Author Index

Abi-Rached, Laurent, 7943 Catalano, Donna, 7686 Frahm, Nicole, 7756, 7890 Adams, Sharon, 7756 Catley, Lawrence, 7730 Franzese, Ornella, 7710 Aggarwal, Bharat B., 8183 Cava, Antonio La, 7649 Frausto, Ricardo F., 8158 Akbar, Arne N., 7710 Cejudo-Martin, Pilar, 7516 Freitas, Antonio A., 7550 Al-Alwan, Monther, 7859 Center, David M., 8081 Frey, Alan B., 7814 Alber, Gottfried, 7805 Chang, W. L. William, 7794 Fu¨llbier, Lars, 8127 Alcaraz, Ana, 7974 Chavez-Rueda, Karina A., 7868 Alpsoy, Erkan, 7520 Chen, Grace, 8022 Alter, Galit, 7658 Chen, Jianzhu, 7632 Ganea, Doina, 8138 Altfeld, Marcus, 7658, 7756 Clark, Sally A., 8212 Gantz, Don, 8046 Amer, Amal, 8022 Cleret, Aure´lie, 7994 Gao, Hongwei, 7902 Ammann, Christoph G., 7840 Cohn, Lauren, 7501 Garbi, Natalio, 7932 Anderson, Kenneth C., 7730 Colbert, Dana C., 7879 Garcia, Eduardo, 7840 Andrzejewski, Michael G., 8064 Colby, Thomas V., 7879 Garcia, Sylvie, 7550 Ansari, Aftab A., 7720 Cool, Carlyne D., 8148 Gardai, Shyra, 8117 Appelberg, Rui, 8028 Correia-Neves, Margarida, 8028 Garn, Holger, 7805 Appleton, Judith A., 7974 Cosgrove, Gregory P., 8148 Gassner, Christoph, 7840 Aranami, Toshimasa, 7525 Crocker, Stephen J., 8158 Gauldie, Jack, 7984, 8175 Arap, Wadih, 8183 Cronstein, Bruce N., 7747 Gazzard, Brian, 8212 Arbabi, Saman, 7902 Cross, Lillian, 8081 Geiger, Terrence L., 7667 Assarsson, Erika, 7890 Crouch, Erika C., 8046 Genestier, Laurent, 7779 Autschbach, Frank, 8203 Cruikshank, William W., 8081 Gheit, Hanane, 7779 Ayyavoo, Velpandi, 7756 Ghosh, Moumita, 8117 Gilles, Stefanie, 7623 Daha, Mohamed R., 7581 Glasser, Anne-Lise, 8168 Da Silva, Diane M., 7587 Bae, Jooeun, 7730 Glenney, Gavin W., 7955 Datta, Syamal K., 7849 Bai, Ailin, 7632 Gobert, Alain P., 8168 Defrance, Thierry, 7779 Banki, Zoltan, 7840 Goldman, Michel, 7607 de Jong, Judith M. H., 7581 Baron, Colin A., 7794 Goldstein, Harris, 7756 del Zoppo, Gregory J., 8158 Barry, Ashley P., 8002 Go´mez-Gaviro, Maria, 8053 Barry, Peter A., 7794 Deol, Parampal, 7557 Goriely, Stanislas, 7607 Batchu, Ramesh Babu, 7730 de Sablet, Thibaut, 8168 Gostick, Emma, 7756 Bauer, Stefan, 7805 Dewhirst, Mark W., 7747 Gotch, Frances, 8212 Baumgarth, Nicole, 7794 De Wit, Dominique, 7607 Green, Daniel S., 8081 Behrendt, Heidrun, 7623 Diaz, Gabriela, 7616 Gregg, Jeff P., 7794 Beiting, Daniel P., 7974 Dı´az-Gonza´lez, Federico, 8053 Grey, Howard, 7890 Belaramani, Lavina L., 7710 Dibble, John P., 7563 Gros, Philippe, 8022 Bella, Chantal, 7779 Dib-Hajj, Sulayman, 7822 Grumelli, Sandra, 8090 Bertheau, Robert, 7730 Dierich, Manfred P., 7840 Gutierrez, Astrid, 7616 Beswick, Ellen J., 8097 Di Mari, John F., 8097 Guy-Grand, Delphine, 7598 Biechele, Travis L., 7879 Doedens, Andrew, 7516 Blackburn, Michael R., 7879 Doherty, Peter C., 7616 Bliss, Stuart P., 7974 Dokal, Inderjeet, 7710 Haendle, Ina, 7703 Bliss, Susan K., 7974 Domı´nguez-Luis, Maria, 8053 Hafner, Mathias, 8203 Borgeat, Pierre, 8036 Dorighi, Kristel, 7943 Hahn, Bevra H., 7649 Bostik, Pavel, 7720 Douek, Daniel C., 7756 Hamann, Alf, 8073 Bover, Laura C., 8183 Dresch, Christiane, 7738 Hamann, Lutz, 7520 Bram, Richard J., 7531 Du, Qiujiang, 7859 Ha¨mmerling, Gu¨nter J., 7932 Brander, Christian, 7658, 7756, 7890 Duffy, Karen E., 7833 Han, Xinbing, 8013 Bratton, Donna L., 8117 Dustin, Michael L., 7747 Haraldsson, M. Katarina, 8195 Brenchley, Jason M., 7756 Hart, Melanie, 8212 Brocker, Thomas, 7738 Eberhardt, Meghan K., 7794 Hartshorn, Kevan L., 8046 Bromberg, Jonathan S., 7747 Ebling, Fanny, 7649 Hayakawa, Yoshihiro, 7540 Brown, Deborah M., 7563 Eckle, Tobias, 8127 Haydar, Tarik F., 7814 Brown, Kevin K., 8148 Eddaoudi, Ayad, 7868 Heijink, Irene H., 7678 Bui, Huynh-Hoa, 7890 Ehrenstein, Michael R., 7868 Heirman, Carlo, 7703 Byrne, Aideen, 8117 Eltzschig, Holger K., 8127 Hellmig, Stephan, 8203 Emig, Frances, 8138 Helmke, Burkhard, 8203 Calafat, Jero, 8053 End, Caroline, 8203 Hemmila, Mark R., 7902 Caldwell, Charles C., 7747 Erfurt, Cornelia, 7703 Henderson, Don C., 8212 Campbell, Iain L., 8175 Evans, Jamie G., 7868 Henson, Peter, 8117 Campbell, James J., 7598 Hertzog, Paul, 7540 Camps, Marcel G. M., 7581 Fan, Yijun, 7859 Hindre´, Thomas, 8168 Canchado, Javier, 8053 Farris, A. Darise, 7511 Hoek, Kristen L., 7531 Cancro, Michael P., 7531 Fausch, Steven C., 7587 Hoesel, Laszlo M., 7902 Capocasale, Renold J., 7833 Feinberg, Mark B., 8002 Holtzman, Michael J., 8107 Ca´rdenas-Navia, L. Isabel, 7747 Finney, Helene M., 7710 Hou, Sen, 7859 Cardo´-Vila, Marina, 8183 Flamand, Louis, 8036 Houghton, A. McGarry, 8090 Carlesso, Gianluca, 7531 Flamand, Ve´ronique, 7607 Hu, Hui, 7632 Carrithers, Lisette M., 7822 Fletcher, Jean M., 7710 Huang, Julie H., 7747 Carrithers, Michael D., 7822 Fo¨lsch, Ulrich R., 8203 Huizinga, Tom W. J., 7581 Caruso, Maria, 8175 Fortier, Anne, 8022 Hundhausen, Christian, 8064 Casey, Kerry A., 7640 Fourie, Anne, 8053 Hung, Stephanie, 8158 8230 AUTHOR INDEX

Ibla, Juan, 8127 Marincola, Francesco M., 7756 Plumb, Troy J., 7747 Ipaktchi, Kyros R., 7902 Marshall, Aaron J., 7859 Plunkett, Fiona J., 7710 Irvin, Charles C., 7879 Martin, Christine, 8168 Postma, Dirkje S., 7678 Iwakura, Yoichiro, 7571 Mathieu, Jacques, 7994 Poustka, Annemarie, 8203 Mauri, Claudia, 7868 Powell, Don W., 8097 Jacobsen, Elizabeth A., 7879 Mbow, M. Lamine, 7833 Poynter, Matthew E., 8148 Jakob, Thilo, 7623 McAllister, Brian, 8081 Prabhala, Rao, 7730 Janssen, Hans, 8053 McClure, Harold M., 8002 Price, David A., 7756 Janssen, William J., 8117 McGarry, Michael P., 7879 Protheroe, Cheryl A., 7879 Jeliazkova, Valentina, 7686 McKinstry, K. Kai, 7563 Pruenster, Monika, 7840 Jelley-Gibbs, Dawn M., 7563 McPhillips, Kathleen, 8117 Pypaert, Marc, 7822 Jennrich, Silke, 8073 Mecklenbra¨uker, Ingrid, 7814 Jin, Yi-Ping, 7911 Meier, Angela, 7658 Quesnel-Hellmann, Anne, 7994 Jindra, Peter T., 7911 Melendez, Karla, 8107 Quintero, Pablo A., 8090 Johnson, Christopher M., 7520 Mescher, Matthew F., 7640 Johnson, Randall S., 7516 Meyer-Bahlburg, Almut, 7868 Radoja, Nadezˇda, 7814 Jonas, Elizabeth A., 7822 Mifflin, Randy C., 8097 Radoja, Sasˇa, 7814 Jones, Christine C., 8148 Millward, Jason M., 8175 Radu, Caius G., 7747 Joos, Guy F., 7501 Milner, Richard, 8158 Rahman, Adeeb H., 7503 Joseph, Aviva, 7756 Mitsiades, Constantine, 7730 Rai, Pradeep R., 8148 Jung, Steffen, 7994 Mittelbronn, Michel, 8127 Raj, Beena Patricia Jeevan, 7923 Moldenhauer, Gerhard, 7932 Rangel, Roberto, 8183 Kaiga, Teruo, 7571 Molle, Ce´line, 7607 Ratsch, Boris A., 8073 Kambayashi, Taku, 7531 Mollenhauer, Jan, 8203 Rawlings, David J., 7868 Kaneda, Hide, 7571 Mollinedo, Faustino, 8053 Reed, Elaine F., 7911 Kang, Hee-Kap, 7849 Momburg, Frank, 7932 Reinheckel, Thomas, 7932 Kang, Jihee L., 8117 Monaco, John J., 7557 Reiss, Karina, 8064 Kan-Mitchell, June, 7756 Mondiere, Paul, 7779 Remigio, Linda, 8117 Kanneganti, Thirumala-Devi, 8022 Monu, Ngozi, 7814 Renner, Marcus, 8203 Kaplan, Mark H., 7550 Morgan, Ross K., 8081 Renneson, Joelle, 7607 Kast, W. Martin, 7587 Moyle, Graeme, 8212 Renz, Harald, 7805 Kauffman, Henk F., 7678 Mudd, Philip A., 7511 Reyes, Victor E., 8097 Kaur, Kanwal J., 7923 Muellauer, Brigitte, 7840 Ring, Johannes, 7623 Keates, Andrew C., 8013 Mueller, Martin J., 7623 Rittirsch, Daniel, 7902 Keates, Sarah, 8013 Mun˜oz-Planillo, Rau´l, 8022 Rocha, Paulo N., 7747 Kelleher, Peter, 8212 Munshi, Nikhil C., 7730 Roque, Susana, 8028 Kelly, Ciara´n P., 8013 Murray, Susan E., 7694 Rosenberger, Peter, 8127 Khan, Wasif N., 7531 Rosenstiel, Philip, 8203 Khayrullina, Tanzilya, 8138 Nakken, Britt, 7511 Rozengurt, Enrique, 7911 Khoury, Joseph, 8127 Nashed, Baher, 7859 Kies, P. Marcel, 7678 Nelson, Mark, 8212 Saada, Jamal I., 8097 Kim-Howard, Xana, 7511 Ng, Hwee L., 7756 Safrit, Jeffrey T., 8002 Kioschis, Petra, 8203 Nguyen, Muriel, 7607 Safroneeva, Ekaterina, 7984 Kono, Dwight H., 8195 Niederbichler, Andreas D., 7902 Saftig, Paul, 8064 Korin, Yael, 7911 Nikolaus, Susanna, 8203 Salmon, Mike, 7710 Kornfeld, Hardy, 8081 Nikolic, Damjan S., 7840 Salunke, Dinakar M., 7923 Kozyr, Natalia, 8002 Niu, Naiqian, 7501 Sanchez-Guajardo, Vanesa, 7550 Krishnan, Lavanya, 7923 Nizet, Victor, 7516 Sa´nchez-Madrid, Francisco, 8053 Kuniyasu, Akihiko, 8183 Noble, Erika S., 7720 Santiago-Raber, Marie-Laure, 8195 Nobrega, Claudia, 8028 Sarisky, Robert T., 7833 Lamb, Roberta J., 7833 Norman, Paul J., 7943 Sarma, J. Vidya, 7902 Lamkanfi, Mohamed, 8022 Nu´n˜ez, Gabriel, 8022 Sato, Marimo, 7571 Lara-Pezzi, Enrique, 8053 Sato, Wakiro, 7525 LaRosa, David F., 7503 Ochkur, Sergei I., 7879 Schaefer, Julia, 7902 Lawson, Alastair D. G., 7710 Olivas, Elvia, 7616 Schaubert, Keri L., 7756 Lee, C. Y. Daniel, 7794 O’Malley, John T., 7550 Schirmacher, Peter, 8203 Lee, James J., 7879 Omueti, Katherine O., 7520 Schreiber, Robert D., 7540 Lee, Nancy A., 7879 O’Neill, Katie R., 7879 Schreiber, Stefan, 8203 Legarda-Addison, Diana, 7767 Oseroff, Carla, 7890 Schuler, Gerold, 7703 Leitges, Michael, 7814 Ossendorp, Ferry, 7581 Schuler-Thurner, Beatrice, 7703 Lenox, Christopher C., 8148 Owen, Caroline A., 8090 Schulte, Alexander, 8064 Li, Cheng, 7730 Owens, Trevor, 8175 Schultz, Erwin S., 7703 Li, Jinzhu, 7756 Schulz, Beate, 8064 Liu, Michael, 7849 Paliga, Krzysztof, 8064 Schumann, Ralf R., 7520 Lomash, Suvendu, 7923 Pan, Yujun, 7511 Schuurhuis, Danita H., 7581 Ludwig, Andreas, 8064 Parham, Peter, 7943 Schwarz, Nicole, 8064 Lyer, Stefan, 8203 Parker, David C., 7694 Scott, Bernadette, 7540 Lyle, Elizabeth A., 7520 Pasqualini, Renata, 8183 Seagrave, JeanClare, 8107 Pasquetto, Valerie, 7890 Sel, Sarper, 7805 Ma, Jennifer S. Y., 7814 Paul, Elyse, 7756 Sel, Serdar, 7805 Maeno, Toshitaka, 8090 Pero, Ralph S., 7879 Selvaraj, Ramesh K., 7667 Maes, Tania, 7501 Peters, Bjoern, 7890 Sette, Alessandro, 7890 Majumder, Biswanath, 7756 Petty, Joseph M., 8148 Sewell, Andrew K., 7756 Malissen, Bernard, 7598 Peyssonnaux, Carole, 7516 Shammas, Masood, 7730 Malissen, Marie, 7598 Pfister, Gerald, 7840 Shapiro, Steven D., 8090 Mandrekar, Pranoti, 7686 Pianko, Matthew J., 7902 Sheehan, Kathleen C. F., 7540 Marconi, Peggy, 7738 Piguet, Vincent, 7840 Sheibanie, Amir F., 8138 Mariani, Valentina, 7623 Pinchuk, Irina V., 8097 Shen, David T., 7814 AUTHOR INDEX 8231

Shen, Huahao, 7879 Teigen, Nickolas, 7658 Wang, Xiaoyun, 8158 Shurin, Galina V., 7787 Tesfaigzi, Yohannes, 8107 Ward, Peter A., 7902 Shurin, Michael R., 7787 Theofilopoulos, Argyrios N., 8195 Waxman, Stephen G., 7822 Sidney, John, 7890 Thiel, Martina, 7623 Weber, Christian, 8064 Sijts, Alice J. A. M., 7557 Thielemans, Kris, 7703 Webster, David, 7710 Silvestri, Guido, 8002 Till, Andreas, 8203 Wegmann, Michael, 7805 Sina, Christian, 8203 Ting, Adrian T., 7767 Wehrmann, Manfred, 8127 Singh, Ram Pyare, 7649 Tiwari, Neeraj, 7932 Wei, Sheng, 7787 Sitkovsky, Michail, 7747 Toes, Rene´ E. M., 7581 Weinberg, Andrew D., 7694 Smyth, Mark J., 7540 Tokmoulina, Gouzel, 7822 Weiss, Daniel J., 8148 Stadanlick, Jason E., 7531 Tourkova, Irina L., 7787 Werner-Klein, Melanie, 7738 Staprans, Silvija I., 8002 Tournier, Jean-Nicolas, 7994 Westfall, Margaret V., 7902 Steel, Alan, 8212 Tournoy, Kurt G., 7501 White, Mitchell R., 8046 Stepensky, Vitaly A., 7520 Traidl-Hoffmann, Claudia, 7623 Wiens, Gregory D., 7955 Stephenson, Susan T., 7720 Tremblay, Michel J., 8036 Wilder, Tuere, 7747 Stoiber, Heribert, 7840 Treml, Laura S., 7531 Wilflingseder, Doris, 7840 Stout, Barbara A., 8107 Trottein, Franc¸ois, 7607 Willems, Fabienne, 7607 Streeck, Hendrik, 7658 Tugores, Antonio, 8053 Williams, Cortny A., 7694 Strutt, Tara M., 7563 Tuma, Ronald, 8138 Wilson, Bridget, 8107 Su, Grace L., 7902 Turka, Laurence A., 7503 Wilson, Patrick C., 7511 Suarez, Giovanni, 8097 Turner, Stephen J., 7616 Wilson, Robert, 8212 Sueblinvong, Viranuj, 8148 Winston, John, 8097 Sumpter, Beth, 8002 Valenzuela-Ferna´ndez, Agustı´n, 8053 Winter, Ulrike, 8064 Sun, Jessica, 8183 Vallon-Eberhard, Alexandra, 7994 Wong, Maida, 7649 Sun, Zhaojun, 7703 Vandenabeele, Peter, 8022 Wurbel, Marc-Andre´, 7598 Suratt, Benjamin T., 8148 van der Bruggen, Pierre, 7703 Suscovich, Todd J., 7658 van der Voort, Ellen I. H., 7581 Xiang, Jialing, 8107 Swain, Susan L., 7563 Van Hove, Chris L., 7501 Xing, Zhou, 7984 Swann, Jeremy B., 7540 van Kooten, Cees, 7581 Syrbe, Uta, 8073 van Montfoort, Nadine, 7581 Yamamura, Takashi, 7525 Szabo, Gyongyi, 7686 van Oosterhout, Antoon J. M., 7678 Yang, Otto O., 7756 Szodoray, Peter, 7511 Vareille, Marjolaine, 8168 Yang, Xi, 7859 Vellenga, Edo, 7678 Yawata, Makoto, 7943 Tahara, Hideaki, 7571 Verbeek, J. Sjef, 7581, 7587 Yegin, Olcay, 7520 Tai, Yu-Tzu, 7730 Verrier, Bernard, 7994 Yen, Jui-Hung, 8138 Taillardet, Morgan, 7779 Vidal, Dominique, 7994 Yeung, Mandy, 7632 Takayama, Tadatoshi, 7571 Villinger, Francois, 7720 Takenaka, Shunsuke, 7984 Vogt, Peter M., 7902 Zaiss, Dietmar M. W., 7557 Takeya, Motohiro, 8183 von Hundelshausen, Philipp, 8064 Zerafa, Nadeen, 7540 Tanchot, Corinne, 7550 Vukmanovic´, Stanislav, 7814 Zhang, Ming, 8138 Tapping, Richard I., 7520 Zhang, Qingzhao, 7511 Teague, Brittany N., 7511 Wang, Huiying, 7879 Zhang, Xiaohai, 7911 Tecle, Tesfaldet, 8046 Wang, Stewart C., 7902 Zinkernagel, Annelies S., 7516 Author Index to Volume 178

