Vandal Stakes, Cup and Saucer Stakes At 3 Years WON Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’s Plate 3RD Belmont Stakes Horse Eq. Wt. PP 1/4 1/2 3/4 MILE STR. FIN. Jockey Owner Odds To $1 Northern Dancer b 126 7 7 2-1/2 6 hd 6 2 1 hd 1 2 1 nk W. Hartack Windfields Farm 3.40 Hill Rise 126 11 6 1-1/2 7 2-1/2 8 hd 4 hd 2 1-1/2 2 3-1/4 W. Shoemaker El Peco Ranch 1.40 The Scoundrel b 126 6 3 1/2 4 hd 3 1 2 1 3 2 3 no M. Ycaza R. C. Ellsworth 6.00 Roman Brother 126 12 9 2 9 1/2 9 2 6 2 4 1/2 4 nk W. Chambers Harbor View Farm 30.60 Quadrangle b 126 2 5 1 5 1-1/2 4 hd 5 1-1/2 5 1 5 3 R. Ussery Rokeby Stables 5.30 Mr. Brick 126 1 2 3 1 1/2 1 1/2 3 1 6 3 6 3/4 I.
    [Show full text]
  • 23 Bay Filly
    Barn 3D Hip No. Property of Tenlane Farm, Trackside Farm (Tom Evans), Agent 23 Bay Filly Quiet American Real Quiet . { Really Blue Midnight Lute . Dehere { Candytuft . { Bolt From the Blue Bay Filly . Hold Your Peace March 16, 2010 Meadowlake . { Suspicious Native {Ma Kitty . In Reality (1998) { Taruma . { Table of Contents By MIDNIGHT LUTE (2003), black type wnr of 6 races, $2,690,600, champ- ion, Breeders’ Cup Sprint [G1] twice, Forego S. [G1], Perryville S. [G3]- ntr, 2nd Cigar Mile H. [G1], San Fernando Breeders’ Cup [G2], 3rd Mali- bu S. [G1]. Son of Real Quiet, $3,271,802, champion, Ky. Derby [G1], etc., sire of 15 black type winners. His first foals are yearlings of 2011. 1st dam Ma Kitty, by Meadowlake. Winner at 3 and 4, $159,644, 3rd Belle Mahone S. [L] (WO, $11,550-CAN). Dam of 4 foals of racing age, including a 2- year-old of 2011, three to race, including-- One Brave Cat (c. by Lion Heart). Winner at 2, 2010, $10,209. 2nd dam TARUMA, by In Reality. Dam of 9 winners, including-- SAGASIOUS (f. by Quest for Fame-GB). 3 wins at 3, $115,122, Reeve Schley, Jr. S. [G2], 3rd Sands Point H. [L] (BEL, $12,232). MISS DOMINIQUE (f. by Private Account). 6 wins at 4 and 5, $385,678, Vieille Vigne H. [L] (DMR, $36,770), Run for the Roses H. [L] (SA, $35,- 200), 2nd Reminiscing H. [L], Commissary H.-R, Ladyhawke Ranch H. [R], 3rd Breeders’ Cup Distaff [G1], Spinster S. [G1]. Producer. Ma Kitty (f.