Abbott, Christina M., 7467 Alba, Aurora, 6533 Ansems, Marleen, 154 Abbott, Derek J., 2835 Albarani, Valentina, 5048 Ansorge, Siegfried, 4632 Abdala-Valencia, Hiam, 3865 Alber, Gottfried, 7805 Anthony, Donald D., 4436 Abdel-Motal, Ussama M., 4676 Albert, Matthew L., 6038 Antunes, Fernando, 3893 Abdullah, Zeinab, 3390 Albina, Jorge E., 7276 Anzala, A. Omu, 3750 Abe, Yusuke, 1189 Albini, Adriana, 1122 Aoki, Naoko, 1189 Abi-Rached, Laurent, 7943 Albuquerque, Adriana S., 3252 Apostolou, Irina, 1477 Abken, Hinrich, 4650 Alcaide, Pilar, 1136, 5879 Appelberg, Rui, 8028 Abraham, Clara, 2104 Alcaraz, Ana, 7974 Appleton, Judith A., 1039, 7974 AbuAttieh, Mouhammed, 2950 Aldaz-Carroll, Lydia, 6374 Apt, Alexander S., 976 Aburatani, Hiroyuki, 6994 Alexander, Denis R., 3474 Arai, Fumio, 103 Accardi, Rosita, 3186 Alexander-Brett, Jennifer M., 4623 Aramaki, Yukihiko, 584 Accavitti-Loper, Mary Ann V., 5357 Alexopoulou, Lena, 5200 Aranami, Toshimasa, 7525 Adachi, Takahiro, 2901 Alfaidy, Nadia, 1598 Arap, Wadih, 8183 Adachi, Tetsuo, 3316 Algeciras-Schimnich, Alicia, 4846 Arase, Hisashi, 647 Adam, Estelle, 1713 Alisa, Akeel, 1914 Arata, Satoru, 7042 Adamopoulou, Eleni, 5465 Allard, Jenna, 7064 Araujo, Luiza M., 5435 Adams, Lisa M., 5668 Allen, Amy N., 2163 Arbabi, Saman, 7902 Adams, Sharon, 7756 Allen, Samantha J., 3713 Archer, David, 4194 Adatia, Femina, 6092 Allen, Stephanie D., 7120 Archibeque, Tereassa, 4584 Adcock, Ian M., 2491, 7366 Allende, Luis M., 2556 Ardehali, Abbas, 511 Addison, Elena, 85 Allendorf, John, 7432 Ardiet, Denis-Luc, 6746 Adema, Gosse J., 154 Allison, David B., 2746 Arendt, Bonnie K., 5612 Aderem, Alan, 4250, 4717 Allore, Heather G., 970 Arias, Cristina F., 2296 Adkins, Becky, 2667 Almeida, Catarina R., 5606 Aries, Marie-Franc¸oise, 5571 Adnan, Sama, 2746 Alpdogan, O¨ nder, 7473 Arigo`, Milena, 4417 Adorini, Luciano, 145 Alphonse, Martin P., 2535 Arima, Kazuhiko, 6720 Aesif, Scott W., 3814 Alpsoy, Erkan, 7520 Arimura, Kimiyoshi, 5888, 5966 Agadjanyan, Michael G., 566 Alsaaty, Sara, 5262 Arimura, Yutaka, 3680 Agarwal, Rajeev K., 7072 Al-Sadi, Rana M., 4641 Arispe, Kiea, 3695 Agarwal, Vaibhav, 5848 Altare, Fre´de´ric, 3161 Arita, Makoto, 3912 Agea, Elisabetta, 3620 Alter, Galit, 7658 Arlaud, Ge´rard J., 5710 Aggarwal, Bharat B., 2507, 8183 Altfeld, Marcus, 7658, 7756 Arlen, Philip, 3492 Agger, Teit, 5710 Altuwaijri, Saleh, 6730 Armes, Jane E., 6435 Agrawal, Alok, 1158, 7302 Alugupalli, Kishore R., 3740 Arnaboldi, Francesca, 4296 Agrawal, Anshu, 6912 Alvarez-Barrientos, Alberto, 3731 Arneson, Laura N., 3575 Agrawal, Neerja, 6876 A´ lvarez-Errico, Damiana, 808 Arnett, Heather A., 1523 Agrawal, Reena, 2047 Amadori, Alberto, 1122 Arock, Michel, 6465 Agrawal, Sudhanshu, 6912 Amano, Shiro, 3288 Aronica, Mark, 6482 Aguet, Michel, 6746 Amante, Fiona H., 6033 Aronoff, David M., 1628 Aguilar, Helena, 4402 Amariglio, Ninette, 201, 2307 Arredouani, Mohamed S., 5912 Ahamed, Jasimuddin, 5366 Amato, Anthony A., 547 Arribillaga, Laura, 748 Ahlfors, Helena, 3648 Amer, Amal, 8022 Arrode, Geraldine, 2318 Åhlin, Erik, 5383 Ammann, Christoph G., 7840 Arruvito, Lourdes, 2572 Ahlqvist, Emma, 3084 Ampudia, Rosa Maria, 6533 Arseneau, Kristen O., 1809 Ahmed, Chulbul M., 4576, 5058 Amuchastegui, Susana, 145 Arstila, T. Petteri, 1208 Ahmed, Rubina, 5116 Anderegg, Ulf, 4966 Artavanis-Tsakonas, Katerina, 7199 Ahmed, Tanvir, 1443 Andersen, Peter, 3721 Arthur, Janelle C., 1256 Ahn, Kwang Seok, 2507 Andersen-Nissen, Erica, 4717 Asaad, Robert, 4436 Ahn, Yong-Tae, 5496, 7081 Anderson, Ana C., 6158 Asadullah, Khusru, 5973 Ahuja, Seema S., 5668 Anderson, Bradley M., 4147 Asano, Koichiro, 489 Ahuja, Sunil K., 5668 Anderson, David E., 4017, 6158 Ashby, Charlotte A., 5533 Aiba, Setsuya, 5086 Anderson, Don H., 3831 Asher, Damon R., 3363 Aichele, Peter, 2241 Anderson, Kenneth C., 7730 Ashok, Mala, 3856 Aicheler, Rebecca J., 4473 Anderson, Michael J., 1268 Ashton-Rickardt, Philip G., 3483 Aiello, Francesca B., 1553 Anderson, Robert, 85 Ashwell, Jonathan D., 4153 Aı¨t-Azzouzene, Djemel, 6332 Andersson, John, 4022, 6901 Ashworth, Todd, 2631 Aiuti, Fernando, 3932 Andreakos, Evangelos, 2148 Aslan, Mihaela, 592 Ajona, Daniel, 5991 Andreasen, Karl, 2407 Asmawidjaja, Patrick, 657 Akagi, Takami, 2979 Andrei, Fabio, 5957 Asosingh, Kewal, 6482 Akahoshi, Tohru, 1144, 3059 Andrews, Nicolas P., 7267 Assarsson, Erika, 5018, 7890 Akashi, Mitsuru, 2979 Andrews, Norma W., 1498 Atkins, Harry, 6092 Akbar, Arne N., 6689, 7710 Andreyeva, Tatyana A., 5124 Atlas, Ann, 5340 Akhtar, Shamsuddin, 592 Andrzejewski, Michael G., 8064 Atreya, Imke, 3427 Akira, Shizuo, 2182, 3153, 3170, 3740, Anfosso, Luca, 1122 Aucher, Anne, 3637 4717, 6715, 6876 Angel, Jonathan B., 798 Aumeunier, Aude, 5435 Aksoy, Ezra, 1301 Angele, Barbara, 1861 Auron, Philip E., 5413 Alabyev, Boris, 897, 5623 Angelisova´, Pavla, 1991 Aurrand-Lions, Michel, 5879 Alaedini, Armin, 6590 Anguita, Juan, 7064 Austin, Bobbie Ann, 5166 Alaie-Petrillo, Adrienne, 6297 Annibali, Viviana, 6208 Austin, Sarah J., 4506 Al-Alwan, Monther M., 2328, 7859 Anolik, Jennifer, 6624 Autschbach, Frank, 8203 Alam, S. Munir, 4424 Ansari, Aftab A., 3492, 7720 Auwerx, Johan, 4362 AUTHOR INDEX 8233

Avanesyan, Armine, 3293 Barrett, Masheka A., 6710 Benyon, R. Christopher, 5288 Avci, Recep, 1059 Barrett, Ronald P., 1105 Benz, Claudia, 858 Averbeck, Marco, 4966 Barrett, Simon P., 4089 Berahovich, Robert, 7395 Averdam, Anne, 7151 Barrett, Trisha F., 1800 Be´rard, Fre´de´ric, 5571 Awad, Alaa S., 4240 Barrionuevo, Paula, 436 Berek, Claudia, 1180 Ayaru, Lakshmana, 1914 Barry, Ashley P., 8002 Berezov, Alan, 1021 Ayi, Kodjo, 3954 Barry, Peter A., 7794 Berg, Louise, 3536 Ayyavoo, Velpandi, 7756 Bartholdy, Christina, 1662 Berg, Rance E., 2028 Azevedo, Jorge E., 3612 Bartsch, Brigitte, 3427 Berghe, Wim Vanden, 5048 Azuma, Masaki, 103 Baruzzi, Anna, 3874 Bergho¨fer, Beate, 4072 Baschuk, Nikola, 3390 Bergmann, Christoph, 320 Baan, Carla C., 6066 Bashirova, Arman, 33 Bergmeier, Lesley A., 1671 Baatar, Dolgor, 4891 Bassaganya-Riera, Josep, 2940 Bergstro¨m, Tomas, 3536 Baba, Masanori, 2979 Bassotti, Gabrio, 3620 Bergtold, Amy, 6217 Babaahmady, Kaboutar, 1671 Basu, Sreyashi, 3260 Berhanu, Aklile, 3400 Baccala, Roberto, 5366 Batchu, Ramesh Babu, 7730 Berkun, Yakov, 201 Bach, Fritz H., 5921 Bates, Elizabeth, 3186 Berlin, Aaron A., 5820 Bach, Jean-Marie, 7458 Batteux, Fre´de´ric, 1115 Berloco, Pasquale, 7432 Bach, Patricia, 5839 Baudard, Marion, 3307 Bernales, Cecily Q., 5735 Bachmann, Martin F., 67, 2415, 7450 Bauer, Karl, 1180 Bernard, Alain, 5930 Badley, Andrew D., 4846 Bauer, Monika, 7450 Bernard, Franc¸ois-Xavier, 4615 Badovinac, Vladimir P., 6109 Bauer, Stefan, 7805 Bernard, Nicholas J., 5779 Bae, Jooeun, 7730 Bauler, Timothy J., 3680 Bernstein, Steven H., 4051 Baecher-Allan, Clare, 6158 Baumgaertner, Petra, 3566 Berntman, Emma, 5018 Baerg, Heather, 2932 Baumgarth, Nicole, 1457, 7794 Bertera, Suzanne, 4260 Baeten, Dominique, 557 Baxter, Alan G., 1618 Bertheau, Robert, 7730 Bagavant, Harini, 2565 Bayer, Allison L., 4062 Berton, Giorgio, 3874 Bagchi, Aranya, 1164 Bayry, Jagadeesh, 4184 Berzins, Stuart P., 2827 Bagley, Jessamyn, 4757 Bean, Alexander T., 2746 Berzofsky, Jay A., 7211 Bahl, Pru, 2908 Bear, Susan E., 5443 Besack, Dave, 5099 Bai, Ailin, 7632 Beaty, Steven R., 1882 Besenbacher, Flemming, 3016 Bai, Xue-Feng, 6227 Beauchemin, Catherine, 5505 Besin, Gilles, 2241 Bailly, Ve´ronique, 2249 Beaudet, Arthur L., 851 Besra, Gurdyal S., 1415, 2827, 6181 Baine, Ian, 1415 Beaudoin, Lucie, 1332 Bessa, Juliana, 67, 2415 Baiu, Dana C., 520 Beck, Markus, 7450 Bessler, Waylan, 2527 Baker, Chris A. R., 3265 Beck, Stephan, 5744 Best, Donna, 4455 Baker, Ken, 5744 Becker, Amy M., 4120 Beswick, Ellen J., 8097 Bakhsh, Ismail, 85 Becker, Doreen, 6476 Bevan, Michael J., 5429 Bakshi, Chandra Shekhar, 1013 Becker, Tamara, 7151 Beyer, Marc, 6931 Balachandran, Siddharth, 2429 Becker, Todd, 1059 Bezman, Natalie, 4606 Balamuth, Fran, 5543 Becknell, Brian, 4832 Bhandari, Vineet, 4993 Baldwin, Albert S., Jr., 4803 Bedoya, Felipe, 3837 Bhandoola, Avinash, 2008 Ball, T. Blake, 3750 Beelen, Dietrich W., 3918 Bianco, Alberto, 6700 Ballerini, Patrizia, 720 Beermann, Friedrich, 6746 Bianco, Germa´n A., 436 Ballesteros-Tato, Andre´, 2296 Beg, Amer A., 6770, 6777 Biassoni, Roberto, 1702 Ballinger, Megan N., 1628 Begum, Mst Dilara, 3786 Bichet, Jean-Christophe, 3373 Balomenos, Dimitrios, 2296 Behboudi, Shahriar, 1914 Biechele, Travis L., 7879 Bals, Robert, 3134 Behrendt, Heidrun, 7623 Bielefeldt-Ohmann, Helle, 4538 Balsari, Andrea, 4296 Behrens, Axel, 5690 Bigenzahn, Sinda, 3924 Bambara, Lisa M., 7325 Behrens, Edward M., 6268 Bilenki, Laura, 1048 Bamias, Giorgos, 1809 Beigier-Bompadre, Macarena, 436 Biliato, Alexandra, 3186 Bandaru, Raj, 7442 Bein, Gregor, 4072 Billeskov, Rolf, 3721 Bandettini, Roberto, 5144 Beiting, Daniel P., 1039, 7974 Billiar, Timothy R., 6573 Bang, Boram, 5375 Bekeredjian-Ding, Isabelle, 2803 Binne´, Lauri L., 4342 Bangsberg, David R., 3265 Belaaouaj, Abderazzaq, 5871 Biondo, Carmelo, 3126, 4417 Banham, Alison H., 2572 Belaramani, Lavina L., 7710 Biragyn, Arya, 4891 Bank, Ilan, 201 Be´lec, Laurent, 1086 Bishop, Caroline, 3661 Bankert, Richard B., 4051, 5552 Belisle, John T., 4538 Bishop, Gail A., 671 Banki, Zoltan, 7840 Belkaid, Yasmine, 4136 Bismuth, Georges, 4351, 6821 Baptista, Marina, 1379 Bell, Charles W., 6495 Bistoni, Onelia, 3620 Baranzini, Sergio E., 5076 Bell, John I., 944, 5727 Biswas, Kaushik, 6642 Barat, Corinne, 2862 Bella, Chantal, 7779 Biswas, Soumika, 6642 Barber, Glen N., 2429, 6444, 7267 Bellfy, Sarah, 5227 Bitonti, Alan, 5390 Barber, Melissa A., 6140 Bellinger, Adam S., 5668 Bjordahl, Ryan, 2407 Barbey, Catherine, 3566 Belnoue, Elodie, 6416 Blackburn, Michael R., 7879 Barbosa, Rita, 4351 Belperio, John A., 511 Blackman, Marcia A., 1692 Barbry, Pascal, 3161 Beltran, Jacqueline, 3260 Blackshear, Perry J., 2813 Bard, Julie D. J., 4584 Belyakov, Igor M., 7211 Blackwell, Timothy S., 702, 6504 Barington, Torben, 4322, 4708 Ben, Li-Hong, 1341 Blahoianu, Maria A., 798 Barkhausen, Tanja, 5940 Bendelac, Albert, 58, 1332 Blair, Derek, 4726 Barlos, Dimitrios, 5253 Benetie`re, Josette, 5571 Blalock, J. Edwin, 1013 Barnes, Peter J., 2491 Ben-Horin, Shomron, 201 Blanchard, Dominique, 2763 Barnett, Jim W., 2641 Beninati, Concetta, 3126, 4417 Blancou, Philippe, 7458 Barnum, Scott R., 851 Benlagha, Kamel, 58 Blazar, Bruce R., 280 Baron, Colin A., 7794 Benmansour, Abdenour, 4385 Bleul, Conrad C., 858 Bar-Or, Amit, 6092 Benoist, Christophe, 7032 Blimkie, Darren, 3695 Barrachina, Marta, 6307 Benoit, Stephen E., 2589 Bliss, Stuart P., 7974 Barratt-Boyes, Simon M., 6958 Bensussan, Armand, 1293 Bliss, Susan K., 1039, 7974 8234 AUTHOR INDEX

Blom, Anna M., 6359, 7242 Bratton, Donna L., 6540, 8117 Bushara, Khalafalla O., 6590 Blomberg, Bonnie B., 3521 Braun, Johann S., 6476 Buskirk, Elizabeth J., 2835 Blount, Daniel G., 4136 Brauweiler, Anne, 3353 Busslinger, Meinrad, 3031 Boackle, Susan A., 4667 Breiter, Deborah R., 3301 Butchar, Jonathan P., 4445 Boasso, Adriano, 3492 Bremner, Rod, 345 Butcher, Eugene C., 3713 Bochtler, Petra, 2083 Bren, Gary D., 4846 Butler, Betsy R., 5659 Bockermann, Robert, 3084 Brenchley, Jason M., 7756 Butler, John E., 6320 Bode, Johannes G., 2813 Brenndo¨rfer, Erwin D., 2813 Butnor, Kelly J., 1800 Body-Malapel, Mathilde, 2380 Brenner, Max, 2344 Bygrave, Anne E., 2352 Boehm, Bernhard O., 4749 Brewer, Avery W., 1523 Byrd, Benjamin, 6374 Boes, Marianne, 2192 Briani, Chiara, 6590 Byrne, Aideen, 8117 Boesze-Battaglia, Kathleen, 5099 Bricard, Gabriel, 3566 Byrne, Susan, 3483 Bogacheva, Polina, 976 Briles, David E., 5828 Bogen, Bjarne, 4169 Briles, W. Elwood, 7162 Cabbage, Sarah E., 887 Bogiatzi, Sofia I., 3373 Brimer, Christine M., 7334 Cabrelle, Anna, 1312 Boiani, Norman, 1523 Brinkman, C. Colin, 1512 Cabrol, Dominique, 1115 Boirivant, Monica, 732 Brocke, Stefan, 4632 Caceres, Gisela, 6444 Bolton, Eleanor M., 2221 Brocker, Thomas, 7738 Caci, Emanuela, 5144 Bonaminio, Dana, 2440 Broderick, Lori, 5552 Caciagli, Francesco, 720 Bondada, Subbarao, 111 Brodin, Veronika Patcha, 7357 Cafardi, John M., 3272 Bonello, Gregory, 5668 Broers, Annoek E. C., 3551 Cagney, Gerard, 4595 Bongfen, Silayuv E., 7054 Broide, David H., 5321, 7310 Cai, Hong, 1852 Bonhagen, Kerstin, 2661 Brombacher, Frank, 7450 Cai, Yeping, 219 Boniface, Katia, 4615 Bromberg, Jonathan S., 4623, 7747 Cai, Yong-Chun, 1608 Bonthuis, Paul J., 1002 Brooks, David, 3492 Caignard, Anne, 6821 Bonventi, Gabriel, 1608 Brooks, James, 6624 Caillier, Stacy J., 5076 Boon, Louis, 6894 Brors, Benedikt, 6931 Cain, Hilary, 1948 Boon, Thierry, 2617 Brossart, Peter, 154 Calado, Rodrigo T., 4159 Boothroyd, John C., 5154 Brouet, Agne`s, 1505 Calafat, Jero, 8053 Bora, Nalini S., 1783 Brouillette, Eric, 2171 Calcaterra, Claudia, 4296 Bora, Puran S., 1783 Browder, I. William, 7317 Caldwell, Charles C., 7747 Bordier, Christine, 3637 Brown, Amy, 3814 Callaghan, Chris J., 2221 Borelli, Manuela, 1931 Brown, Charles R., 5109 Callis, Gayle, 1791 Boren, David, 4424 Brown, David C., 3903 Calzetti, Federica, 7325, 7344 Borgeat, Pierre, 8036 Brown, Deborah M., 7563 Camacho, Zenaido T., 4424 Bornstein, Paul, 5930 Brown, Eric J., 3048, 5930 Camargo, Jose F., 5668 Borra´s-Cuesta, Francisco, 748 Brown, Helen J., 3492 Cambier, John C., 3353 Borregaard, Niels, 6540 Brown, Kevin K., 8148 Camelo, Ana, 1379 Borysiewicz, Leszek K., 4473 Brown, Kevin N., 6958 Camenisch, Todd D., 5635 Bos, Jan D., 1986 Brown, Marion H., 4351 Cameron, Paul U., 6581 Bosca´, Lisardo, 3731 Brown, Michael G., 5899 Cameron, Thomas O., 788 Bosio, Catharine M., 1059, 4538 Brown, Scott A., 3091 Campbell, Donald, 3627 Bosma, Brenda M., 6066 Brown, Thomas P., 3822 Campbell, Iain L., 8175 Boss, Jeremy M., 961, 6675 Browner, Michelle F., 2641 Campbell, James J., 3358, 7598 Bossi, Fleur, 1312 Brunner-Weinzierl, Monika C., 2132 Campo, Elias, 1923 Bostik, Pavel, 7720 Bruno, Graziella, 7458 Camps, Marcel G. M., 7581 Botella, Laure, 3161 Bruno, Roxana, 6533 Canasto-Chibuque, Claudia, 4623 Botto, Marina, 1861, 2352, 2916, 6514 Brusselle, Guy G., 5305 Canchado, Javier, 8053 Bottomly, Kim, 5543 Bruton, Rachel, 4455 Cancro, Michael P., 7531 Boudinot, Pierre, 4385 Bryl, Ewa, 771 Cantin, Re´jean, 2862 Bouhlal, Hicham, 1086 Bucala, Richard, 2469 Cantoni, Claudia, 2688 Boulassel, Rachid, 788 Buchholz, Christian J., 5839 Cao, Huyen, 3265 Boulter, Jonathan M., 5727 Bu¨chmann, Ingrid, 6931 Cao, Jia-Ning, 6912 Boumsell, Laurence, 6821 Buck, Amanda L., 1321 Cao, Yu-An, 838 Bourgeois, Christine, 5488 Budelsky, Alison L., 1523 Capocasale, Renold J., 7833 Bouriez-Jones, Tiphaine, 4276 Buelta, Luis, 2778 Cappione, Amedeo, 6624 Bouvard, Veronique, 3186 Bugajska-Schretter, Agnes, 6290 Caprioli, Flavio, 5957 Bouvier, Marlene, 4567 Bui, Huynh-Hoa, 6814, 7890 Capron, Monique, 1713 Bouzin, Caroline, 1505 Bukowski, Ronald, 6642 Caputo, Antonella, 5144 Bover, Laura C., 8183 Bullard, Daniel C., 851 Carballido, Jose M., 4335 Bowdish, Katherine S., 5595 Bunnell, Stephen C., 1443 Carbone, Ennio, 3536 Boxio, Rachel M. M., 5871 Bunting, Karen, 7097 Cardell, Susanna, 5018 Boyd, Kelli, 4214 Buonocore, Sofia, 1301 Ca´rdenas-Navia, L. Isabel, 7747 Boyd, Richard L., 4956, 7473 Buracchi, Chiara, 6616 Cardinale, Irma, 7442 Boyle, David L., 2636 Buranda, Tione, 6828 Cardo´-Vila, Marina, 8183 Boyle, Joseph J., 3767, 4395 Burchill, Matthew A., 280 Carello, Rossella, 3932 Braakman, Eric, 3551 Burdick, Marie D., 511 Carey, Brenna, 2440 Braathen, Ranveig, 1589 Burdo, Tricia H., 5812 Caricato, Marco, 7432 Brabb, Thea, 887 Burger, Danielle, 446 Carl, Joseph W., Jr., 6227 Bradfield, Paul F., 5879 Burgess, Antony W., 6435 Carlesso, Gianluca, 7531 Bradley, J. Andrew, 2221 Burke, Bernie, 4779 Carletto, Antonio, 7325 Bradshaw, Elizabeth M., 547 Burkum, Claire E., 1692 Carlier, Yves, 5182 Brady, Jason, 4764 Burlingham, William J., 3983 Carlucci, Francesco, 2352 Braff, Marissa H., 1829 Burroughs, Andrew K., 1914 Carmeliet, Peter, 4267 Bram, Richard J., 7531 Burshtyn, Deborah N., 1261 Carmo, Alexandre M., 4351 Brandal, Stephanie, 378 Burwitz, Benjamin J., 2746 Carmody, Ruaidhrı´ J., 186 Brander, Christian, 7658, 7756, 7890 Busch, Dirk, 1573, 4908 Carmo-Fonseca, Maria, 3612 Brandtzaeg, Per, 1589 Bushanam, Jessica N., 740 Carnathan, Diane G., 4803 AUTHOR INDEX 8235

Carr, Daniel J. J., 5166 Chebloune, Yahia, 2318 Chow, Lu-Ping, 5237 Carr, William H., 647 Chemnitz, Jens M., 6931 Christensen, Jan Pravsgaard, 1662 Carrega, Paolo, 4947 Chen, Aoshuang, 3301 Christman, John W., 6504 Carrier, Yijun, 172, 179 Chen, Biao, 936 Chu, Fuliang, 944 Carrillo, Jorge, 6533 Chen, Celia X.-J., 2483 Chu, Jang-Hann J., 2699 Carrington, Mary, 33 Chen, Dazhi, 3856 Chuang, Da-Yung, 6984 Carrithers, Lisette M., 7822 Chen, Dong, 5480 Chun, Eun-Young, 5375 Carrithers, Michael D., 7822 Chen, Grace, 8022 Chun, Tae-Wook, 6968 Carson, William E., III, 4832 Chen, Haiying, 6028 Chung, Chungwon, 2746 Carstens, Jennifer K., 1628 Chen, Jia, 416 Chung, Heekyung, 1443 Carter, John H., 3038, 6796 Chen, Jian, 5357 Chung, Kian Fan, 7366 Carter, Robert H., 5357 Chen, Jiang-Fan, 5921 Chung, Shih-Ye, 4688 Carter, Tim, 5116 Chen, Jianzhu, 7632 Chupp, Geoffrey, 1948 Caruso, Maria, 8175 Chen, Jichun, 4159 Ciborowski, Pawel, 6404 Caruso, Roberta, 732, 5957 Chen, Keqiang, 1759 Ciccarelli, Renata, 720 Casals, Cristina, 6307 Chen, Lei, 4315 Cichy, Joanna, 3713 Casares, Noelia, 748 Chen, Liang, 2730 Cihakova, Daniela, 6710 Cascalho, Marilia, 2950 Chen, Liangen, 6634 Cimburek, Zdeneˇk, 711 Casciola-Rosen, Livia, 95 Chen, Lieping, 1931, 4194, 6634 Cinti, Paola, 7432 Casella, Carolyn R., 6083 Chen, Li-Yuan, 5262 Cippitelli, Marco, 4039 Casey, Kerry A., 7640 Chen, Peter W., 6115 Ciric, Bogoljub, 1426 Caspi, Rachel, 5578, 7072 Chen, Pojen, 4424, 5351 Cittera, Elena, 6616 Cassatella, Marco A., 1312, 7325, 7344 Chen, Sabrina M., 6504 Clapp, D. Wade, 2527 Castelli, Chiara, 1975 Chen, Shi, 2527 Clare-Salzler, Michael J., 3886 Castellino, Flora, 778 Chen, Shih-Yao, 4688 Clark, Richard, 3265 Castro, Mo´nica A. A., 4351 Chen, Shun-Le, 5351 Clark, Robert B., 4129 Catalano, Donna, 7686 Chen, Wei-Ru, 3023 Clark, Sally A., 8212 Catlett, Sally V., 1013 Chen, Weiwei, 6634 Clarke, Stephen E., 5533 Catley, Lawrence, 7730 Chen, Xiaohong, 539 Clarke, Stephen H., 5982 Caton, Andrew, 4793, 6028 Chen, Xiaoru, 5366 Classen, Sabine, 6931 Cava, Antonio La, 7649 Chen, Xiao-Xiang, 5351 Classon, Brendan J., 4956 Cavacini, Lisa A., 7132 Chen, Xin, 6123 Clay, Corey D., 4445 Cavinato, Tiziana, 228 Chen, Xiuxu, 6181 Clayberger, Carol, 77, 3688, 5496, 7081 Cejudo-Martin, Pilar, 7516 Chen, Yi-Tien, 2483 Clayson, Barbara A., 2835 Celada, Antonio, 6307 Chen, Youhai H., 186, 503 Clayton, Linda K., 3668 Celis, Esteban, 1189 Chen, Yuhong, 49 Clayton, Natasha, 7422 Center, David M., 8081 Chen, Yu Wai, 944 Clemens, Regina A., 4606 Cerny, Anna M., 5173 Chen, Zhi, 3648 Cleret, Aure´lie, 7994 Cerottini, Jean-Charles, 3566 Cheng, Dong-sheng, 6504 Clerici, Mario, 407, 1931 Cerundolo, Vincenzo, 2721, 2908 Cheng, Genhong, 6705 Clise-Dwyer, Karen, 1321 Cervasi, Barbara, 1680 Cheng, Lu, 2755 Cloutier, Alexandre, 7344 Cerwenka, Adelheid, 1991 Chermoshnuk, Helly, 201 Clynes, Raphael, 6217, 6259 Chabot, John, 7432 Cheroutre, Hilde, 4230 Coccia, Eliana M., 6208 Chai, Jian-Guo, 3558 Chevalier, Sylvie, 4615 Cocco, Lucio, 4011 Chaillous, Lucy, 7458 Chi, Hongbo, 2730 Coghlan, Lezlee, 829 Chakravarty, Soumya D., 1723 Chi, Michael H., 2651 Cogswell, Patricia C., 4803 Chaloin, Olivier, 6700 Chiang, Cern-Cher S., 2699 Cohavy, Offer, 5524 Chambers, Benedict J., 5018 Chiang, Nan, 3912 Cohen, Gary H., 6374 Chambon, Pierre, 2113 Chiang, Yi-Ming, 6984 Cohen, Patrice A., 2787 Chamekh, Mustapha, 6700 Chiang, Y. Jeffrey, 926 Cohn, Lauren, 3846, 6191, 7501 Chamian, Francesca, 7442 Chiba, Kenji, 3437 Cohn, Zanvil A., 5 Chan, Chi-Chao, 5578 Chidgey, Ann, 4956, 7473 Colau, Didier, 6761 Chan, John, 1723, 7222 Chieco-Bianchi, Luigi, 1122 Colbert, Dana C., 7879 Chan, Melvin, 3363, 5173 Chigaev, Alexandre, 6828 Colby, Thomas V., 7879 Chan, Philippe, 3323 Chignard, Michel, 3368 Cole, David K., 5727 Chang, Alfred, 6730 Chiles, Thomas C., 4726 Coleman, Kathrin E., 1819 Chang, Chih-Chao, 7432 Chilton, Paula M., 6083 Coleman, Nicole, 1628 Chang, Cicero Lee-Tian, 6984 Chin, Cecilia L., 6395 Colin, Ingrid, 4385 Chang, Elmer Y., 6705 Chiodi, Francesca, 5340 Collins, Mary, 3822 Chang, Hua-Chen, 4901 Chiriac, Mircea T., 6514 Collins, Robert G., 851 Chang, Hyeun-Wook, 7042 Chisari, Francis V., 2714 Collins, Samuel L., 2163 Chang, King-Chan, 3023 Chiu, Li-Li, 5237 Colomer, Dolors, 1923 Chang, Meng-Ya, 4688 Chiu, Ya-Lin, 6581 Colonna, Lucrezia, 6217 Chang, Shu-Lin, 6984 Cho, Edward H., 1759 Colovai, Adriana I., 7432 Chang, Sook Kyung, 5612 Cho, Eun, 1068 Cominelli, Fabio, 1809, 5411 Chang, Sun-Young, 2476 Cho, Jae Youn, 5321, 7310 Communi, David, 1450 Chang, Wenjie, 2249 Cho, Sang-Heon, 5375 Condomines, Maud, 3307 Chang, W. L. William, 1457, 7794 Cho, Soo Jung, 1948 Cong, Yingzi, 6867 Chang, Xing, 1542 Cho, Suzanne, 2755 Conne, Be´atrice, 4373 Chang, Yun C., 6367 Choi, Jason C., 1598 Connell, Terry D., 4811 Chapman, Timothy J., 4506 Choi, Jin W., 7088 Connick, Elizabeth, 6975 Charbonnel, Bernard, 7458 Choi, Young I., 7088 Connolly, Janet M., 6280 Charini, William A., 3409 Chomez, Patrick, 2617 Constandinou, Christothea M., 5288 Chason, Kelly D., 3208 Chomont, Nicolas, 1086 Contag, Christopher H., 838 Chatila, Talal A., 2961 Chong, Tiana M., 6374 Conte, Romana, 4947 Chatzidakis, Ioannis, 6735 Chont, Melissa, 6504 Conti, Marco, 4820 Chaudhry, Umer I., 4411 Choo-Wing, Rayman, 4993 Conti-Fine, Bianca M., 7072 Chavez-Rueda, Karina A., 7868 Chouaib, Salem, 6821 Conway, Rochelle M., 291 8236 AUTHOR INDEX

Cook, Andrew D., 5245 Dakappagari, Naveen, 5595 de Oliveira-Marques, Virgı´nia, 3893 Cook, H. Terence, 2352 Dakhama, Azzeddine, 480, 1433 De Plaen, Etienne, 2617 Cookenham, Tres, 1692 D’Alessio, Alessio, 592 De Riva, Alessandra, 5488 Cook-Mills, Joan M., 3865 Daley, Charles L., 3688 Derre, Laurent, 3566 Cool, Carlyne D., 8148 D’Alimonte, Iolanda, 720 de Sablet, Thibaut, 8168 Cooper, Joanne C., 3474 Dalpke, Alexander H., 3134 Desai, Dharmesh D., 6217 Copin, Richard, 5182 Dame, Tarah M., 1172 Deschemin, Jean-Christophe, 6416 Coppock, Dagan, 6350 Damotte, Diane, 5435 Deshmukh, Umesh S., 1251, 2565 Coppola, Roberto, 7432 Danese, Silvio, 6017 Deshpande, Pratima, 6695 Coquet, Jonathan M., 2827 Dani, Indra, 2122 de Sousa, Maria, 3612 Corcoran, Kelly E., 2075 Daniel, Carolin, 2458 de Souza, J. Brian, 4136 Corcoran, Lynn M., 4104 Daniel, Kenn C., 145 deStefani, Andreas, 4595 Corfe, Steven A., 6028 Danilenko, Dimitry M., 2229 DeStephan, Christine M., 3627 Cornall, Richard J., 2916, 4276 Darabi, Kamruz, 7442 Detry, Bruno, 4658 Cornelissen, Jan J., 3551 Darce, Jaime R., 5612 Devevre, Estelle, 3566, 4112 Coro, Elizabeth S., 1457 Das, Tanya, 6642 DeVine, Jarret L., 2835 Corr, Maripat, 2636 Dasgupta, Anindya, 1654 de Vos, Alex F., 1845 Corradin, Giampietro, 7054 Da Silva, Diane M., 7587 De Vos, John, 3307 Corrales, Leticia, 5991 Dastych, Jaroslaw, 5701 De Vriese, Joelle, 1505 Corre, Jean-Philippe, 2646 Dasu, Trivikram, 111 deWalick, Saskia, 6033 Correia-Neves, Margarida, 7032, 8028 Datta, Syamal K., 7849 DeWever, Julie, 1505 Cortesa˜o, Catarina S., 3252 D’Auro, Mariagrazia, 720 Dewhirst, Mark W., 7747 Cortes-Hernandez, Josefina, 2352 David, Chella S., 3076 Dewhurst, Stephen, 3226 Cortesini, Raffaello, 7432 Davidson, Brian, 1914 De Wit, Dominique, 7607 Corthe´sy, Blaise, 27 Davidson, Robert N., 7190 de Zoete, Marcel R., 7110 Corthesy, Patricia, 4112 Davidson, Todd S., 4022 Dhandapani, Sripriya, 7467 Cosgrove, Gregory P., 8148 Davies, Joanna D., 6148 Diaz, Gabriela, 7616 Cosman, David, 2688 Davis, Beckley K., 1256 Diaz, Luis A., 5982 Costa, Paola, 1702 Davis, Daniel M., 3418, 5606 Diaz, Marilyn, 7422 Costa, Roberta, 4947 Davis, Sarah E., 6710 Dı´az-Gonza´lez, Federico, 8053 Costello, Amy, 2893 Dayer, Jean-Michel, 446 Dibble, John P., 7563 Coudert, Je´roˆme D., 1277 Daynes, Raymond A., 2517 Dib-Hajj, Sulayman, 7822 Couper, Kevin N., 4136 De, Asit, 4051 Dicaire, Chantal J., 2396 Cox, Carol J., 7412 de Almeida, Se´rgio F., 3612 Di Candia, Michele, 5144 Cox, Jeffery S., 3143 De Baetselier, Patrick, 5182 DiCarlo, Edward, 2204 Crabtree, Gerald R., 4315 de Bernard, Marina, 1312 Di Ciano-Oliveira, Caterina, 5769 Craft, Joe, 2730 Debey, Svenja, 6931 Dick, Christopher J., 3575 Crameri, Reto, 389 Debnath, Irina, 7139 Diehl, Linda, 2122 Cravens, Petra D., 1341 Deeks, Jonathan J., 5217 Diekmann, Jan, 5465 Cribbs, David H., 566 Deem, Tracy L., 3865 Diem, Se´verine, 5435 Crist, Kathryn, 1059 Deenick, Elissa K., 2932 Dierich, Manfred P., 7840 Crocker, Andrea, 6259 De Felice, Marco, 3932 Dietmeier, Klaus, 7450 Crocker, Stephen J., 8158 De Filippo, Annamaria, 1975 Dietrich, Jes, 3721 Crockford, Tanya L., 2916, 4276 DeFord-Watts, Laura M., 4120 Diggs, Kelly A., 211 Croft, Michael, 6814 deFougerolles, Antonin R., 4506 Di Iorio, Patrizia, 720 Croker, Byron P., 4667 Defrance, Thierry, 7779 Dijsselbloem, Nathalie, 5048 Cronstein, Bruce N., 7747 Degli-Esposti, Mariapia A., 4764 Dillehay, Dirck, 4194 Cross, Lillian, 8081 de Gorter, David J. J., 1405 DiLorenzo, Teresa P., 1415 Crothers, Kristina A., 1948 Dejana, Elisabetta, 6017 Di Mari, John F., 8097 Crotty, Shane, 817, 6814 de Jong, Esther C., 1986 DiMascio, Leah, 3511 Crouch, Erika C., 8046 de Jong, Judith M. H., 7581 Dimasi, Nazzareno, 369 Croucher, Peter, 3379 de Jong, Wilco, 6894 Di Nardo, Anna, 1829 Crowe, Suzanne M., 1096, 6581 de Kruif, Martijn D., 1845 Dinarello, Charles A., 5413 Croy, B. Anne, 4267 Delarasse, Ce´cile, 4865 DiPaolo, Richard J., 4022 Cruikshank, William W., 8081 De La Rue, Sarah A., 1809 Dispenza, Melanie C., 1512 Cuesta, Natalia, 3602 de Leij, Lou F. M. H., 2287 Dittel, Bonnie N., 39, 3447 Cunningham, Adam F., 6200 Dell’Eva, Raffaella, 1122 Dittmayer, Maria, 3427 Cunningham, Madeleine W., 7412 Delon, Je´roˆme, 4373 Diveu, Caroline, 4615 Cunningham, Rodat T., 235 del Rio, Maria-Luisa, 6861 DiVietro, Jeffrey A., 3903 Curry, Allison J., 2221 Del Vecchio Blanco, Giovanna, 5957 Dixit, Narendra M., 5505 Curtsinger, Julie M., 6752 del Zoppo, Gregory J., 8158 Dixon, Craig, 3648 Cuttitta, Frank, 3602 de Madariaga, Africa, 6130 Dixon, Darlene, 3208 Cyrne, Luı´sa, 3893 De Maria, Andrea, 1702 Dlakic´, Mensur, 5099 Cyster, Jason G., 2973 DeMatteo, Ronald P., 4411 Dobles, Max, 2249 De Milito, Angelo, 5340 Doecke, Wolf-Dietrich, 5973 Da, Reng-Rong, 557 Demirkiran, Ahmet, 6066 Doedens, Andrew, 7516 Dace, Dru S., 6115 Dempsey, Peter J., 4214 Doenhoff, Michael J., 6023 Daehnel, Katrin, 1068 Deng, Shaoping, 6028 Doherty, Heather, 7132 Dae¨ron, Marc, 6465 Dengler, Thomas J., 3237 Doherty, Peter C., 1285, 2370, 2737, 3091, Dagand, Emilie, 6476 den Haan, Joke M. M., 5429 7616 D’Agati, Vivette D., 7432 Denhardt, David T., 6567 Doherty, T. Mark, 3721 D’Agostino, Antonella, 4947 Denizeau, Jordan, 5435 Dohi, Taeko, 5296 Dagregorio, Guy, 4615 Dennehy, Kevin M., 1363 Doi, Takahiro, 2272 Daha, Mohamed R., 7581 Denning, Timothy L., 4230 Doi, Takehiko, 3806 Dai, Hehua, 4260 Dent, Lindsay A., 4222 Doi, Takeshi, 360 Dai, Jie, 3219 Denyer, Gareth S., 7097 Doi, Tomomitsu, 1349 Dai, Qun, 1243 Denzin, Lisa K., 1488 Dokal, Inderjeet, 7710 Dai, Zhenhua, 4260 Deol, Parampal, 7557 Dolganiuc, Angela, 1243 AUTHOR INDEX 8237