    [Show full text]
  • Preakness Stakes .Fifty-Three Fillies Have Competed in the Preakness with Start in 1873: Rfive Crossing the Line First The
    THE PREAKNESS Table of Contents (Preakness Section) History . .P-3 All-Time Starters . P-31. Owners . P-41 Trainers . P-45 Jockeys . P-55 Preakness Charts . P-63. Triple Crown . P-91. PREAKNESS HISTORY PREAKNESS FACTS & FIGURES RIDING & SADDLING: WOMEN & THE MIDDLE JEWEL: wo people have ridden and sad- dled Preakness winners . Louis J . RIDERS: Schaefer won the 1929 Preakness Patricia Cooksey 1985 Tajawa 6th T Andrea Seefeldt 1994 Looming 7th aboard Dr . Freeland and in 1939, ten years later saddled Challedon to victory . Rosie Napravnik 2013 Mylute 3rd John Longden duplicated the feat, win- TRAINERS: ning the 1943 Preakness astride Count Judy Johnson 1968 Sir Beau 7th Fleet and saddling Majestic Prince, the Judith Zouck 1980 Samoyed 6th victor in 1969 . Nancy Heil 1990 Fighting Notion 5th Shelly Riley 1992 Casual Lies 3rd AFRICAN-AMERICAN Dean Gaudet 1992 Speakerphone 14th RIDERS: Penny Lewis 1993 Hegar 9th Cynthia Reese 1996 In Contention 6th even African-American riders have Jean Rofe 1998 Silver’s Prospect 10th had Preakness mounts, including Jennifer Pederson 2001 Griffinite 5th two who visited the winners’ circle . S 2003 New York Hero 6th George “Spider” Anderson won the 1889 Preakness aboard Buddhist .Willie Simms 2004 Song of the Sword 9th had two mounts, including a victory in Nancy Alberts 2002 Magic Weisner 2nd the 1898 Preakness with Sly Fox “Pike”. Lisa Lewis 2003 Kissin Saint 10th Barnes was second with Philosophy in Kristin Mulhall 2004 Imperialism 5th 1890, while the third and fourth place Linda Albert 2004 Water Cannon 10th finishers in the 1896 Preakness were Kathy Ritvo 2011 Mucho Macho Man 6th ridden by African-Americans (Alonzo Clayton—3rd with Intermission & Tony Note: Penny Lewis is the mother of Lisa Lewis Hamilton—4th on Cassette) .The final two to ride in the middle jewel are Wayne Barnett (Sparrowvon, 8th in 1985) and MARYLAND MY Kevin Krigger (Goldencents, 5th in 2013) .
    [Show full text]
  • Table of Contents Meet-At-A-Glance
    Santa Anita Park 2017 Spring Media Guide Table of Contents Meet-At-A-Glance . 2 The Gold Cup at Santa Anita . 28-29 Information Resources . 3 Honeymoon Stakes . 30-31 Santa Anita Spring Attendance and Handle . 4 Kona Gold Stakes . 31 Santa Anita Spring Opening Day Statistics . 4 Landaluce Stakes . 32-33 Michael Wrona Biography . 4 Lazaro Barrera Stakes . 33 Santa Anita Spring Meet Attendance . 5 Lennyfrommalibu Stakes . 33 Santa Anita Spring 2016 Meet Handle, Payoffs & Top Five Days . 5 Los Angeles Stakes . 34-35 Santa Anita Spring Meet Annual Media Poll . 6 Melair Stakes . 36 Santa Anita Track Records . 7 Monrovia Stakes . 36 Leaders at Previous Santa Anita Spring Meets . 8 Precisionist Stakes . 37-38 Santa Anita 2016 Spring Meet Standings . 9 San Carlos Stakes . 38-39 Roster of Santa Anita Jockeys . 10 San Juan Capistrano Stakes . 40-41 Roster of Santa Anita Trainers . 11 Santa Anita Juvenile . 42-43 2016 Santa Anita Spring Meet Stakes Winners . 12 Santa Barbara Stakes . 44-45 2016 Santa Anita Spring Meet Longest Priced Stakes Winners . 12 Senorita Stakes . 46 Stakes Histories . 13 Shoemaker Mile . 47-48 Adoration Stakes . 14-15 Snow Chief Stakes . 49 Affirmed Stakes . 15 Summertime Oaks . 50-51 American Stakes . 16-17 Thor's Echo Stakes . 51 Beholder Mile . 18-19 Thunder Road Stakes . 51 Californian Stakes . 20-21 Wilshire Stakes . 52 Charles Whittingham Stakes . 22 Satellite Wagering Directory . 53 Crystal Water Stakes . 23 Los Angeles Turf Inc . Club Officers/Administration . 54-55 Daytona Stakes . 23 Visitors Guide/Map of Los Angeles Freeways . 56 Desert Stormer Stakes . 24 Local Hotels and Restaurants .