Dolton, Garry, 330 Eckenrode, Sarah, 7173 Evert, Bernd, 2122 Dolz, Manuel, 7458 Eckhardt, Laurel A., 6297 Excoffon, Katherine J. D. A., 6395 Domercq, Marı´a, 6549 Eckhaus, Michael A., 4159 Domingo, Joan C., 6130 Eckle, Tobias, 8127 Faas, Susan, 4749 Domingo, Pere, 6130 Edberg, Jeffrey C., 3272, 3973 Fabbri, Marco, 7344 Domı´nguez-Luis, Maria, 8053 Eddaoudi, Ayad, 7868 Fabis, Marzena J., 7334 Donato, Paolo, 4417 Edenhofer, Frank, 2122 Fabre, Ste´phanie, 4351 Donda, Alena, 2182 Edghill-Spano, Yvette, 3492 Fabry, Zsuzsanna, 520 Dondorff, Monica, 2287 Edwards, Dylan R., 1199 Facchetti, Fabio, 7325 Dong, Chen, 3661, 5496 Edwards, Steven W., 7325 Faccioli, Lucia H., 1628 Dong, Mingdong, 3016 Egan, Karine M., 702 Faeder, James R., 3530 Dong, Tao, 33 Eggle, Daniela, 6931 Fagerlie, Sara R., 5277 Donini, Marta, 7344 Egilmez, Nejat K., 1357 Fainboim, Leonardo, 2572 Donoghue, Eileen T., 6968 Egorin, Merrill J., 2028 Fairchild, Robert L., 2278 Dooley, James, 3007 Ehlting, Christian, 2813 Fairfax, Kirsten, 4104, 4764 Doom, Carmen M., 7235 Ehrchen, Jan M., 7251 Fairweather, DeLisa, 6710 Dorighi, Kristel, 7943 Ehrenstein, Michael R., 2916, 7868 Fais, Stefano, 5340 Dosanjh, Davinder P. S., 5217 Eid, Raymond E., 592 Fait, Vuk, 6789 Dose, Marei, 5443 Eidsmo, Liv, 5340 Falahati, Rustom, 2056 Douek, Daniel C., 3492, 7756 Eils, Roland, 6931 Falco, Michela, 4947 Douglas, Raymond S., 3281 Einsele, Hermann, 5465 Falkson, Carla, 6867 Douladiris, Nikolaos, 6290 Eisenberg, Roselyn J., 6374 Fallas, Jennifer L., 1488 Downie, Matthew P., 6217 Eisenman, Daniel, 7173 Fallon, Padraic G., 4557 Doyle, Sean E., 6705 Eissmann, Philipp, 3418 Fallon, Rosie E., 4557 Draghi, Monia, 2688 Ekoff, Maria, 4177 Fallowfield, Jonathan A., 5288 Draghi, Nicole A., 1488 Elangovan, Siva, 3912 Fan, Janet J., 6573 Drake, James R., 2065 Elentner, Andreas, 4362 Fan, Jie, 6573 Dranoff, Glenn, 1553 Elford, Alisha R., 2932 Fan, Juan, 2469 Dresch, Christiane, 7738 El-Gengehi, Nagala, 3076 Fan, Yijun, 1048, 7859 Drew, Paul D., 1904 ElGhazali, Gehad, 5383 Fang, Kevin J., 1450 Druilhe, Pierre L., 3099 Elias, Fernando, 1363 Fang, Yuan, 4267 Du, Qiujiang, 7859 Elias, Jack A., 1948, 4993 Fantini, Massimo Claudio, 732, 5957 Du, Xiaoping, 416 Elkington, Paul T., 1199, 3767 Farber, Joshua M., 2278 Du, Ziyun, 986 Ellery, Philip J., 6581 Farr, Andrew G., 3007 Dubin, Grzegorz, 3713 Elliott, James I., 3474 Farrand, Kathryn J., 2721 Dubrac, Sandrine, 4362 Elliott, Peter J., 1845 Farrar, Michael A., 262, 280 Du Clos, Terry W., 530, 7283 Ellis, Peter, 4304 Farrell, John, 5533 Duddy, Martin, 6092 Ellison, Felicia M., 4159 Farris, A. Darise, 2996, 7511 Duffield, Jeremy S., 5288 Ellyard, Julia I., 4222 Fatma, Sumbul, 3627 Duffy, Karen E., 7833 Elpek, Kutlu G., 6840 Faubion, William A., 3583 Dulak, Jozef, 4707 Elrefaei, Mohamed, 3265 Fauci, Anthony S., 6968 Dulphy, Nicolas, 2908 Elsa¨sser, Hans-Peter, 6941 Fausch, Steven C., 7587 Dumas, Antoine Ribadeau, 6465 Elsby, Rachel, 6444 Faust, Ju¨rgen, 4632 Dumont, Alain R., 788 Elshafie, Amir Ibrahim, 5383 Fazilleau, Nicolas, 4865 Dumont, Jennifer, 5390 Eltzschig, Holger K., 8127 Federici, Cristina, 5340 Dumortier, He´le`ne, 6700 Emeny, Rebecca T., 4876 Fedorova, Ludmila, 5018 Duncan, Andrew, 3511 Emig, Frances, 8138 Fedulov, Alexey, 5912 Dunham, Richard, 1680 End, Caroline, 8203 Feinberg, Mark B., 8002 Dunkley, Karissa M., 6374 Endesfelder, Stefanie, 5973 Feirt, Nikki, 7432 Dunlop, Nancy M., 1759 Endoh, Ikuko, 1852 Feldmann, Marc, 2148 Dunn, Ashley R., 6435 Endres, Stefan, 2803 Felici, Franco, 4417 Dunussi-Joannopoulos, Kyri, 3822 Endt, Johanna, 5606 Felsher, Dean, 4315 Duong, Bao, 6332 Eng, Jeffrey M., 7473 Feng, Dongdong, 5496 Durantez, Maika, 748 Engel, Rosel, 4304 Fenton, Matthew J., 2655 Durham, Stephen R., 4658 Engelhard, Victor H., 1512, 5899 Ferch, Uta, 953, 4373 Durigutto, Paolo, 1312 Engelman, Robert W., 2893 Ferencik, Stanislav, 3918 Durum, Scott K., 228, 1553 English, B. Keith, 5312 Ferguson, Andrew R., 1512 Duso, Debra K., 1321 Engram, Jessica, 1680 Ferguson, Donald A., Jr., 1158 Dustin, Michael L., 7747 Engwerda, Christian R., 6033 Ferguson, Paul, 5321 Duteyrat, Jean-Luc, 3161 Enrich, Barbara, 1748 Ferguson, Thomas A., 2679 Dutt, Suparna, 6242 Erfurt, Cornelia, 7703 Ferlazzo, Guido, 4947 Dutton, Richard W., 1030 Erickson, Matthew, 3007 Fern, Robert, 6549 Duval, Mark, 7132 Erikson, Christopher J., 3208 Fernald, Guy Haskin, 5076 Dy, Michel, 5435 Eriksson, John E., 3944 Fernandez, Isabel, 3373 Dyson, Julian, 3558 Erle, David J., 1457 Feron, Olivier, 1505 Dzhagalov, Ivan, 2113 Erzurum, Serpil C., 6482 Ferrante, Andrea, 7181 Dziarski, Roman, 3116 Escobar, Sabine S., 1523 Ferrari, Nicoletta, 1122 Dziegiel, Morten H., 3099 Esen, Nilufer, 4528 Ferreira, Paula, 1379 Dzutsev, Amiran, 7211 Esparza, Thomas J., 122 Ferry, Helen, 2916, 4276 Esposito, Antonella, 3932 Fessler, Michael B., 3153 Ear, Thornin, 7344 Esposito, Giovanni, 1122 Fichtner-Feigl, Stefan, 5859 Earle, James K., Jr., 2679 Estanyol, Josep Maria, 6533 Fidanza, Vincenzo, 5443 Earp, H. Shelton, 5635 Estefanı´a, Ernesto, 4402 Figdor, Carl G., 154 Easterbrook, Philippa, 33 Ettinger, Rachel, 2872 Fikrig, Erol, 970 Eberhardt, Meghan K., 7794 Etxebarria, Estibaliz, 6549 Fillatreau, Simon, 4865 Eberl, Matthias, 4304 Evain-Brion, Danie`le, 1115 Fina, Daniele, 732, 5957 Ebihara, Nobuyuki, 3288 Evanoff, David P., 539 Finberg, Robert W., 3363, 5173 Ebling, Fanny, 7649 Evans, Jamie G., 7868 Fink, Katja, 1468 8238 AUTHOR INDEX

Finke, James, 2278, 6642 Franco, Francesca, 5912 Galle, Peter R., 3427 Finkel, Terri H., 6268 Francoz, Sarah, 5048 Gallin, John I., 6367 Finkelman, Fred, 4027 Frank, Ronald, 3797 Gallinat, Sven, 6941 Finlay-Jones, John J., 2794 Franklin, Edward C., 1229 Gallo, Amy, 592, 1948 Finn, Olivera J., 2615, 2787 Franssila, Rauli, 1208 Gallo, David, 5921 Finnern, Ricarda, 4650 Franzese, Ornella, 7710 Gallo, Richard L., 1829 Finney, Helene M., 7710 Frasch, S. Courtney, 6540 Gallucci, Marcello, 6268 Fiocchi, Claudio, 6017 Frati, Luigi, 4039 Gallucci, Stefania, 6268 Fionda, Cinzia, 4039 Frausto, Ricardo F., 8158 Galluzzo, Sara, 7432 Firat, Elke, 2241 Frederickson, Shana, 5595 Gambuzza, Maria, 3126 Fischer, Gottfried F., 2262 Fredriksen, Agnete B., 4169 Gamrekelashvili, Jaba, 1573 Fischer, Johannes C., 3918 Freedman, Mark, 6092 Gandhi, Roopali, 4017 Fischer, Klaus-Dieter, 1363, 3797 Freedman, S. Ben, 1852 Ganea, Doina, 8138 Fischer, Randy T., 2872 Freeman, Gordon J., 2714 Ganesan, Latha P., 4445 Fischer, Ryan T., 7018 Freitas, Antonio A., 7550 Ganor, Yonatan, 683 Fischetti, Fabio, 1312 Frelinger, Jeffrey A., 1388, 2065 Gantz, Don, 8046 Fish, Richard J., 5879 Fremont, Daved H., 4623, 6280 Gao, Bin, 944 Fisher, Paul B., 2429 Freund, Gregory G., 663, 6886 Gao, Chengjiang, 1870 FitzGerald, Garret A., 702 Frey, Alan B., 7814 Gao, Donghong, 4876 Fitzgerald, Katherine A., 1068, 5173 Freyer, Dorette, 6476 Gao, Feng, 4424 Flamand, Louis, 8036 Freymond, Nathalie, 2763 Gao, George F., 944, 5727 Flamand, Ve´ronique, 1301, 7607 Friedland, Jon S., 1199, 3767 Gao, Hongwei, 7902 Flanagan, Michelle B., 4595 Friedlein, Grzegorz, 6821 Gao, Ji-Liang, 1450 Flati, Vincenzo, 720 Friedman, Richard A., 5329 Gao, Lifen, 503 Flavell, Richard A., 2730, 5200 Friedrich, Thomas C., 2746 Gao, Xiang, 7317 Fleetwood, Andrew J., 5245 Frisancho, J. Augusto, 6710 Gao, Yunfei, 2730 Fleischmann, Bernd K., 3390 Frisancho-Kiss, Sylvia, 6710 Gapin, Laurent, 3457 Fleming, John V., 3612 Fritsch, Peter, 4362 Garbi, Natalio, 7932 Fleshner, Phillip R., 3293 Froger, Josy, 4615 Garcea, Robert L., 5124 Fletcher, Jean M., 7710 Frommer, Ture, 4072 Garcia, Ana Maria, 5390 Fletcher, Julie M., 1618 Frossi, Barbara, 2549 Garcia, Bertha, 5480 Flores, Juana M., 2296 Fru¨h, Klaus, 1654 Garcia, Eduardo, 7840 Flores, Marcella, 6217 Fry, Terry J., 5340 Garcı´a, Marı´a Isabel, 2296 Flores, Rafael R., 211 Fu, Jie, 4567 Garcia, Martine, 4615 Flores, Raquel, 4402 Fu, Shu Man, 1251, 2565 Garcia, Sylvie, 7550 Floto, R. Andres, 7190 Fujihashi, Keiko, 6058 Garcı´a-Garcı´a, Erick, 3048 Flowers, Lawrence O., 5058 Fujihashi, Kohtaro, 6058 Garcı´a-Sastre, Adolfo, 6770 Fluur, Caroline, 5340 Fujii, Shin-ichiro, 2853 Gardai, Shyra, 8117 Flynn, Claudia, 5812 Fujimori, Akira, 2923 Gardiner, Clair M., 235 Flynn, JoAnne, 1723 Fujimura, Yoshinori, 4854 Gardner, Humphrey, 4506, 7442 Foey, Andy, 4779 Fujioka, Yuki, 605 Gariboldi, Silvia, 4296 Fogli, Manuela, 1702 Fujise, Kiyotaka, 613 Garin, Alexandre, 4623 Foley, Julie, 7422 Fujita, Takashi, 3368 Garn, Holger, 7805 Folkvord, Joy M., 6975 Fujiwara, Mari, 1349 Garrett, Joan T., 7120 Fo¨lsch, Ulrich R., 8203 Fukuda, Mark M., 1151 Gascan, Hugues, 4615 Fontaine, Marc, 3323 Fukui, Mikiko, 2853 Gaspal, Fabrina, 6200 Fonzi, William A., 2038 Fukuiwa, Tatsuya, 6058 Gasperini, Sara, 7344 Foote, Monica R., 2667 Fukuma, Daiki, 918 Gasque, Philippe, 3323 Ford, Paul A., 463 Fukunaga, Koichi, 489 Gassner, Christoph, 7840 Forestier, Claire, 1415 Fu¨llbier, Lars, 8127 Gatto, Dominique, 67 Forman, James, 2028 Fumagalli, Laura, 3874 Gauld, Stephen B., 3353 Forman, Stephen, 838 Furie, Martha B., 1172 Gauldie, Jack, 7984, 8175 Fornace, Albert J., Jr., 4153 Furukawa, Yoshitaka, 5966 Gault, Ruth A., 5753 Forni, Guido, 7120 Furukawa, Yuko, 2499 Gazzard, Brian, 8212 Forrester, John V., 4276 Furuuchi, Keiji, 1021 Ge, Weiwen, 5480 Forsgren, Arne, 6316 Furuyashiki, Maiko, 2610 Gebhardt, Carl, 4966 Forster, Nicole, 6941 Fuse, Shinichiro, 5227 Geczy, Carolyn L., 1852 Fo¨rster, Reinhold, 1468, 6861 Fusi, Alessandra, 1931 Gee, Katrina, 798 Forsyth, Christopher B., 2038 Fuss, Ivan J., 5859, 6725 Gefen-Dor, Chen, 2307 Forte, Giuseppe, 4947 Futagami, Yuri, 6994 Geiben, Ralf, 5652 Forthal, Donald N., 6596 Fuxa, Martin, 3031 Geiger, Terrence L., 7667 Fortier, Anne, 8022 Geijtenbeek, Teunis B. H., 3177 Fossati-Jimack, Liliane, 2352 Gabriel, Luisa, 4395 Geissler, Edward K., 5859 Foster, Paul S., 219, 4222 Gabrilovich, Dmitry, 4705 Geisslinger, Gerd, 2458 Foster, Robert A., 4267 Gaedicke, Simone, 2241 Gelbard, Harris A., 869, 3226 Fourie, Anne, 8053 Gaestel, Matthias, 2813 Gelfand, Erwin W., 480, 1433 Fournel, Sylvie, 6700 Gafa, Valerie, 6208 Gell, Joanna, 1800 Foussat, Arnaud, 5930 Gaggar, Amit, 1013 Gendelman, Howard E., 6404 Fousteri, Georgia, 6735 Gagliani, Nicola, 5921 Gendzekhadze, Ketevan, 2688 Fouts, Ashley E., 5154 Gagliardo, Lucille F., 1039 Genestier, Laurent, 7779 Fowke, Keith R., 3750 Gagne, Bethany A., 6140 George, Bruce D., 2908 Fowler, Kimberly T., 1498 Gaide, Olivier, 4373 George, James D., 1713 Fox, Howard S., 5812 Gaitanaris, George A., 5443 George, Thaddeus C, 3457 Foxall, Russell B., 3252 Galbo, Roberta, 3126, 4417 George, Tracy I., 6242 Foxwell, Brian M., 2148, 4779 Galeotti, Laura, 4011 Geraci, Mark W., 702 Frahm, Nicole, 7756, 7890 Galietta, Luis J. V., 5144 Geraghty, Patrick, 5871 Franchini, Genoveffa, 3492 Galili, Uri, 4676 Gerard, Craig, 1723, 7395 Francis, James N., 4658 Galit, Denkberg, 2307 Gerber, Annegret, 4632 AUTHOR INDEX 8239

Gerlo, Sarah, 5048 Goodyear, Carl S., 2636 Gu, Yue-Ying, 5351 Germain, Guy, 1115 Goossens, Pierre Louis, 2646 Guardo, Alberto C., 2556 Germain, Ronald N., 778 Gorbachev, Anton V., 2278 Guay, Heath M., 4793, 5124 Germain, Sarah J., 5949 Gordon, Shari, 1680 Gueinzius, Katja, 3134 Gerner, Michael Y., 6752 Gordon, Siamon, 4975 Guerardel, Yann, 3161 Gerondakis, Steve, 2932, 7097 Goriely, Stanislas, 1301, 5048, 7607 Guest, Christopher B., 6886 Gewirth, Daniel, 4424 Gorman, Shelley, 2794 Guibert, Benoıˆt, 2763 Ghansah, Tomar, 2893 Gorraiz, Marta, 748 Guichard, Gilles, 6700 Gheit, Hanane, 7779 Gorry, Paul R., 6581 Guignouard, Emmanuel, 4615 Gho, Yong Song, 5375 Gorski, Jack, 7181 Guillabert, Aude, 1450 Ghochikyan, Anahit, 566 Gostick, Emma, 5727, 7756 Guillaume, Philippe, 1277, 3566 Ghosh, Amiya K., 3260 Gotch, Frances, 8212 Guillet, Ge´rard, 4615 Ghosh, Moumita, 8117 Gotlinger, Katherine, 496 Guinan, Kieran J., 235 Ghosh, Sankar, 6642 Goto, Akira, 2853 Gulati, Sunita, 4489 Ghosh, Sharmistha, 5652 Goto, Ronald M., 7162 Guler, Reto, 7450 Giacomini, Elena, 6208 Goudy, Kevin S., 1388 Guleria, Indira, 3345 Gianoukakis, Andrew G., 3281 Gougeon, Marie-Lise, 4865 Gulko, Pe´rcio S., 2344 Giarratana, Nadia, 145 Gounari, Fotini, 5443 Gumperz, Jenny E., 6181 Gibson, Andrew W., 3272, 3973 Gounni, Abdelilah Soussi, 2535 Gunatheesan, Rubamalaar, 5217 Giebelen, Ida A., 1845 Gourdy, Pierre, 5435 Gunn, Michael D., 5828 Giembycz, Mark A., 463 Goverman, Joan, 887 Gu¨nther, Claudia, 4335 Giese, Thomas, 2803 Gowda, D. Channe, 3954 Guo, Beichu, 6705 Gilbert, Caroline, 2862 Gowen, Brian B., 5200 Guo, Benchang, 4726 Gilbert, Mileka R., 4803 Goyette, Jesse, 1852 Guo, Hongtao, 1870 Gilbert, Peter B., 6596 Graddy, Ryan, 4230 Guo, Renfeng, 5940 Gileadi, Uzi, 2721 Grader-Beck, Thomas, 95 Gupta, Dipika, 3116 Giles, Brendan M., 4667 Graeber, Manuel B., 1199 Gupta, Sudhir, 6912 Gilham, David E., 4650 Graf, Daniel, 3661 Gurnani, Komal, 2396 Gillard, Geoffrey O., 3007 Graham, Nicholas R., 5735 Gururajan, Murali, 111 Gilleaudeau, Patricia, 7442 Grammer, Amrie C., 2872 Gutierrez, Astrid, 7616 Gilleron, Martine, 3161 Grandien, Alf, 5018 Guy-Grand, Delphine, 7598 Gilles, Stefanie, 7623 Granger, Steve W., 4230 Guyot-Revol, Valerie, 5217 Gillespie, Geraldine, 33 Granstein, Richard D., 1829 Guzzardi, Montserrat, 4373 Gillette-Ferguson, Illona, 1068 Gray, Daniel H. D., 4956 Gylling, Mikhail, 1208 Gilmartin, Laura, 4584 Gray, J. Dixon, 2018 Ginter, Sandra, 970 Grc˘evic´, Danka, 3379 Ha, Tuanzhu, 7317 Giovannetti, Antonello, 3932 Green, Daniel S., 8081 Ha, Unhwan, 1736 Gissmann, Lutz, 3186 Green, Douglas R., 2679 Haapasalo, Karita, 3831 Giustiniani, Je´roˆme, 1293 Green, Justin A., 1199 Haas, Helmut, 6023 Glaser, Andreas G., 389 Green, Peter H. R., 6590 Habib, Mohammed, 6700 Glasser, Anne-Lise, 8168 Greenberg, Andrew S., 7473 Hackam, David J., 6573 Glaysher, Bridget R., 3757 Greenberg, Norman M., 1268 Hackforth, Sarah, 5217 Glenney, Gavin W., 7955 Greenberg, Philip D., 6849 Hackstein, Holger, 4072 Glomski, Ian Justin, 2646 Greenberg, Steven A., 547 Haeberle, Lothar, 4908 Gobbi, Giuliana, 4011 Greene, Catherine M., 5871 Haegeman, Guy, 5048 Gobert, Alain P., 8168 Greene, Mark I., 1021 Haegens, Astrid, 1800 Gocke, Anne R., 1341 Greene, Warner C., 6581 Haelbich, Steffi, 5848 Godbout, Kevin, 2249 Greenland, John R., 5652 Haendle, Ina, 7703 Godfrey, Dale I., 2827 Gregg, Jeff P., 7794 Hafler, David A., 547 Godson, Catherine, 4595 Gregg, Randal K., 5899 Hafner, Mathias, 8203 Goebeler, Matthias, 3198 Greiner, Dale L., 693 Hage, Aaron, 6975 Goetzl, Edward J., 4885, 5425, 6806 Gress, Ronald, 4891 Hage, Faten El, 6821 Goetzman, Eric S., 3702 Gresser, Ion, 6416 Hageman, Gregory S., 3831 Goitsuka, Ryo, 262 Greten, Tim F., 1573 Hagman, James, 3457 Gojobori, Takashi, 5966 Grey, Howard, 6814, 7890 Hahn, Bevra H., 7649 Golay, Jose´e, 6616 Griffin, Cora, 4473 Haider, Asifa S., 7442 Golby, Susanne, 2755 Griffith, Jason, 2469 Haider, Mohammed I., 5058 Goldberg, Gabrielle L., 7473 Griffith, Thomas S., 2679 Haidl, Ian D., 858 Goldman, Michel, 1301, 5048, 6700, 7607 Griffiths, Christopher J., 7190 Hailfinger, Stephan, 4373 Goldschmidt, Hartmut, 3307 Griffiths, Mark R., 3323 Hajek, Roman, 6789 Goldstein, Byron, 3530 Grinstein, Sergio, 5769 Hajishengallis, George, 4811 Goldstein, Harris, 7756 Griseri, Thibault, 1332 Hajjar, Adeline M., 3695 Goldstein, Itamar, 201 Grizzle, William E., 5357, 6867 Haks, Marie¨lle C., 5443 Goldstraw, Peter, 463 Groh, Veronika, 961 Haley, Gabriela, 4072 Golenbock, Douglas T., 1068 Groot, Angelique P., 1845 Haley, Kathleen J., 496 Goleniewska, Kasia, 702, 2651 Groot, Arjan J., 5701 Halford, William P., 5166 Golgotiu, Kirsti, 7310 Gros, Philippe, 8022 Hall, Frank W., 6252 Go´mez-Gaviro, Maria, 8053 Gross, Olaf, 953 Hall, Linda, 2229 Go´mez-Lozano, Natalia, 4402 Grosse-Wilde, Hans, 3918 Halle, Annett, 6476 Gomperts, Brigitte N., 511 Grossman, Zvi, 788 Hallett, Mark, 6590 Gong, Dapeng, 242 Gruaz, Lyssia, 446 Hallstro¨m, Teresia, 6316, 6359 Gong, Wanghua, 1759 Grubeck-Loebenstein, Beatrix, 2611 Haluszczak, Catherine, 1564 Gonsalves, Caryn, 4707 Grumelli, Sandra, 8090 Hamada, Satoru, 3786 Gonzalez, Jean-Paul, 407 Gru¨n, Katja, 3466 Hamaguchi, Masahide, 3316 Gonza´lez, Jovanna, 2778 Gru¨ner, Anne Charlotte, 6416 Hamann, Alf, 8073 Gonza´lez-Gay, Miguel A., 2778 Grunstein, Judith S., 3627 Hamann, Lutz, 7520 Gonzalez-Suarez, Eva, 1523 Grunstein, Michael M., 3627 Hamilton, John A., 5245 Goodridge, Helen S., 3107 Grusby, Michael J., 511, 1870 Hamilton, Thomas, 2542 8240 AUTHOR INDEX

Hammarlund, Erika, 1654 He, Li-Zhen, 6259 Ho, Derek K., 1002 Ha¨mmerling, Gu¨nter J., 7932 He, Weifeng, 2730 Ho, Eric K., 7432 Hammerschmidt, Sven, 5848 He, You-Wen, 2113 Ho, Jason, 6968 Hammett, Maree V., 7473 Hebert, Sherry, 6092 Ho, Liza, 4373 Hamuro, Koji, 5682 Hedin, Karen E., 1581 Hocini, Hakim, 1086 Han, Lihui, 503 Heeg, Klaus, 3134 Hodes, Richard J., 926 Han, Shuhua, 5010 Heeger, Peter S., 4436 Hoek, Kristen L., 7531 Han, Soo, 6604 Heeney, Jonathan, 1702 Hoersch, Gabriele, 1180 Han, Wei, 6504 Heer, Alex K., 2182 Hoesel, Laszlo M., 7902 Han, Xinbing, 8013 Heesemann, Juergen, 1861 Hoffmann, Matthias, 1573 Hanada, Kousuke, 5966 Hegde, Ramakrishna, 2318 Hoffmann, Olaf, 6476 Handel, Tracy M., 3713 Hegel, J. Kolja E., 2132 Hoffmann, Ute, 5973 Haney, Anessa C., 4528 Heijink, Irene H., 7678 Hofhuis, Frans M., 5762 Hansen, Diana S., 5779 Heinrich, Peter C., 2813 Hofstetter, Harald H., 1372 Hansen, Søren, 4708 Heinzel, Kornelia, 858 Hogaboam, Cory, 511 Hansen, Ted H., 6280 Heirman, Carlo, 1301, 7703 Ho¨gstrand, Kari, 5018 Haque, Ashraful, 6033 Held, Werner, 1277 Hohman, Valerie S., 1589 Hara, Eiichi, 613 Helfrich, Wijnand, 2287 Hoidal, John R., 1835 Hara, Hirokazu, 3316 Hellman, Judith, 1164 Hoji, Akihiko, 2746 Hara, Hiromitsu, 4466, 6715 Hellmig, Stephan, 8203 Hojo, Tatsuya, 3316 Hara, Toshiro, 3806 Helmke, Burkhard, 8203 Holers, V. Michael, 1819, 6514, 6968 Harabuchi, Yasuaki, 1189 Hemmila, Mark R., 7902 Hollenbaugh, Joseph A., 1030 Harada, Mine, 480 Henderson, Don C., 8212 Holman, Halsted R., 1229 Harada, Tatsuhiro, 1938 Henderson, Ian R., 6200 Holmdahl, Rikard, 3084 Haraguchi, Misako, 2979 Hengartner, Hans, 1468 Ho¨lscher, Christoph, 7251 Haraldsson, M. Katarina, 8195 Hengster, Paul, 4362 Holscher, Todd D., 6252 Harbers, Stephanie O., 6217 Hennessy, Margaret, 1680 Holtmeier, Wolfgang, 711 Hardy, Kristine, 7097 Hennino, Ana, 5571 Holtz, Renae, 1598 Haribabu, Bodduluri, 2421 Hensley, Lucinda L., 2065 Holtzman, Michael J., 8107 Haribhai, Dipica, 2961 Henson, Peter M., 6540, 8117 Hombach, Andreas A., 4650 Harman, Benjamin C., 2008 Henttinen, Tiina, 3648 Homer, Robert J., 1948, 3846, 4993, 6191 Harmsen, Allen G., 6604 Herbelin, Andre´, 5435 Homma, Sadamu, 613 Harmsen, Ann, 1059, 6604 Herber, Deborah, 3822 Honda, Shin-ichiro, 765 Harrer, Nathalie, 4335 Herbert, Ronald, 7422 Honey, Karen, 4230 Harris, Claire L., 352, 1783 Herbomel, Philippe, 4385 Hong, Song, 496 Harris, James, 4975 Hermann, Corinna, 2610 Honjo, Tasuku, 2192 Harris, James E., 1199 Hermans, Ian F., 2721 Hontecillas, Raquel, 2940 Harrison, Leonard C., 2094 Hernandez, Jose J., 2835 Hooper, D. Craig, 7334 Harry, Anya, 5262 Hernandez, Maria Genevive H., 2844 Hopewell, Philip C., 3688 Hart, Melanie, 8212 Herndon, John M., 2679 Horejsı´, Va´clav, 455, 1991, 2262 Hart, Prue H., 2794 Herrup, Elizabeth A., 1164 Horie, Kyoji, 5443 Hartl, Arnulf, 3924 Hertzog, Paul, 7540 Horncastle, Donna E., 1199, 3767 Hartmann, Gunther, 2803 Herva´s-Stubbs, Sandra, 748, 2361 Horwitz, David A., 2018 Harton, Jonathan A., 3837 Herve´, Roxane, 1115 Hose, Dirk, 3307 Hartshorn, Kevan L., 8046 Herzberger, Pia, 7292 Hoshino, Akiyoshi, 5296 Hartung, Thomas, 2610 Herzog, Jeremy, 122 Hosokawa, Hiroyuki, 3067 Harty, John T., 6109 Herzog, Sebastian, 2336 Hosokawa, Kentaro, 103 Harvey, Bohdan, 2730 Hescheler, Ju¨rgen, 3390 Hosomichi, Kazuyoshi, 7162 Hasan, Uzma A., 3186 Hess, Christian, 3134 Hot, David, 1713 Haschemi, Arvand, 5921 Hesse, Matthias, 1039 Hou, Sen, 7859 Hasegawa, Akihiro, 4926 Heuser, Claudia, 4650 Hou, Sheng, 2755 Hasegawa, Atsuhiko, 3409 Hewes, Becker, 4194 Houghton, A. McGarry, 8090 Hasegawa, Mizuho, 2380 Hibbs, Margaret L., 6435 Howard, Maureen, 7395 Hashim, Fazila, 3558 Hickman, Somia Perdow, 5192 Howard, O. M. Zack, 6123 Hashimoto, Katsunori, 360 Higashimoto, Ikkou, 5888 Howell, Amy R., 1415 Hashimoto, Koichi, 702 Higginbotham, James N., 2651 Howes, Christopher J., 592 Hashimoto, Masahito, 2610 Higgins, Christopher F., 3474 Hozumi, Nobumichi, 3067 Hashimoto, Yumi, 2448 Hilchey, Shannon P., 4051 Hryniewicz, Anna, 3492 Hatzelmann, Armin, 4820 Hilchie, David, 4267 Hsu, Hui-Chen, 5357 Hauck, Christof R., 3797 Hildeman, David A., 4027 Hsu, Yi-Fan, 5991 Hauser, Carl J., 5253 Hildner, Kai M., 3427 Hu, Aihua, 3627 Ha¨ussinger, Dieter, 2813 Hill, Ann B., 7235 Hu, Hui, 7632 Havenar-Daughton, Colin, 4498 Hill, Geoff R., 6033 Hu, Jinyue, 1450 Hawn, Thomas R., 4717 Hill, Susan, 1981 Hu, Xianzhen, 851 Haworth, Oliver, 496 Hilston, Cynthia, 6642 Hu, Yinling, 829 Hayakawa, Takao, 1767 Hindre´, Thomas, 8168 Hua, Fang, 7317 Hayakawa, Yoshihiro, 2171, 4764, 7540 Hinks, Timothy S. C., 5217 Hua, Xiaoyang, 3208 Hayashi, Hidetoshi, 3059 Hinman, Rochelle M., 740 Huai, Jisen, 2241 Hayashi, Takahito, 7385 Hinnebusch, B. Joseph, 1059 Huang, Boli, 7081 Haydar, Tarik F., 7814 Hinton, Heather J., 67, 2415 Huang, Chunhong, 3688 Hayday, Adrian C., 4304 Hirano, Atsushi, 480 Huang, Jay, 6374 Hayflick, Joel S., 2328 Hirano, Ken-ichi, 4854 Huang, Jian, 1759, 3400 HayGlass, Kent T., 2535 Hirao, Atsushi, 103 Huang, Jiaqiang, 228 Haynes, Barton F., 4424 Hirata, Shinya, 918 Huang, Julie H., 7747 Haynes, Lynn D., 3983 Hirata, Takako, 2499 Huang, Liping, 4240, 5899 Haynie, J. Marshall, 2028 Hirsch, Emilio, 2549 Huang, Lisa P., 77 Hazlett, Linda D., 1105 Hiscott, John, 253 Huang, Mei-Chuan, 4885, 5425, 6806 He, Hong, 4267 Hise, Amy G., 1068 Huang, Xiaolun, 6028 AUTHOR INDEX 8241

Huang, Xiaopei, 3505 Ishii, Akihiro, 397 Jiang, Dianhua, 2469 Huang, Yu-Chia, 3023 Ishii, Shunsuke, 4926 Jiang, Hui R., 4276 Huaux, Franc¸ois, 3244 Ishikawa-Sekigami, Tomomi, 6164 Jiang, Lei, 7376 Hubbard, Vanessa M., 7473 Ishino, Hidetaka, 3316 Jiang, Qiong, 228 Hubeau, Cedric, 1477 Ishizaka, Akitoshi, 489 Jiang, Shucui, 720 Huber, Brigitte T., 1443 Ishizaki, Kazusa, 605 Jiang, Weiwen, 6495 Hudrisier, Denis, 3637 Isogawa, Masanori, 2714 Jie, Chunfa, 378 Hughes, Austin L., 7151 Isono, Kyo-ichi, 5001 Jin, Hye Mi, 5588 Hughes, Elizabeth D., 3680 Israel, Elliot, 496 Jin, S. L. Catherine, 4820 Huitron-Resendiz, Salvador, 5812 Issa, Razao, 7366 Jin, Yi-Ping, 7911 Huizinga, Tom W. J., 7581 Isturiz, Martı´n A., 436 Jin, Yuhuai, 2318 Huleatt, James W., 1498 Ito, Kazuhiro, 2491 Jindra, Peter T., 7911 Humann, Jessica, 2407 Ito, Keisuke, 103 Jing, Lichen, 6374 Hume, David A., 6557 Ito, Takaaki, 3777 Jirmanova, Ludmila, 4153 Humlicek, Alicia L., 6395 Itoh, Yuka, 3059 Job, Godwin, 5357 Hummel, Michael, 1180 Ivashkiv, Lionel B., 2204 Jobin, Christian, 6522 Hundemer, Michael, 3307 Ivison, Sabine M., 5735 Joensuu, Joonas, 1208 Hundhausen, Christian, 8064 Iwabuchi, Kazuya, 6567 Joergensen, Louise, 428 Hung, Stephanie, 8158 Iwakura, Yoichiro, 3786, 5086, 6444, 7385, Joetham, Anthony, 1433 Hu¨nig, Thomas, 1363 7571 Jog, Neelakshi R., 2421 Huntington, Nicholas D., 4104, 4764 Iwamura, Chiaki, 4926 Johansen, Finn-Eirik, 1589 Hurchla, Michelle A., 6073 Iwata, Fumi, 5086 Johansen, Pål, 7450 Hurwitz, Arthur A., 1268 Izui, Shozo, 2778, 4395 Johansson, C. Christian, 6949 Huseby, Eric S., 887 Izumo, Shuji, 5966 Johndrow, James E., 3143 Hussain, Rehana Z., 1341 Johnson, Christopher M., 7520 Hussain, Sofia, 6770, 6777 Jablonska, Jadwiga, 6941 Johnson, Howard M., 4576, 5058 Huster, Katharina M., 1573 Jackman, Rachael P., 5543 Johnson, Jennifer, 4528 Huston, Gail E., 1321 Jackson, Patricia L., 1013 Johnson, Leanne M., 7259 Hutt, Julie A., 530 Jacob-Hirsch, Jasmine, 2307 Johnson, Patrick T., 3831 Hwang, Kwan-Ki, 5351 Jacobs, Muazzam, 7450 Johnson, Randall S., 7516 Hwang, Kyung-A, 5473 Jacobs, Susan, 2287 Jokinen, Micheal, 7422 Hwu, Patrick, 1534 Jacobsen, Elizabeth A., 7879 Jokiranta, T. Sakari, 3831 Hyodo, Mamoru, 2171 Jacobson, Mikila R., 4658 Joly, Etienne, 3637 Jafarshad, Ali, 3099 Jomaa, Hassan, 4304 Iacomini, John, 4757 Jaffe, Eileen, 5099 Jonas, Anna K., 2746 Iakimov, Alexander O., 592 Jakob, Thilo, 7623 Jonas, Elizabeth A., 7822 Iancu, Emanuela M., 4112 Jakobsen, Bent K., 5727 Jondal, Mikael, 6761 Iannascoli, Bruno, 6465 Jala, Venkatakrishna R., 2421 Jones, Christine C., 8148 Ibla, Juan, 8127 Janelsins, Brian M., 7006 Jones, Gareth J., 6456 Ichiki, Manami, 4917 Jang, Sihyug, 5192 Jones, Matthew R., 1896 Ichim, Thomas E., 566 Jang, Thomas, 2883 Jones, Russell G., 2932 Idegami, Yuka, 5513 Jania, Leigh A., 2065, 3208 Jono, Hirofumi, 1736 Iemoli, Enrico, 1931 Janicki, Joseph S., 641 Joos, Guy F., 5305, 7501 Iftner, Thomas, 3186 Jankovic´, Dragana, 4153 Jordan, Margaret A., 1618 IJzermans, Jan N. M., 6066 Jankowska-Gan, Ewa, 3983 Joseph, Aviva, 7756 Ikeda, Yasuo, 103 Janowski, Jessie W., 7276 Joshi, Pramod S., 6227 Ikeda, Yasutaka, 4854 Janssen, Hans, 8053 Jost, Philipp J., 953 Ilaria, Robert L., Jr., 2028 Janssen, William J., 8117 Joyee, Antony George, 1048 Ilarregui, Juan M., 436 Janssen-Heininger, Yvonne M., 1800, 3814 Jozkowicz, Alicja, 4707 Illarionov, Petr, 1415, 6181 Jaradat, Maisa, 3208 Jo´z´wik, Agnieszka, 771 Illei, Gabor, 2579 Jarcho, Michael, 6342 Ju, Shyr-Te, 1251 Im, Jin S., 1415, 2755 Jarjour, Wael N., 1251 Juang, Yuang-Taung, 1938, 1960 Imanishi, Takayuki, 6715 Jarva, Hanna, 3831, 6359 Juelke, Kerstin, 4947 Imbault, Virginie, 1450 Ja¨rvela¨, Irma, 3831 Julkunen, Ilkka, 253 Imhof, Beat A., 5879 Jaworowski, Anthony, 1096, 6581 Jumaa, Hassan, 2336 Immonen, Ilkka, 3831 Jayaraman, Padmini, 6083 Jun, SangMu, 1791 Imreh, Stefan, 5018 Jazrawi, Elen, 2491 Juncadella, Ignacio, 7064 Imrich, Amy, 5912 Jazwa, Agnieszka, 4707 Jung, Kenneth, 2229 Inamura, Seiichi, 2803 Jegerlehner, Andrea, 2415 Jung, Kie-Hoon, 5200 Indraccolo, Stefano, 1122 Je´gou, Jean-Franc¸ois, 3323 Jung, Steffen, 2000, 6217, 7994 Infante, Anthony J., 3544 Jeliazkova, Valentina, 7686 Junt, Tobias, 1468 Ingram, David A., 2527 Jelinek, Diane F., 5612 Innes, John A., 5217 Jelley-Gibbs, Dawn M., 7563 Kachinski, Julie J., 4667 Inohara, Naohiro, 2380 Jennings, C. Darrell, 111 Kadiu, Irena, 6404 Inoko, Hidetoshi, 7162 Jennings, Gary T., 7450 Kadowaki, Takashi, 1349 Inoue, Joe, 584 Jennrich, Silke, 8073 Kagimoto, Yoshiko, 757 Intlekofer, Andrew M., 2730 Jensen, Anja T. R., 428 Kagyo, Junko, 489 Introna, Martino, 6616 Jeon, Seong Gyu, 5375 Kaiga, Teruo, 7571 Ipaktchi, Kyros R., 7902 Jeon, Sung H., 7088 Kain, Kevin C., 3954 Iredale, John P., 5288 Jerud, Elliot S., 1415 Kaise, Hitomi, 5001 Iribarren, Pablo, 1759 Jessup, Wendy, 1852 Kakuta, Shigeru, 6444 Irvin, Charles C., 7879 Jetten, Anton M., 3208 Kalfayan, Lena H., 788 Irvin, Charles G., 3814 Jevnikar, Anthony M., 5480 Kaliappan, Sankaranarayanan, 1783 Irvine, Katharine M., 6557 Jeyaseelan, Samithamby, 3153 Kalinke, Ulrich, 5839 Isaac, Sylvie, 2763 Jha, Purushottam, 1783 Kaliyaperumal, Arunan, 7467 Isakov, Dmitry, 7211 Ji, Chuanyi, 3973 Kalkonde, Mrunal, 5668 Ishida, Kazuhiro, 6994 Ji, Shaoquan, 702 Kallies, Axel, 4104 Ishida, Yuko, 7385 Jiang, Chuancang, 7422 Kalra, Vijay K., 4707 8242 AUTHOR INDEX