    [Show full text]
  • HEADLINE NEWS • 1/24/06 • PAGE 2 of 6
    PREAKNESS IS NTRA MOMENT OF HEADLINE THE YEAR...p2 NEWS For information about TDN, DELIVERED EACH NIGHT BY FAX AND FREE BY E-MAIL TO SUBSCRIBERS OF call 732-747-8060. www.thoroughbreddailynews.com TUESDAY, JANUARY 24, 2006 SAINT LIAM ECLIPSES “ALEX” DEEP IMPACT JAPAN’S HORSE OF THE YEAR Between his exploits on the track and the human Deep Impact (Jpn) (Sunday Silence), who last year interest stories that surrounded him off it, Afleet Alex became the first undefeated Triple Crown winner in (Northern Afleet) may have Japan in 21 years, has been earned the most ink in 2005. named the near-unanimous win- But it was GI Breeders’ Cup ner of the Japan Racing Associ- Classic hero Saint Liam (Saint ation’s 2005 Horse of the Year Ballado) who earned the title as award, with 285 of the 291 the season’s Horse of the Year. votes. He was the unanimous “Indeed, Saint Liam has all the selection as champion three- characteristics of a great cham- year-old. Hearts Cry (Jpn) pion,” owner William Warren Deep Impact jair.jrao.ne.jp (Sunday Silence), who snapped Saint Liam Horsephotos Jr. said. “He has mental tough- Deep Impact’s unbeaten streak ness, the ability to rate, endurance, a sound heart and a on Christmas Day in the G1 Arima Kinen S., was racing eye. We really truly had so much fun with him.” named champion older male and was the only other It was the fourth year in a row that an older horse horse considered for the year’s biggest award.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • PTHA News 2011
    PTHA NEWS Pennsylvania Thoroughbred Horsemen’s Association Newsletter We ARE Pennsylvania Racing Volume 6 2011 Kasey K Stables and Butch Reid’s Afleet Again Wins 2011 Breeders Cup Marathon “On Breeders Cup day this year, there were 18 horses competing that had prepped at Parx in 2011, including the first and second place runners in the Marathon, and the first three finishers of the Turf Sprint,” said Parx Director of Racing Sal Sinatra. “It’s Tricky, who was second in the Cotillion here for Kiaran McLaughlin, was second in the Lady’s Classic, and Ruler On Ice, 2nd in the PA Derby, was third in the Classic. I’d say we were well represented.” Bob Krangel, who is retired and now manages multiple LLCs that race under the name Kasey K Racing Stable, had loved Afleet Again for over a year and a half—and was eager to purchase him when the former CHURCHILL DOWNS/REED PALMER PHOTO owners, Cash Is King, LLC, were Kasey K Stables’ managing partner Bob Krangel and ready to sell earlier this year. his wife Sue still haven’t come down from the clouds Being in the same barn, with the after their 40-1 victory in the Breeders Cup Marathon same trainer, Krangel knew the with Afleet Again. Their first Breeders Cup Champion horse well. was the also the first for trainer Butch Reid, and the first to come out of Parx – the biggest win in the local “There was just something community since Smarty Jones won the Kentucky about him,” said Krangel. “He is a Derby and Preakness Stakes for Someday Farm and big, goofy horse who, I think, just trainer John Servis in 2004.