Kamat, Shweta, 3281 Keates, Sarah, 8013 King, Irah L., 6695 Kambayashi, Taku, 4606, 7531 Keating, Rachael, 2737, 3091 King, Philip D., 3680 Kamene, Jane, 3750 Keaton, Jason M., 6181 Kingham, T. Peter, 4411 Kamphuis, Elisabeth, 5839 Kedl, Ross M., 1564 Kinoshita, Keiji, 2923 Kampmann, Beate, 7190 Keestra, A. Marijke, 7110 Kinter, Audrey, 1680 Kamradt, Thomas, 2661 Keka¨la¨inen, Eliisa, 1208 Kioschis, Petra, 8203 Kanai, Takanori, 4737, 4937 Keler, Tibor, 6259 Kiosses, William B., 6252 Kandeel, Fouad, 838 Kelleher, Peter, 8212 Kirschfink, Michael, 7292 Kane, Kevin P., 1261 Kelleher, Raymond J., Jr., 5552 Kirschning, Carsten J., 2396 Kaneda, Hide, 7571 Keller, Iris, 7450 Kirvan, Christine A., 7412 Kaneko, Shuichi, 574 Keller, Jonathan R., 228, 1553 Kishihara, Kenji, 4466 Kaneko, Yoriaki, 6164 Keller, Walter, 6290 Kissling, Grace, 7422 Kaneko, Yuka, 6164 Kelley, Jim, 7317 Kitahara, Masaaki, 574 Kanellopoulos, Jean M., 4865 Kelley, Lara, 5820 Kitaichi, Nobuyoshi, 6567 Kang, Hee-Kap, 7849 Kelly, Ciara´n P., 8013 Kitamei, Hirokuni, 6567 Kang, Insoo, 5473 Kelsoe, Garnett, 3593, 4424 Kitamura, Kenichi, 480 Kang, Jihee L., 8117 Kemeny, David M., 4771 Kitamura, Mizuki, 6567 Kang, Min-Jong, 1948 Kemp, Melissa L., 4984 Kitamura, Toshio, 4250 Kang, Rui, 7376 Kendall, Peggy L., 5643 Kitani, Atsushi, 5859, 6725 Kang, Seung G., 301 Kendall, Timothy J., 5288 Kitasato, Hidero, 1144 Kan-Mitchell, June, 7756 Kendoff, Daniel O., 5940 Kitaura, Jiro, 455 Kannan, Kolenkode B., 5253 Kenny, Sinead M., 6200 Kitchen, Christina M. R., 3492 Kanneganti, Thirumala-Devi, 2380, 8022 Keren, Sinik, 2307 Kiyono, Hiroshi, 4937 Kansal, Rita, 3076 Kernaleguen, Anne-Elen, 788 Klarmann, Kimberly D., 1553 Kansas, Geoffrey S., 4901 Kerr, William G., 2893 Klatt, Nichole, 1680 Kanzler, Benoıˆt, 2241 Keyvanfar, Keyvan, 4159 Klein, Anne, 4304 Kao, Race L., 7317 Khalaf, Waleed F., 2527 Klein, Bernard, 3307 Kapina, Marina A., 976 Khalife, Jamal, 1713 Klein, Claudia, 4966 Kaplan, Gilla, 338 Khan, Abdul Hamid, 944 Klein, Matthias, 1861 Kaplan, Henry J., 474 Khan, Mahmood, 6200 Klenerman, Paul, 5217 Kaplan, Mark H., 4901, 7550 Khan, Naeem, 4455 Klimmek, Kerstin, 3198 Kapoor, John R., 592 Khan, Wasif N., 7531 Klockgether, Thomas, 2122 Kapsenberg, Martien L., 1986 Khayrullina, Tanzilya, 8138 Klos, Andreas, 5940 Kapur, Reuben, 4901 Khorasani, Nadia, 7366 Klotz, Luisa, 2122 Karaolis, David K. R., 2171 Khoury, Joseph, 8127 Kluin-Nelemans, Hanneke C., 2287 Karman, Jozsef, 520 Khurana, Dianne, 3575 Knapp, Sylvia, 993 Karpa, Volodymyr I., 4832 Kianpour, Sussan, 936 Knaus, Ulla G., 3731 Karrasch, Thomas, 6522 Kielczewska, Agnieszka, 369 Knechtle, Stuart J., 3983 Ka¨rre, Klas, 3536 Kielian, Tammy, 4528 Knights, Ashley, 320 Kaser, Arthur, 1748 Kies, P. Marcel, 7678 Knippels, Le´on M. J., 6894 Kashkar, Hamid, 3390 Kiessling, Rolf, 6949 Knol, Edward F., 5701 Kasischke, Karl A., 869 Kifayet, Arnawaz, 5735 Knolle, Percy, 2122 Kasman, Ian, 2229 Kikuchi, Kiyoshi, 5682 Knott, Simon, 5076 Kassiotis, George, 5488 Kikuchi, Toyoko, 7442 Knuth, Alexander, 320, 2617 Kast, W. Martin, 7587 Kilic¸, Sara S., 2556 Knutson, Keith L., 3583 Kataoka, Hirotoshi, 3437 Kim, Carol H., 4517 Kobayashi, Hirohito, 2278 Kataoka, Kosuke, 6058 Kim, Chang H., 301 Kobayashi, Hiroya, 1189 Kataranovski, Milena, 530 Kim, Gisen, 5563 Kobayashi, Kiyoshi, 5209 Katavic´, Vedran, 3379 Kim, Grace J., 1534 Kobayashi, Ryoki, 6058 Kato-Maeda, Midori, 3688 Kim, Hang-Rae, 5473 Kobayashi, Susumu, 613 Kauer, Friederike, 4966 Kim, Hee-Seo, 369 Kobayashi, Yasuhiro, 192 Kauffman, Henk F., 7678 Kim, Ho Jin, 6092 Kobzik, Lester, 1477, 5912 Kauffmann, Susanne Ørding, 1662 Kim, In-Jeong, 1692 Kocak, Ergun, 1542 Kaufman, Howard, 7432 Kim, James, 6028 Kocak, Ivo, 6789 Kaufman, Jim, 5744 Kim, Jee-Hye, 2370 Koch, Joachim, 657 Kaufmann, Stefan H. E., 2661 Kim, Jieun, 7088 Koch, Markus, 2661 Kaumaya, Pravin T. P., 7120 Kim, Jong-Hoon, 5375 Kochman, Adam, 7473 Kaunisto, Aura, 3944 Kim, Joo-Sung, 6522 Kodama, Taku, 480 Kaur, Kanwal J., 7923 Kim, Jung Ha, 5588 Kodama, Tatsuhiko, 360 Kaveri, Srini V., 4184 Kim, Kabsun, 5588 Koedel, Uwe, 1861 Kawabata, Kenji, 1767 Kim, Ki-Chan, 5473 Koelle, David M., 6374 Kawachi, Yasuhiro, 605 Kim, Minsoo, 7276 Koenen, Paul G. F., 5762 Kawahara, Hidejiro, 613 Kim, Nacksung, 5588 Koga, Tomoaki, 1736 Kawahito, Yutaka, 3316 Kim, Sean T., 2730 Kogan, Mariya S., 1896 Kawakami, Kazuyoshi, 3786 Kim, Seon-Kyeong, 5154 Kohli, Payal, 496 Kawakami, Toshiaki, 455 Kim, Yoon-Keun, 5375 Kohlmeier, Jacob E., 4721 Kawakami, Yuko, 455 Kim, You-Me, 7199 Kohno, Kenji, 5001 Kawamura, Yuki I., 5296 Kim, You-Sun, 5375 Kohno, Masataka, 3316 Kawula, Thomas H., 2065 Kim, You-Young, 5375 Kohsaka, Hitoshi, 1144 Kayibanda, Miche`le, 6416 Kim, Yun-Gi, 2380 Kohyama, Masako, 3067 Kazama, Hirotaka, 2679 Kimberly, Robert P., 3272, 3973, 6867 Koido, Shigeo, 613 Kazani, Shamsah, 496 Kim-Howard, Xana, 7511 Koizumi, Naoya, 1767 Kazatchkine, Michel D., 1086 Kimura, Akihiko, 7385 Kojima, Soichi, 3059 Kazura, James W., 1068 Kimura, Mizuho, 3316 Kok, Alice, 6066 Ke, Yan, 474 Kimura, Motoko Y., 4926 Kok, Jan Willem, 2287 Kean, Rhonda B., 7334 Kimura, Shoji, 1189 Kokame, Koichi, 7042 Keane, Michael P., 511 King, Andrew J., 6252 Kolanus, Waldemar, 2122 Keates, Andrew C., 8013 King, Anne M., 3521 Kole, Thomas P., 2163 AUTHOR INDEX 8243

Koller, Beverly H., 3208, 5132 Kuniyasu, Akihiko, 8183 Lawson, Brian R., 5366 Kollias, George, 6735 Kunkel, Henry G., 1229 Lay, Guillaume, 3161 Kollmann, Tobias R., 3695 Kunkel, Steven L., 511, 3777, 5820 Lazarova, Elena, 1301 Kolls, Jay K., 3702, 6730 Kuns, Rachel D., 6033 Lazo, John S., 6923 Koltakov, Alexander, 201 Kuntz, Gaby, 5465 Le, Annie V., 7310 Kolumam, Ganesh A., 4498, 5802 Kuo, Ann, 4315 Le, Yingying, 1450 Kon, Maria, 6297 Kuo, Cheng-Chin, 6100 Lea, Susan M., 352 Kon, Shigeyuki, 6567 Kuo, Chia-Lam, 3023 Leach, Michael W., 2589 Kondadasula, Sri Vidya, 4832 Kuo, Hui-Kai, 6984 Leanderson, Tomas, 3126 Kondo, Motonari, 5717 Kuo, Paul C., 1870 Lebecque, Serge, 2763, 5305 Kondo, Toshikazu, 7385 Kurisaki, Akari, 918 Leclerc, Claude, 748, 2361 Kono, Dwight H., 8195 Kuroda, Marcelo J., 3409 Leclercq, Georges, 1277, 4230 Koopman, Gerrit, 1702 Kurrer, Michael, 3466 Le´cluse, Yann, 6821 Kopf, Manfred, 2182, 2415, 3466, 4908 Kursar, Mischo, 2661 Lecron, Jean-Claude, 4615 Koppers-Lalic, Danijela, 657 Kurth, Isabel, 4112 Lederman, Michael M., 4436 Korangy, Firouzeh, 1573 Kurt-Jones, Evelyn A., 3363, 5173 Ledford, Julie G., 5132 Koretzky, Gary A., 4606 Kusaka, Satoshi, 3983 Lee, C. Y. Daniel, 7794 Korin, Yael, 7911 Kuwano, Hiroyuki, 757 Lee, Changjin, 7088 Kornfeld, Hardy, 8081 Kuziel, William A., 5305 Lee, Chun Geun, 1948 Koseki, Haruhiko, 5001 Kwekkeboom, Jaap, 6066 Lee, Chung, 2883 Kostianovsky, Alex M., 6158 Kweon, Mi-Na, 2476 Lee, Eun-Hyung, 6624 Kotb, Malak, 3076 Kwok, William W., 6374 Lee, Hyun-Seung, 5375 Kotelianski, Victor, 4506 Kwon, Byoung, 4194 Lee, James J., 7879 Kountouri, Nicole, 6435 Kwon-Chung, Kyung J., 6367 Lee, Janine, 6259 Koup, Richard A., 3492 Kyparissoudis, Konstantinos, 2827 Lee, Jee H., 301 Kourilsky, Philippe, 4865 Kyttaris, Vasileios C., 1938, 1960 Lee, Junglim, 3983 Kovac˘ic´, Natasˇa, 3379 Lee, Junwon, 5588 Kovarova, Martina, 5132 Laban, Sandra, 657 Lee, Kang-Yun, 2491, 7366 Koya, Toshiyuki, 480, 1433 LaBelle, Ed, 5099 Lee, Kyoo Y., 7088 Koyasu, Shigeo, 1349 Lacelle, Chantale, 6840 Lee, Major K., IV, 6028 Kozel, Thomas R., 5753 Lacroix, Monique, 5710 Lee, Nancy A., 7879 Kozyr, Natalia, 8002 Lafitte, Sophia, 1713 Lee, Simon W., 2641 Kraal, Georg, 5429 Lage, Christopher R., 4517 Lee, Soo-Yeon, 5375 Krahenbuhl, James, 338 Lager, Kelly M., 6320 Lee, Soo Young, 5588 Kraiczy, Peter, 7292 Lahesmaa, Riitta, 3648 Lee, Wonhee, 2746 Kraig, Ellen, 3544 Lai, Anne, 5717 Lee, Yi-Mei, 6984 Kramer, Jason M., 663 Lai, Chen-Yen, 6100 Lee, Youl-Nam, 378 Kranz, David M., 6280 Lai, Wi S., 2813 Leeansyah, Edwin, 1096 Krawczyk, Connie M., 4080 Laine, Matti, 3831 Lefebvre, Juliet M., 6796 Kremer, Kimberly N., 1581 Lajoie, Ginette, 1608 Lefkowitz, Elliot J., 6814 Kremer, Laurent, 3161 Lake, Jason G., 5659 Lefrancois, Leo, 6342 Kremmer, Elisabeth, 6861 Lalvani, Ajit, 5217 Legarda-Addison, Diana, 7767 Krensky, Alan M., 77, 3688, 5496, 7081 Lamb, Roberta J., 7833 Legoff, Je´roˆme, 1086 Krettek, Christian, 5940 Lambe, Teresa, 4276 Le Goff, Marc K., 3846 Kretz-Rommel, Anke, 5595 Lambris, John D., 1819 Le Goffic, Ronan, 3368 Krishnan, Lakshmi, 2396 Lamkanfi, Mohamed, 8022 Lehman, Amy, 4832 Krishnan, Lavanya, 7923 Lamont, Deanna, 5879 Lehmann, Paul V., 1372, 4749 Kroesen, Bart Jan, 2287 Lampano, Aaron E., 4717 Lehnardt, Seija, 6476 Kronenberg, Mitchell, 2706, 4230, 5563 Lamy, Laurence, 5930 Lehner, Thomas, 1671 Kro¨nke, Martin, 3390 Lande, Roberto, 6208 Lehtinen, Markus J., 3831 Krueger, James G., 7442 Landers, Carol J., 4033 Lehtonen, Anne, 253 Krueger, Manuela, 2132 Landsman, Limor, 2000 Lehuen, Agne`s, 1332 Kru¨ger, Christine, 1573 Landucci, Gary, 6596 Leibson, Paul J., 3575 Kruisbeek, Ada M., 3668 Lane, Peter J. L., 6200 Leidi, Marzia, 6616 Krutzik, Stephan, 1829 Lang, Roland, 3134 Leipner, Carola, 3466 Kryczek, Ilona, 4706, 6730 Lang, Thomas J., 95 Leitenberg, David, 2056 Kuang, Wen, 2589 Langefeld, Carl D., 3973 Leitges, Michael, 7814 Kubo, Masato, 262, 3777 La¨nger, Florian, 5828 Leitinger, Norbert, 993 Kubota, Ryuji, 5966 Langford, Cordelia, 4304 Leke, Rose G. F., 2770 Kubota, Yoshihisa, 2923 Lanier, Lewis L., 369, 647 Lemaire, Lucienne C., 1845 Kuchen, Stefan, 2872 Lanigan, Caroline, 5812 Lemke, Caitlin D., 6320 Kuchroo, Vijay K., 172, 179 Laouar, Amale, 652 Lemke, Greg, 5635 Kudo, Daisuke, 2278 Laragione, Teresina, 2344 Lemnge, Martha, 428 Kudo, Ichiro, 7042 Lara-Pezzi, Enrique, 8053 Le Moigne, Vincent, 7344 Kuerten, Stefanie, 4749 Larkin, Joseph, III, 4793 Lemonnier, Franc¸ois, 3558 Kuglstatter, Andreas, 2641 LaRosa, David F., 7503 Lendeckel, Uwe, 4632 Kuhl, Heiner, 7151 Larregina, Adriana T., 7006 Lenderink, Amanda M., 1819 Kuhlman, Joshua R., 5312 Larson, Richard S., 3903 Lenox, Christopher C., 8148 Kulig, Paulina, 3713 Lasarte, Juan J., 748 Lenox, Laurie E., 4606 Kulik, Liudmila, 6968 Latov, Norman, 6590 Lenz, Laurel L., 2407 Kulkarni, Hemant, 5668 Lattmann, Evelyn, 1468 Lenzo, Jason C., 2794 Kumagai, Toru, 1021 Lauffenburger, Douglas A., 4984 Leonard, John P., 2589 Kumar, Ashok, 798, 1581 Lavigne, Liz M., 7276 Leonard, Warren J., 6720 Kumar, Vipin, 6043 Lawrence, David A., 4876 Leong, John M., 3740 Kumazaki, Kaori, 2192 Lawrence, Michael B., 3903 Lerm, Maria, 7357 Kume, Hiroaki, 360 Lawrence, Rachel A., 5116 LeRoy, Frances G., 330 Ku¨ndig, Thomas M., 7450 Lawrence, Toby, 5245 Leroy, Marie-Jose`phe, 1115 Kunert, Anja, 5848 Lawson, Alastair D. G., 7710 Lesinski, Gregory B., 4832 8244 AUTHOR INDEX

Letesson, Jean-Jacques, 5182 Lim, Jae Hyang, 1736 Losyev, Grigoriy, 7032 Letvin, Norman L., 3409, 5652 Limacher, Andreas, 389 Lou, Jingwei, 838 Leung, Janson C. H., 4276 Limper, Andrew H., 2950 Lou, Olivia, 1136 Leung, Rufina, 3418, 5606 Lin, Chia-Lei, 838 Lou, Yanyan, 1534 Levi, Marcel, 1845 Lin, Eugene, 5659 Lou, Zhiyong, 944 Levick, Scott P., 641 Lin, Hana, 7432 Louahed, Jamila, 3244 Levin, Matthew, 5563 Lin, Li, 4803 Loukinov, Dmitri, 566 Levisetti, Matteo G., 6051 Lin, Rongtuan, 253 Love, J. Christopher, 7199 Levite, Mia, 683 Lin, Tong-Jun, 3170 Love, Paul E., 2008 Levitsky, Hyam I., 2155 Lin, Wen, 2961 Lovett-Racke, Amy E., 1341 Levitt, Roy, 3244 Lin, Xin, 49 Lovitch, Scott B., 122 Levraud, Jean-Pierre, 4385 Lindeman, Nina, 3831 Lowdell, Mark W., 85 Levy, Bruce D., 496 Linden, Joel, 4240 Lowell, Clifford A., 3874, 4726 Levy, David E., 4901 Ling, Khoon-Lin, 2908 Lo¨wenberg, Bob, 3551 Le´vy, Fre´de´ric, 1277 Linhart, Birgit, 3924, 6290 Lowes, Michelle A., 7442 Levy, Ryan M., 6573 Lins, Debra C., 6752 Lo¨yto¨ma¨ki, Maritta, 3648 Lew, Andrew M., 2094 Liou, Hsiou-Chi, 186 Lu, Bao, 1723 Lewin, Sharon R., 6581 Lipsky, Peter E., 2579, 2872 Lu, Danhong, 3511 Lewis, Christina L., 4984 Lira, Sergio A., 4623, 5296, 5305 Lu, Ling-Min, 936 Lewis, Claire E., 7405 Lison, Dominique, 3244 Lu, Xiaofeng, 3116 Lewis, Margarita, 4395 Liu, Ailian, 4709 Lu, Xin, 5912 Lewis, Mark G., 3492 Liu, Bei, 3219 Lu, Ziyue, 3954 Lewkowicz, Elodie, 4373 Liu, Bigang, 829 Lucas, Andrew D., 4975 Li, Bin, 4250 Liu, Chengwen, 1534 Ludewig, Burkhard, 1468 Li, Bo, 3170 Liu, Cunren, 6867 Ludwig, Andreas, 8064 Li, Cheng, 7730 Liu, Hong, 4567 Ludwig, Stephan, 2813, 3198 Li, Chuanfu, 7317 Liu, Huining, 3409 Ludwig, Thomas, 5443 Li, Chuanyu, 6867 Liu, Jin-Qing, 6227 Luescher, Immanuel F., 3566 Li, Fangyong, 3846 Liu, Li-Hui, 3116 Lu¨hder, Fred, 1363 Li, Fubin, 6297 Liu, Liming, 5390 Lui, Gabrielle, 4947 Li, Hanfen, 5271 Liu, Meidong, 7376 Lukacher, Aron E., 7267 Li, Jian-Dong, 1736 Liu, Michael, 7849 Lukacs, Nicholas W., 511, 5820 Li, Jianhua, 3856 Liu, Ni, 3483 Lukic´, Ivan Kresˇimir, 3379 Li, Jinzhu, 7756 Liu, Shanrong, 3301 Lund, Riikka J., 3648 Li, Li, 1388, 4240, 5899 Liu, Victoria C., 2883 Lundberg, Anna M. C., 2148 Li, Ming O., 6770 Liu, Wujiang, 539 Lundmark, Carin, 5018 Li, Mu, 5480 Liu, Xiaohe, 5035 Lundquist, Rasmus, 3099 Li, Nainong, 838 Liu, Xikui K., 3661 Luo, Ma, 3750 Li, Nianyu, 4214 Liu, Yang, 1542 Luo, Yi, 539 Li, Shu-Jie, 5351 Liu, Yiwei, 944 Lupinek, Christian, 3924 Li, Wei, 3856, 4482 Liu, Yong-Jun, 1534, 6720 Lurquin, Christophe, 2617 Li, Wen Qing, 228 Liu, Yuan, 2483 Luscinskas, Francis W., 1136, 5879 Li, Xiaoli, 3272 Liu, Yuelong, 6867 Lusingu, John P., 428 Li, Xinna, 3116 Liu, Yugang, 503 Lute, Kenneth D., 1542 Li, Xinrui, 3272 Liu, Yuhong, 3153 Lutfalla, Georges, 4385 Li, Yan, 7317 Liu, Yusen, 5312 Lutz, Manfred B., 4908 Li, Yansong, 1938 Liu, Zhiwei, 4260 Lutz, Michael A., 2163 Li, Yonggang, 6634 Liu, Zhuoru, 7432 Lutz, Werner, 6941 Li, Yuehua, 6573 Ljunggren, Hans-Gustaf, 5018 Luzina, Irina, 3962 Li, Zhifang, 2249 Lloberas, Jorge, 6307 Lyadova, Irina V., 976 Li, Zihai, 3219 Llopiz, Diana, 748 Lybarger, Lonnie, 6280 Liadis, Nicole, 2932 Llorian, Miriam, 1981 Lyer, Stefan, 8203 Lian, Dameng, 5480 Lobanenkov, Victor V., 566 Lyle, Elizabeth A., 6387, 7520 Lian, Moh-Moh, 6028 Lobo, Peter I., 4240, 5899 Lynch, Joseph P., III, 511 Liang, Chi-Ming, 6100 Loboda, Agnieszka, 4707 Lyu, Shu-Chen, 77, 5496 Liang, Fang Ting, 5109 Lo Caputo, Sergio, 407 Liang, Jiurong, 2469 Locati, Massimo, 7344 Ma, Chunhong, 503 Liang, Shuang, 4811 Loch, David C., 641 Ma, Jennifer S. Y., 7814 Liang, Shu-Mei, 6100 Lockett, Stephen, 1759 Ma, Jing, 7317 Liang, Spencer, 3822 Loffredo, John T., 2746 Ma, Ling Ling, 6456 Liang, Tony W., 5879 Lofgren, James A., 7467 Ma, Thomas Y., 4641 Liang, Xiaohong, 503 Logozzi, Mariantonia, 5340 Ma, Zhengyu, 6268 Liao, Dongmei, 3593 Logun, Carolea, 5262 Mabbott, Neil A., 3757 Liao, Grace, 3208 Loh, Christina, 1608 MacDonald, H. Robson, 6746 Liao, Jia-Jun, 5425, 6806 Lomada, Dakshayani, 829 MacDonald, Kelli P. A., 6033 Liaw, Hung-Jiun, 3023 Lomash, Suvendu, 7923 MacDonald, Thomas T., 732, 5957 Libert, Claude, 5069 Lombardo, Eleuterio, 3731 Mach, Bernard, 6677 Lich, John D., 1256 Long, Brian, 1388 Maciaszek, Joseph W., 6876 Lichtenegger, Felix S., 4749 Long, Carole, 2770 Mack, Matthias, 5828 Lichtenheld, Mathias, 2667 Lonning, Scott, 2883 Mackall, Crystal L., 5340 Lichty, Brian D., 2387 Look, Dwight C., 6395 Mackman, Nigel, 6252 Lien, Egil, 693, 3740 Lo Passo, Carla, 4417 MacLennan, Ian C. M., 6200 Lie´nard, Danielle, 3566 Lopez, Joe, 6259 MacLeod, Ralph, 1608 Lifson, Jeffrey D., 2746 Lopez, Lissette, 2361 MacPherson, Maximilian, 1800 Liggitt, Denny, 887 Lo´pez, Mercedes N., 6949 Macrı`, Giancarlo, 3126 Lighvani, Shahrzad, 1105 Lo´pez-Botet, Miguel, 808, 4402, 4473 Maderna, Paola, 4595 Liljestro¨m, Peter, 6761 Lo´pez-Guerra, Mo´nica, 1923 Madico, Guillermo, 4489 Lillevang, Søren T., 4708 Lo´pez-Hoyos, Marcos, 2778 Madureira, Pedro, 1379 AUTHOR INDEX 8245

Maeda, Akira, 877 Marincola, Francesco M., 7756 Mauri, Claudia, 7868 Maeda, Atsuko, 605 Marine, Jean-Christophe, 5048 Maus, Regina, 5828 Maeda, Yasuhiro, 3437 Marinho, H. Susana, 3893 Maus, Ulrich A., 5828 Maeda-Yamamoto, Mari, 455 Marinova, Ekaterina, 5010 MaWhinney, Samantha, 6975 Maehr, Rene´, 2192 Marissen, Wilfred E., 3668 May, Kenneth F., Jr., 1542 Maenaka, Katsumi, 33 Markmann, James F., 6028 Mayadas, Tanya, 5879 Maeno, Toshitaka, 8090 Marko, Melissa G., 1443 Mayer, Anja K., 3134 Maes, Tania, 5305, 7501 Marloie-Provost, Marie-Annick, 3373 Mayette, Jana, 7064 Magalha˜es, Vanessa, 1379 Marnell, Lorraine L., 530 Mazier, Dominique, 6416 Mages, Jo¨rg, 3134 Maroto, Beatriz, 3731 Mazur, Daniel J., 6387 Maggirwar, Sanjay B., 3226 Maroulakou, Ioanna, 5443 Mazza, Stefania, 1702 Magistrado, Pamela, 428 Marquina, Regina, 2778 Mazzetta, Francesca, 3932 Maglione, Paul J., 7222 Marr, Kaleb J., 6456 Mazzocchi, Alessandro, 3620 Magness, Scott T., 6522 Marrakchi, Hedia, 3161 Mazzotta, Francesco, 407 Mahanonda, Rangsini, 1151 Marshak-Rothstein, Ann, 6876 Mazzucchelli, Renata, 1553 Maier, Holly, 2714 Marshall, Aaron J., 2328, 7859 Mbow, M. Lamine, 7833 Maier, Lisa M., 6158 Marski, Marissa, 2104 McAdams, Mildred, 4424 Maier, Rolf F., 1180 Marsland, Benjamin J., 2182, 3466 McAllister, Brian, 8081 Maier, Shannon, 2996 Marston, Denise A., 5744 McArdel, Shannon L., 547 Maillard, Ivan, 2008 Mårtensson, Inga-Lill, 1981 McArthur, Craig, 2370 Majeau, Gerard, 2249 Martin, Andrea P., 4623 McBride, Amanda, 5192 Majumder, Biswanath, 7756 Martin, Christine, 8168 McCabe, Kathleen, 1013 Mak, Tak W., 103, 953, 4373 Martin, James P., 4576, 5058 McCann, Fiona E., 3418, 5606 Makinen, Kimmo, 4276 Martin, Maureen P., 33 McCarter, Martin D., 6975 Makita, Shin, 4737, 4937 Martin, Roland, 4632 McCaskill, Joshua G., 3208 Makler, Oryan, 2307 Martin, Stephen W., 67 McCastlain, Kelly, 4528 Malaspina, Angela, 6968 Martı´n-Caballero, Juan, 2296 McCausland, Megan M., 817 Malbec, Odile, 6465 Martineau, Adrian R., 7190 McClure, Harold, 1680, 8002 Malcolm, Kenneth C., 3153 Martinez, Fernando O., 7344 McClurkan, Christopher L., 6374 Malek, Thomas R., 242, 4062 Martı´nez-A, Carlos, 2296 McConville, Malcolm J., 4956 Malik, Meenakshi, 1013 Martinez-Pomares, Luisa, 4975 McCoon, Patricia, 2249 Malissen, Bernard, 7598 Martinko, John M., 6280 McCormick, Sarah, 2387 Malissen, Marie, 7598 Martinotti, Stefano, 720 McDonald, Christine, 2380 Malley, Richard, 1736 Martins, Vera C., 858 McDonald, Patrick P., 7344 Mallone, Roberto, 7458 Martinuzzi, Emanuela, 7458 McDonnell, Kevin, 5390 Malorni, Walter, 3932 Marukawa, Yohei, 574 McDuffie, Marcia, 4240 Malouin, Franc¸ois, 2171 Marusˇic´, Ana, 3379 McElvaney, Noel G., 5871 Maltzman, Jonathan S., 4606 Marusic, Suzana, 2589 McElwain, Shauna, 5321, 7310 Mamalaki, Clio, 6735 Marussig, Myriam, 6416 McGarry, Helen F., 1068 Mami-Chouaib, Fathia, 6821 Maruyama, Kazuichi, 6994 McGarry, Michael P., 7879 Mamikonyan, Gregory, 566 Maruyama, Toshiaki, 5595 McGhee, Jerry R., 6058 Mancuso, Giuseppe, 3126, 4417 Marziali, Marco, 3932 McGlade, Jacqueline P., 2794 Mandakovic´, Dinka, 6949 Mascheri, Ambra, 1931 McGovern, Toby, 3814 Mandal, Palash, 2542 Maskell, Kevin, 2908 McInturff, Jamie E., 1829 Mandrekar, Pranoti, 7686 Masri, S. Hajar, 2721 McKay, Derek M., 4284 Mandruzzato, Susanna, 1122 Masuda, Akio, 360 McKay, Dianne B., 6252 Maneechotesuwan, Kittipong, 2491 Masuda, Daisaku, 4854 McKenzie, Andrew N. J., 3244, 4557 Manenkova, Yulia, 5366 Matarrese, Paola, 5340 McKenzie, Emma J., 4975 Manes, Thomas D., 3237 Mathers, Alicia R., 7006 McKinley, Laura, 3702 Mangan, Niamh E., 4557 Mathieu, Jacques, 7994 McKinnon, Lyle R., 3750 Mani, Arunmani, 2318 Mathis, Diane, 7032 McKinstry, K. Kai, 7563 Manicassamy, Santhakumar, 312 Mathsson, Linda, 5383 McLaren, Paul J., 3750 Manjunath, N., 652 Mathur, Anubhav N., 4901 McLeish, Kenneth R., 2421 Manktelow, Emily, 3558 Matozaki, Takashi, 6164 McNeil, H. Patrick, 1852 Mann, Monica K., 3447 Matsubara, Shigeki, 1433 McPherson, Lisa, 5496, 7081 Mannie, Mark D., 2835 Matsuda, Jennifer L., 3457 McPhillips, Kathleen, 8117 Manns, Michael P., 1573 Matsuda, Satoshi, 1349 McSharry, Brian P., 4473 Manocha, Monika, 652 Matsuguchi, Tetsuya, 360 McSorley, Stephen J., 6342 Manser, Tim, 897, 5035, 5623 Matsukawa, Akihiro, 3777, 5296 McSweeney, Karli A., 6033 Mansilla, Cristina, 748 Matsumoto, Masanori, 2499 McVicar, Daniel W., 33 Mansour, Mariam, 3186 Matsumoto, Misako, 397, 489 McWhirter, John, 5595 Mantovani, Alberto, 7325, 7344 Matsuo, Aya, 397 McWilliams, Jennifer A., 1564 Manzanillo, Paolo, 3143 Matsuoka, Sahoko, 103 Means, Terry K., 2171 Manzel, Lori J., 6395 Matsushima, Glenn K., 5635 Mecklenbra¨uker, Ingrid, 7814 Mao, Changchuin, 5443 Matsuyama, Wataru, 5888 Meditz, Amie L., 6975 Mao, Xiaojuan, 3750 Matsuyoshi, Hidetake, 918 Medzhitov, Ruslan, 970 Marboe, Charles C., 5329 Matsuyuki, Hirofumi, 3437 Me´hats, Ce´line, 1115 Marcondes, Maria Cecilia G., 5812 Matsuzaki, Goro, 3786 Meier, Angela, 7658 Marconi, Peggy, 7738 Matt, Ulrich, 993 Meier, Christa, 389 Marculescu, Rodrig, 5921 Matthaei, Klaus I., 219, 4222 Meijers, Joost C. M., 1845 Marden, Chloe, 85 Matthes, Raphaela-Jessica, 2813 Meinander, Annika, 3944 Maresz, Katarzyna, 39, 3447 Matthews, R. James, 330 Meissner, Nicole, 6604 Marguet, Didier, 4632 Mattila, Teresa, 6975 Melendez, J. Andres, 1013 Mari, Bernard, 3161 Matute, Carlos, 6549 Melendez, Karla, 8107 Mariani, Thomas J., 6191 Mauduit, Marjorie, 6416 Mello, Adriana, 2344 Mariani, Valentina, 7623 Maurer, Dieter, 2262 Mencı´a, Angeles, 2556 Maricic, Igor, 6043 Maurer, Mathew S., 5329 Mendillo, Megan, 338 Marie-Cardine, Anne, 1293 Maurer, Patrik, 2415 Mendoza-Naranjo, Ariadna, 6949 8246 AUTHOR INDEX

Mendoza-Ramirez, Jose, 6259 Miyamoto, Kana, 103 Mosheimer, Birgit, 1748 Meng, Xiaomei, 5312 Miyasaka, Masayuki, 2499 Mosmann, Timothy R., 4506 Meraner, Paul, 2262 Miyata, Toshiyuki, 7042 Moss, Paul A. H., 4455 Meri, Seppo, 3831 Miyazawa, Keiji, 3059 Mosser, David M., 1077 Merino, Jesu´s, 2778 Mizgerd, Joseph P., 1896 Mossman, Brooke T., 1800 Merino, Ramo´n, 2778 Mizoguchi, Toshihide, 192 Motozono, Chihiro, 5513 Merrell, Kevin, 3353 Mizuguchi, Hiroyuki, 1767 Motta, Iris, 4865 Mescher, Matthew F., 6752, 7640 Mizuno, Masashi, 5288 Mountz, John D., 5357 Meskill, Diana, 1039 Mizuta, Hiroshi, 3777 Mousavi, Parvin, 5076 Metenou, Simon, 2770 Mkrtichyan, Mikayel, 566 Moutaftsi, Magdalini, 6814 Metselaar, Herold J., 6066 Mochizuki, Manabu, 6994 Movsesyan, Nina, 566 Metz, Christine N., 2344 Mochizuki, Yoshito, 1349 Moyle, Graeme, 8212 Metzger, Dennis W., 1013 Mock, Miche`le, 2646 Mucci, Steven F., 5413 Meurs, Eliane, 3368 Modamio-Høybjør, Silvia, 2556 Mucida, Daniel, 4230 Meydani, Simin Nikbin, 1443 Modlin, Robert L., 1829 Mudd, Philip A., 7511 Meyer, Tim, 1914 Modrusan, Zora, 2229 Muehmer, Mario, 3134 Meyer-Bahlburg, Almut, 7868 Mody, Christopher H., 6456 Muellauer, Brigitte, 7840 Meyer-Wentrup, Friederike, 154 Moehler, Thomas, 3307 Mueller, Martin J., 7623 Mi, Wentao, 134 Mogi, Makio, 192 Muhlbauer, Marcus, 6522 Mi, Zhiyong, 1870 Mohanty, Subhasis, 970 Mujtaba, Mustafa G., 5058 Miao, Zhenhua, 7395 Mohiuddin, Muhammad, 6028 Mukaida, Naofumi, 574, 7385 Michaelsson, Jakob, 647 Mohr, Elodie, 6200 Mukherjee, Tapan K., 1835 Michalek, Jaroslav, 6789 Mohrs, Katja, 6023 Mukhopadhyay, Srirupa, 1835 Michelsen, Kathrin S., 4033 Mohrs, Markus, 6023 Mullenix, Michael C., 7467 Middleton, Derek, 235 Moir, Susan, 6968 Mu¨ller, Anke, 4335 Midiri, Angelina, 3126, 4417 Moki, Takeshi, 2448 Mu¨ller, Verena, 3198 Miettinen, Aaro, 1208 Molano, Alberto, 1415 Muller, William A., 1136 Mifflin, Randy C., 8097 Mold, Carolyn, 530, 7283 Mu¨ller-Eberhard, Hans J., 1229 Migeotte, Isabelle, 1450 Moldawer, Lyle L., 3886 Mummidi, Srinivas, 5668 Mihai, Sidonia, 6514 Moldenhauer, Gerhard, 7932 Munks, Michael W., 7235 Miki, Takako, 4926 Moles, Jean-Pierre, 4615 Mun˜oz-Planillo, Rau´l, 8022 Miklasz, Steven, 2249 Moll, Hermann, 2803 Munroe, Melissa E., 671 Milani, Monica, 7072 Molle, Ce´line, 7607 Munshi, Nikhil C., 7730 Mileo, Anna Maria, 3932 Mollenhauer, Jan, 8203 Mu¨nz, Christian, 4947 Milkovich, Kimberly A., 4436 Mollinedo, Faustino, 8053 Muraille, Eric, 2171, 5182 Millard, Paul J., 4517 Molnarfi, Nicolas, 446 Murakami, Akira, 3288, 4854 Miller, Edmund J., 2344 Momburg, Frank, 7932 Murakami, Makoto, 7042 Miller, Marcia M., 7162 Monaco, John J., 7557 Murakami, Yousuke, 1144 Miller, Marina, 5321, 7310 Mondiere, Paul, 7779 Murali-Krishna, Kaja, 4498, 5802 Miller, Natalie J., 6968 Moniuszko, Marcin, 3492 Murasko, Donna M., 3886 Miller, Shannon C., 4721 Montecucco, Cesare, 1312 Murata, Yoji, 6164 Miller, Stephen D., 2212 Monteleone, Giovanni, 732, 5957 Murdoch, Craig, 7405 Millington, Kerry A., 5217 Montgomery, Ruth R., 970 Muriglan, Stephanie J., 7473 Millrain, Maggie, 3558 Montreekachon, Pattanin, 1151 Murphy, Kenneth M., 6073 Millward, Jason M., 8175 Montuenga, Luis M., 5991 Murphy, Philip M., 1450 Milne, Sarah, 5744 Monu, Ngozi, 7814 Murphy, Robert C., 6540 Milner, Eric C. B., 6624 Moon, Tae-Chul, 7042 Murphy, Shawn P., 1598 Milner, Richard, 8158 Moons, Lieve, 4267 Murphy, William J., 5753 Milton, Martha J., 908 Moore, Bethany B., 1628 Murray, Peter J., 2623 Milton, Morag K., 7473 Moore, Chris B., 1256 Murray, Rose Ann, 338 Milush, Jeffrey M., 1680 Moore, Daniel J., 6028 Murray, Susan E., 7694 Min, Kyung-Up, 5375 Moore, Fabrice, 1301 Murti, Aruna, 986 Min, Myung Goo, 5321 Moore, Martin L., 2651 Murugaiyan, Gopal, 2047 Min, Wei-Ping, 5480 Moos, Marion, 3307 Mustelin, Tomas, 3680 Mingari, Maria Cristina, 1702 Mora, Barbara, 3932 Mwangi, William N., 4147 Minguela, Alfredo, 134 Morandi, Barbara, 4947 Mytych, Daniel T., 7467 Mintz, Beatrice, 4007 Mordes, John P., 693 Minuzzo, Sonia, 1122 Moreira, Alexandra, 4351 Na, ChangRim, 1829 Miranda, Luis R., 7132 Morel, Franck, 4615 Na, Shin-Young, 1363 Mirandola, Prisco, 4011 Morel, Laurence, 271, 4667 Nabatov, Alexey A., 3177 Mirza, Noweeda, 4705 Morel, Penelope A., 211 Nachman, Alex, 4717 Mischenko, Vladimir V., 976 Morelli, Adrian E., 7006 Nacsa, Janos, 3492 Mishra, Anurag K., 1835 Morelli, Antonio, 3620 Nagarajan, Niranjana A., 2706 Mishra, Gyan C., 2047 Moreno-Pelayo, Miguel Angel, 2556 Nagata, Hideki, 6058 Mishra, Sasmita, 798 Moretta, Alessandro, 2688, 4947 Nagato, Toshihiro, 1189 Misse´, Dorothe´e, 407 Moretta, Lorenzo, 1702, 4947 Nagineni, Sahrudaya, 5262 Mitaksov, Vesselin E., 6280 Morgan, B. Paul, 352, 1783 Nair, Anjali, 693 Mitchell, Thomas C., 4027, 6083 Morgan, Ross K., 8081 Naisbitt, Dean J., 5533 Mitchell, William M., 5200 Morimoto, Junko, 6849 Naka, Kazuhito, 103 Mitra, Debashis, 2047 Morito, Naoki, 605 Nakae, Susumu, 3786 Mitsiades, Constantine, 7730 Moriya, Chikaya, 3409 Nakagawa, Ryusuke, 4482 Mitsunaga, Makoto, 613 Morley, Bernard J., 4395 Nakahashi, Chigusa, 765 Mitsuyama, Hideo, 5888 Morre, Michel, 3492 Nakajima, Takeshi, 489 Mittelbronn, Michel, 8127 Morris, John C., 7120 Nakamichi, Yuko, 192 Mittler, Robert S., 4194 Morris, Melissa Y., 3091 Nakamoto, Yasunari, 574 Mittru¨cker, Hans-Willi, 2661 Morris, Stephan W., 49 Nakamura, Akira, 5086 Miyahara, Nobuaki, 480, 1433 Mortensen, Neil J., 2908 Nakamura, Hiromi, 511 Miyake, Yasunobu, 5001 Moschen, Alexander R., 1748 Nakamura, Masanori, 7042 AUTHOR INDEX 8247