    [Show full text]
  • The Long Ride
    SKIP DICKSTEIN THE LONG RIDE Patience helps jockeys navigate But how do riders prepare and race- plan for this uniquely competitive contest the Belmont Stakes’ 12 furlongs staged at a distance that is as unusual to them as it is to their 3-year-old equine counterparts? BY PAUL VOLPONI “You have to do your homework. You have to know where all the poles are. THE GRADE 1 BELMONT STAKES has been dubbed Make sure at all times during the race you know your position,” said Hall of Fame “The Test of the Champion,” and for good reason. Not jockey John Velazquez. “The track is so only is it the final jewel of the Triple Crown, but along big; it can be very deceiving. At a normal with the Brooklyn Invitational Stakes (G2), run the racetrack you enter the backstretch and 1 same day, it is the only 1 ⁄2-mile dirt race of any major you’ve got three-quarters of a mile re- consequence in the U.S. The 12 furlongs unfold around maining. When you hit the backstretch at Belmont Park, you’re a mile from home.” one full circuit of the Taj Mahal of racing, Belmont Hall of Fame rider Braulio Baeza won Park, known for its immense, sweeping turns. There the Belmont Stakes three times, over is little doubt it takes an ultra-talented Thoroughbred three different surfaces—at the old Bel- to prove victorious. mont Park with Sherluck in 1961, at Aq- 26 / BloodHorse.com / JUNE 9, 2018 / TheBloodHorse / BloodHorse The Belmont Stakes, one trip around the track, is a test of horse and rider THE LONG RIDE BLOOD HORSE LIBRARY HORSE LIBRARY BLOOD JEFFREY SNYDER Braulio Baeza and Arts and Letters win the Belmont in 1969; right, John Velazquez aboard Rags to Riches (outside) in 2007 ueduct (while Belmont Park was being Those two elements—conservation of the window after the start,” he said.
    [Show full text]
  • 01/22/14 12:10:50 ET Equineline.Com Product 39B - Zede Page 1 of 13 Northern Dancer 61
    01/22/14 12:10:50 ET equineline.com Product 39B - Zede Page 1 of 13 Northern Dancer 61 Nijinsky II 67 Flaming Page 59 Whiskey Road 72 Sailor 52 Bowl of Flowers 58 Flower Bowl 52 Strawberry Road (AUS) 79 =Princely Gift (GB) 51 =Rich Gift (GB) 59 =Riccal 53 Giftisa (NZ) 74 =Red Jester (NZ) 48 =Wahkeena 63 ZEDE =Royal Souci (NZ0 52 Dark Bay or Brown Horse Foaled May 6, 1994 in Kentucky Nearctic 54 Northern Dancer 61 Natalma 57 Storm Bird 78 New Providence 56 South Ocean 67 Shining Sun 62 Index's 84 *Princequillo 40 Round Table 54 *Knight's Daughter 41 Table of Contents 71 Polynesian 42 Alanesian 54 Alablue 45 RACE RECORD for Zede: At 2, one win in 2 starts; at 3, two wins (Tampa Bay Derby [L] (TAM, $90,000)), 4 times 2nd (Peter Pan S. [G2]); at 4, one win, twice 3rd. Totals: 4 wins, 4 times 2nd, twice 3rd. Earned $232,111. Statistical summary for Zede Registered progeny in North America and all available foreign data: 2001 first year of crop 500 starts 10 crops of racing age 68 wins 45 foals of racing age 1 blacktype winners 32 starters $1,205,456 earnings 20 winners 01/22/14 12:10:50 ET equineline.com Product 39B - Zede Page 2 of 13 ZEDE'S TOP 20 FOALS ARE: COUNTRY OF ORIGIN TOTAL EARNINGS NAME, YOB WINS EARNINGS CONVERTED TO USA$ Queezee Deezee, 03 5 $162,890 USA$ (USA) Azalea S.-R, etc. Oriza, 04 21 $255,191 USA$ (USA) Zenato, 03 7 $155,105 USA$ (USA) Zede's Pineline, 04 4 $102,374 USA$ (USA) Theze, 03 7 $79,653 USA$ (USA) Go Zede Go, 01 1 $71,282 (NA) Zezak, 02 5 $59,354 USA$ (USA) Zip Zip Zede, 05 2 $47,022 USA$ (USA) Fearless Firl,
    [Show full text]