Nakamura, Midrori, 192 Nikolic, Damjan S., 7840 Okada, Takaharu, 2973 Nakanishi, Yoshinobu, 2448, 4917 Nil, Ahmed, 2241 Okajo, Jun, 6164 Nakano, Hiroyasu, 2272, 5277 Nilsson, Gunnar, 4177 Okamoto, Haruka, 6590 Nakano, Naoko, 3067 Nishimura, Yasuharu, 918 Okamoto, Mariko, 262 Nakano, Takako, 605 Niu, Liguo, 4194 Okamoto, Ryuichi, 4737, 4937 Nakayama, Keiichi, 4482 Niu, Linghao, 2641 O’Kane, Cecilia M., 3767 Nakayama, Masafumi, 4250 Niu, Naiqian, 3846, 7501 Okazawa, Akira, 1809 Nakayama, Toshinori, 4926 Nixon, Douglas F., 647 Okazawa, Hideki, 6164 Nakazato, Kenji, 757 Nixon, Jamee C., 2996 Okita, David, 7072 Nakken, Britt, 7511 Nizet, Victor, 7516 Okkenhaug, Klaus, 2328 Namba, Kenichi, 6567 Noble, Alistair, 4771 Okoshi, Yasushi, 765 Nanamori, Masakatsu, 416 Noble, Erika S., 7720 Oksenberg, Jorge R., 5076 Nappi, Filomena, 4039 Noble, Paul W., 2469 Okuda, Tomohiko, 7042 Narayan, Kavitha, 5076 Nobrega, Claudia, 8028 Okumura, Ko, 2272 Narayan, Opendra, 2318 Noda, Satoshi, 5209 Okusa, Mark D., 4240, 5899 Nardelli, Bernardetta, 7325 Nojima, Yoshihisa, 6164 Okuzawa, Chie, 6164 Nashed, Baher, 7859 Nolan, Mary-Jean, 5595 Olivas, Elvia, 2737, 7616 Na¨slund, Tanja I., 6761 Nolden, Lars, 2122 Oliveira, Cristiano L. P., 3016 Nasreddine, Nadine, 1086 Noma, Satoshi, 5888 Oliveira, Liliana, 1379 Natori, Yukikazu, 489 Nooh, Mohammed M., 3076 Oliveira, Marta I., 4351 Naumanen, Tiina, 3648 Nookala, Suba, 5271 Oliver, Janet M., 3530, 4584 Navarrete, Cristina, 85 Noonan, Douglas M., 1122 Olkhanud, Purevdorj, 4891 Nawar, Hesham F., 4811 Nordstro¨m, Eva K. L., 6761 Olszewski, Maciej B., 5701 Nayak, Laxman, 4455 Norman, Anthony W., 7190 Oltean, Daniela, 5595 Nazareth, Michael R., 5552 Norman, John P., 869 O’Mahony, Michael, 5871 Ndonye, Rachel, 1415 Norman, Paul J., 7943 O’Malley, John T., 4901, 7550 Neal, James W., 3323 North, Janet, 85 Omori, Miyuki, 1396 Negus, Margaret C., 2221 Northrop, Sara C., 1341 Omoto, Atsushi, 3316 Nelin, Leif D., 5312 Nouailles, Geraldine, 2661 Omueti, Katherine O., 6387, 7520 Nelson, Kevin L., 1002 Nouri-Aria, Kayhan T., 4658 O’Neal, Jamye F., 702, 2651 Nelson, Mark, 8212 Novak, Hermann, 4335 O’Neill, Katie R., 7879 Nemazee, David, 6332 Novak, Hila, 2307 O’Neill, Shane J., 5871 Nembrini, Chiara, 3466 Novak, Jan, 1332 O’Neill, Thomas, 6259 Nemenoff, Raphael A., 1819 Novelli, Giulia, 7458 O¨ nfelt, Bjo¨rn, 3418 Nemoto, Yasuhiro, 4737, 4937 Novellino, Luisa, 1975 Ono, Nobuyuki, 817 Neubert, Klaus, 4632 Novitskaya, Inna, 7442 Onoe´, Kazunori, 6173, 6567 Neupane, Rupak, 5820 Noy, Roy, 2307 Onozaki, Kikuo, 3059 Neurath, Markus F., 3427 Numasaki, Muneo, 5086 Oonakahara, Ken-ichi, 5888 Nevius, Erin, 4129 Numata, Kosuke, 3777 Oosterwegel, Marie¨tte A., 5762 Newberry, Rodney D., 5659 Nunes, Raquel J., 4351 Oppenheim, Joost J., 6123 Newton, Gail, 5879 Nu´n˜ez, Gabriel, 2380, 8022 Orabona, Ciriana, 3244 Newton, Sandra M., 7190 Nutt, Stephen L., 4104, 4764 Orange, Jordan S., 3627 Ng, Hwee L., 7756 Nuttall, Robert K., 1199 Orenzoff, Barbara L., 1172 Ng, Mah-Lee, 2699 Nyland, Jennifer F., 6710 Orgun, Nural N., 4498, 4731 Ng, Natalie, 5735 Orihuela, Ana, 547 Ngampasutadol, Jutamas, 4489 Obayashi, Hiroshi, 3316 O’Rourke, Helen M., 1488 Ngoi, Soo Mun, 3219 Oblet, Christelle, 407 Orr, Mark T., 4731 Nguyen, Loc T., 1426 O’Brien, Xian M., 7276 Osame, Mitsuhiro, 5888, 5966 Nguyen, Muriel, 7607 Obst, Reinhard, 7032 Osann, Kathryn, 6912 Nguyen, Thang, 3661 Ochkur, Sergei I., 7879 Oseroff, Carla, 6814, 7890 Nguyen, Vinh, 3962 Ochoa-Repa´raz, Javier, 1791 O’Shea, John J., 6426 Nhu, Quan M., 3602 O’Connell, Daniel J., 3358 Osman, Mohammed S., 1261 Ni, Zuyao, 345 O’Connor, Geraldine M., 235 Ossendorp, Ferry, 7581 Nicco, Carole, 1115 O’Connor, Jason C., 663, 6886 Ostlie, Norma, 7072 Nichols, Frank C., 4129 O’Connor, Kevin C., 547 Otsuka, Fujio, 605 Nichols, Kim E., 4606 Odermatt, Bernhard, 5839 Otten, Luc A., 6677 Nichols, Whitney A., 740 Oeschger, Franziska, 1277 Otterbein, Leo E., 5921 Nicholson, Lindsay B., 4984 Offringa, Rienk, 657 Ottinger, Hellmut, 3918 Nickerson, John M., 4276 Oguma, Tsuyoshi, 489 Ouaaz, Fatah, 6777 Nicol, Kathleen K., 5312 Oh, Min-Hee, 5375 Ouled-Haddou, Najate, 1301 Nicolas, Jean-Franc¸ois, 5571 Oh, Sun-Young, 5375 Ouyang, Wenjun, 2229 Nie, Catherine Q., 5779 Ohashi, Pamela S., 2932 Oved, Kfir, 2307 Nie, Hong, 4709 Ohigashi, Hajime, 4854 Owen, Caroline A., 8090 Niederbichler, Andreas D., 7902 Ohira, Taisuke, 3912 Owens, Trevor, 8175 Niederegger, Harald, 1748 Ohkohchi, Nobuhiro, 765 Oxenius, Annette, 3483 Niedergang, Florence, 4373 O¨ hle´n, Claes, 6849 Niederkorn, Jerry Y., 6115 Ohm-Laursen, Line, 4322 Pablo, Lourdes, 2249 Niedermann, Gabriele, 2241 Ohmura, Masako, 103 Pacheco, Yves, 2763 Nielsen, Christian, 4708 Ohnishi, Hiroshi, 6164 Pachner, Andrew, 5076 Nielsen, Leif K., 3099 Ohno, Kinji, 360 Pack, Christopher D., 7267 Nierkens, Stefan, 6894 Ohno, Shigeaki, 6567 Pack, Svetlana D., 566 Niesters, Hubert G. M., 3551 Ohta, Mitsuhiro, 3316 Paganelli, Roberto, 3932 Nigg, Axel P., 7251 Ohyama, Takao, 3713 Page`s, Gilles, 1736 Nigou, Je´roˆme, 3161 Oikawa, Kensuke, 1189 Paggi, Marco G., 3932 Niimi, Kyoko, 489 Oka, Shinichi, 5513 Paiardini, Mirko, 1680 Niino, Masaaki, 6092 Okada, Hideho, 3400 Paige, Christopher, 6028 Nijnik, Anastasia, 2916 Okada, Masahiro, 5086 Palazzo, Marco, 4296 Nikolaus, Susanna, 8203 Okada, Seiji, 3777 Paliga, Krzysztof, 8064 8248 AUTHOR INDEX

Pallone, Francesco, 732, 5957 Perelson, Alan S., 5505 Pluskota, Elzbieta, 2038 Palmer, Lance E., 1172 Peres, Camila M., 1628 Pober, Jordan S., 592, 3237 Pals, Steven T., 1405 Pe´rez-Flores, Vero´nica, 2556 Pogu, Sylvie, 7458 Pan, Minggui, 4315 Pe´rez-Gala´n, Patricia, 1923 Pohl-Schickinger, Anja, 1180 Pan, Yujun, 7511 Perheentupa, Jaakko, 1208 Poiriert, Tiphaine, 5871 Panarey, Laura, 4793 Perkins, David, 5912 Polenghi, Alessandra, 1312 Pandiyan, Pushpa, 2132 Perng, Diahn-Warng, 5237 Polevoy, Victor, 201 Pang, Qishen, 5277 Pernice, Ida, 4417 Pollakis, Georgios, 3177 Pantesco, Ve´ronique, 3307 Pero, Ralph S., 7879 Polosukhin, Vasiliy V., 6504 Paoluzi, Omero Alessandro, 5957 Perrot, Ivan, 2763 Polumuri, Swamy, 3602 Papa, Stefano, 4011 Perry, Seth W., 869 Pompei, Luca, 5192 Papadakis, Konstantinos A., 3293 Peschel, Christian, 953 Ponomarev, Eugene D., 39 Papadimitriou, John C., 3962 Peter, Daniel, 4820 Ponti, Cristina, 4011 Papadopoulos, Nikolaos G., 6290 Peters, Bjoern, 6814, 7890 Po¨ntynen, Nora, 1208 Papasergi, Salvatore, 4417 Petersen, Timothy W., 4250 Popadiak, Katarzyna, 7242 Pape, Hans C., 5940 Peters-Golden, Marc, 1628 Popmihajlov, Zoran, 6109 Pappu, Bhanu P., 49 Petrie, Howard T., 4147 Popov, Alexey, 6931 Paraiso, Kim H. T., 2893 Petriz, Jordi, 6130 Porcelli, Steven A., 1415, 2755, 3620 Parham, Peter, 33, 235, 2688, 7943 Petroff, Margaret G., 1598 Posner, Marshall R., 7132 Parish, Christopher R., 4222 Petromilli, Chris, 6259 Postlethwait, John H., 4517 Park, B. Kevin, 5533 Pettigrew, David M., 352 Postma, Dirkje S., 7678 Park, Gye-Young, 6504 Pettigrew, Gavin J., 2221 Potempa, Jan, 3713, 7242 Park, Heiyoung, 6426 Petty, Joseph M., 8148 Pothlichet, Julien, 3368 Park, Heung-Woo, 5375 Petzold, Shirley J., 6051 Potter, Paul K., 2916 Park, Irwin, 2883 Peyrieras, Nadine, 4385 Poukkula, Minna, 3944 Park, Jong-Hwan, 2380 Peyssonnaux, Carole, 7516 Poustka, Annemarie, 8203 Park, SeHo, 1332 Pfau, Steven, 592 Pouysse´gur, Jacques, 1736 Park, Sung-Moo, 2476 Pfeffer, Lawrence M., 986 Powell, Don W., 8097 Parker, David C., 7694 Pfeffer, Susan R., 986 Powell, Jonathan D., 2163 Parkos, Charles A., 5879 Pfeffer, Ulrich, 1122, 5144 Powell, Timothy J., 1030, 5744 Parmentier, Marc, 1450 Pfister, Gerald, 7840 Power, Melanie R., 3170 Parmiani, Giorgio, 1975 Pfister, Hans-Walter, 1861 Poynter, Matthew E., 1800, 7064, 8148 Parnes, Jane R., 4351 Pham-Dinh, Danielle, 4865 Prabhala, Rao, 7730 Parsa, Kishore V. L., 4445 Phan, Tran, 6596 Prechtel, Alexander T., 5454 Pascual, David W., 1059, 1791 Phares, Timothy W., 7334 Precup, Calin, 657 Pashine, Achal, 2688 Philadelphe, Emilie, 5435 Prehn, John L., 4033 Pasqualini, Fabio, 6616 Phillips, Gary, 7120 Preisser, Laurence, 4615 Pasqualini, Renata, 8183 Philpott, Dana, 2171 Preller, Vera, 4632 Pasquetto, Valerie, 6814, 7890 Phipps, Richard P., 3226 Premack, Brett A., 7395 Pastor, Silvia, 134 Phulwani, Nirmal K., 4528 Price, David A., 3492, 5727, 7756 Pastor, William A., 5652 Pianko, Matthew J., 7902 Pridans, Clare, 4104 Pastor, Xavier, 6533 Piao, Jiang-Hu, 2272 Prieto, Jesu´s, 748 Patel, Anjali, 3593 Picca, Cristina Cozzo, 4793 Prod’homme, Virginie, 4473 Patel, Nitixa, 2075 Piccoli, Mario, 4039 Profozich, Jennifer L., 908 Patel, Samir N., 3954 Pichyangkul, Sathit, 1151 Protheroe, Cheryl A., 7879 Patel, Seema R., 5659 Pickett, Gavin, 4584 Pruenster, Monika, 7840 Pater, Jennie M., 1845 Piconi, Stefania, 1931 Pruett, Stephen B., 1243 Pathan, Ansar A., 1914 Pidiyar, Vyankatesh, 2565 Pu, Xin-An, 6227 Paton, James C., 5828 Pido-Lopez, Jeffrey, 1671 Puaux, Anne-Laure, 3637 Paukovics, Geza, 6581 Pierdominici, Marina, 3932 Publicover, Jean M., 6350 Paul, Bianca, 2122 Pierrot, Christine, 1713 Pucillo, Carlo, 2549 Paul, Elyse, 7756 Pieters, Raymond, 6894 Puertas, Maria Carmen, 6533 Paulart, Fre´de´ric, 1301 Pietila¨, Taija E., 253 Pugh-Bernard, Aimee, 6624 Paveglio, Sara A., 7064 Piganelli, Jon D., 908 Puime`ge, Leen, 5069 Pawliczak, Rafal, 5262 Piguet, Vincent, 7840 Puissegur, Marie-Pierre, 3161 Paxton, William A., 3177 Pilette, Charles, 4658 Pujol-Borrell, Ricardo, 6533 Pearce, Edward J., 1635, 4080, 6023 Pillai, Asha B., 6242 Puliaev, Roman, 95, 3962 Pearlman, Eric, 1068 Pils, Stefan, 3797 Puliaeva, Irina A., 3962 Pease, Larry R., 1426, 3583 Pimkhaokham, Atiphan, 1151 Pulko, Vesna, 3583 Pedemonte, Nicoletta, 5144 Pinchuk, Irina V., 8097 Pumphrey, Nicholas J., 5727 Pedersen, Jan S., 3016 Pinto, Amelia K., 7235 Punzel, Michael, 3918 Pedras-Vasconcelos, Joao, 39 Pio, Ruben, 5991 Puri, Kamal, 6332 Pedretti, Nathalie, 4615 Piris, Juan, 2908 Purohit, Sharad, 7173 Peebles, R. Stokes, Jr., 702, 1628, 2651 Pirkebner, Daniela, 4362 Puzo, Germain, 3161 Peixoto, Anto´nio, 4351 Pirmohamed, Munir, 5533 Pypaert, Marc, 7822 Pellicci, Daniel, 1618, 2827 Pisetsky, David S., 6495 Pellicioli, Erica, 67 Pittet, Mikae¨l J., 4112 Qian, Jie, 5351 Peltonen, Leena, 3007, 4276, 7173 Pittman, Hanna, 85 Qian, Kun, 3973 Peltre, Gabriel, 6290 Pizarro, Theresa T., 1809, 5411 Qian, Ye, 5982 Peluso, Ilaria, 732, 5957 Pizzuti, Antonio, 3932 Qin, Fenghua, 5595 Pende, Daniela, 5606 Planas, Raquel, 6533 Qin, Yufen, 557 Pe`ne, Je´rome, 407, 4615 Platt, Jeffrey L., 2950, 4005 Qiu, Hongyu, 1048 Penna, Giuseppe, 145 Plitas, George, 4411 Qiu, Yuhui, 5277 Penninger, Josef M., 192 Ploegh, Hidde L., 2192, 7199 Qualls, Clifford, 4584 Pennucci, Jason J., 7467 Plow, Edward F., 2038 Quandt, Dagmar, 2132 Pereda, Cristian, 6949 Plumb, Troy J., 7747 Quesnel-Hellmann, Anne, 7994 Pereira, Stephen P., 1914 Plummer, Francis A., 3750 Quigg, Richard J., 1819 Pereira da Silva, Gabriela, 7325 Plunkett, Fiona J., 7710 Quilici, Cathy, 6435 AUTHOR INDEX 8249

Quintero, Pablo A., 8090 Reichner, Jonathan S., 7276 Ro¨cken, Christoph, 4632 Quinton, Lee J., 1896 Reif, Kathryn E., 5109 Rodet, Karen, 5571 Quirce, Santiago, 6290 Reikie, Brian, 3695 Rodriguez, Benigno, 4436 Reilly, Kerri, 5116 Rodriguez, Wilfredo, 530 Raab, Jesse R., 4411 Reimann, Jo¨rg, 2083 Rodriguez-Barbosa, Jose-Ignacio, 6861 Rabinovich, Gabriel A., 436 Reiner, Steven L., 2730 Roediger, Elizabeth, 2387 Rabitti, Carla, 7432 Reinhardt, Richard, 7151 Roenneburg, Drew A., 3983 Racke, Michael K., 1341 Reinheckel, Thomas, 7932 Rogan, Mark P., 5871 Radeke, Heinfried H., 2458 Reinherz, Ellis L., 3668 Rogers, Nicola J., 4395 Radhakrishnan, Suresh, 1426, 3583 Reinhold, Dirk, 4632 Roget, Karine, 6465 Radic, Luana, 1702 Reinke, Emily, 520 Rohner, Franziska, 7450 Radoja, Nadezˇda, 7814 Reiss, Karina, 8064 Rohrer, Dan, 6259 Radoja, Sasˇa, 7814 Reissmann, Regina, 3466 Romagnani, Chiara, 4947 Radoja, Sasa, 6109 Reiter, Yoram, 2307 Romani, Nikolaus, 4362 Radu, Caius G., 7747 Relland, Lance M., 2961 Romano, Marco, 5957 Rahman, Adeeb H., 7503 Re`me, Thierry, 3307 Rombouts, Elwin J. C., 3551 Rahman, Marina, 3846 Remigio, Linda, 8117 Romeo, Angela, 4417 Rahman, Ziaur S. M., 897, 5623 Remoli, Maria Elena, 6208 Romero, Jackeline F., 7054 Rai, Pradeep R., 8148 Remotti, Helen, 7432 Romero, Pedro, 3566, 4112 Raimondi, Giorgio, 7018 Renauld, Jean-Christophe, 3244 Roni, Valeria, 1122 Raj, Beena Patricia Jeevan, 7923 Re´nia, Laurent, 6416, 7054 Ro¨nnelid, Johan, 5383 Rajaram, Murugesan V. S., 4445 Rennard, Rachel, 2249 Roque, Susana, 8028 Rajgopal, Vikram, 4707 Renner, Marcus, 8203 Rosales, Carlos, 3048 Rajnavo¨lgyi, Eva, 5340 Rennert, Paul D., 2249, 4342 Roschke, Viktor, 7325 Rak, Michael, 4424 Renneson, Joelle, 7607 Rose, C. Edward, Jr., 1882 Rakasz, Eva G., 2746 Renz, Harald, 7805 Rose, John K., 6350 Ram, Sanjay, 1002, 4489 Renzi, Cristina, 3932 Rose, Noel R., 6710 Ramakrishnan, Rajasekhar, 5329 Reome, Joyce, 1030 Rose, S. Jane, 4395 Ramdahin, Sue, 3750 Re´quena, Mary, 1086 Rose, Shawn, 2667 Rameshwar, Pranela, 2075 Rethi, Bence, 5340 Rosen, Antony, 95 Ramı´rez, Marcos, 6949 Reya, Tannishtha, 3511 Rosen, David B., 647 Rammensee, Hans-Georg, 5465 Reyes, Victor E., 8097 Rosenberger, Peter, 8127 Ramsburg, Elizabeth A., 6350 Reynaert, Niki L., 3814 Rosenstiel, Philip, 8203 Ramshaw, Ian A., 2370 Rha, Yeong-Ho, 1433 Rosenwasser, Lanny J., 5413 Rhoden, Kerry, 5144 Ranasinghe, Charani, 2370 Ross, David J., 511 Ribeiro, Adı´lia, 1379 Randall, Louise M., 6033 Rossi, Jean-Franc¸ois, 3307 Ricardo-Dukelow, Mary, 6404 Rane, Madhavi J., 2421 Rossini, Aldo A., 693 Rangel, Roberto, 8183 Riccardi, Carol, 1791 Rossini, Anna, 4296 Rangnekar, Vivek M., 111 Ricci, Vittorio, 5957 Rossmann, Evelyn, 7292 Rani, Reena, 5277 Rice, Peter A., 4489 Roth, Johannes, 3198 Ranjbaran, Hooman, 592 Rich, Alexander, 5413 Rothenberg, Marc E., 4222 Rankin, Joanna, 4395 Richardson, James A., 134 Rothstein, Thomas L., 4726 Rao, Sambasiva, 2249 Richez, Christophe, 6876 Roue´, Gae¨l, 1923 Rao, Sudha, 7097 Richie, Ellen R., 829 Rouhani, Foad J., 2221 Rao, Zihe, 944 Richon, Catherine, 6821 Roundy, Kirstin M., 7139 Rapaka, Rekha R., 3702 Richter, Martin, 4506 Rasmussen, Jeffrey P., 4230 Rickards, Carole R., 4473 Routy, Jean-Pierre, 788 Rasool, Omid, 3648 Rickinson, Alan B., 4455 Rowland-Jones, Sarah, 33 Rathbone, Michel P., 720 Riedemann, Niels C., 5940 Roy, Ananda L., 2631 Ratsch, Boris A., 8073 Rieder, Michael J., 5533 Royer, Pamela A., 1819 Ratto, Giovanni, 4947 Riegert, Patricia, 5744 Rozell, Bjo¨rn, 5018 Rau, Friederike C., 1457 Riera-Sans, Lluı´s, 5690 Rozengurt, Enrique, 7911 Raval, Gira, 6642 Riesbeck, Kristian, 6316, 6359, 7242 Rozie`res, Aurore, 5571 Ravasi, Timothy, 6557 Rifkin, Ian R., 6876 Ruan, Qingguo, 186, 7173 Ravazzolo, Roberto, 5144 Riise, Gerdt C., 3536 Rubio-Godoy, Verena, 3566 Ravey, E. Prenn, 5595 Riley, Eleanor M., 4136 Ru¨ckerl, Dominik, 7251 Ravikumar, Sharada, 5192 Riley, Richard L., 3521 Rudd, Brian D., 5820 Ravon, Elisa, 4615 Rimsza, Lisa M., 4051 Rudensky, Alexander Y., 4230 Rawale, Sharad, 7120 Ring, Johannes, 7623 Rudge, Geordie, 4089 Rawlings, David J., 7868 Ripoll, Vera M., 6557 Rueda, Daniel, 4373 Ray, Alpana, 1774 Ritchie, Janine M., 2094 Rueda, Fe´lix, 6130 Ray, Bimal K., 1774 Rittirsch, Daniel, 7902 Rueda, Paloma, 2361 Ray, M. Graham, 6975 Rittling, Susan R., 6567 Rufer, Nathalie, 3566, 4112 Ray, Steven J., 4506 Rivas, Magali Noval, 6700 Ruff, Katherine, 4667 RayChaudhury, Abhik, 4832, 6227 Rivera, Juan, 2549 Ruggeri, Alessia, 3126 Rayman, Patricia, 6642 Rivera-Nieves, Jesus, 1809 Ruishalme, Iida, 7357 Raynaud, Pierre, 3307 Robays, Lander J., 5305 Ruiz-Vazquez, Elena M., 5329 Re, Fabio, 5271 Robbins, Rachel, 2872 Ruland, Ju¨rgen, 953, 4373 Reardon, Colin, 4284 Roberts, Alan D., 1030 Rumio, Cristiano, 4296 Rebeaud, Fabien, 4373 Robertson, Darrell A., 111 Rupprecht, Tobias A., 1861 Rebhahn, Jonathan, 4506 Robertson, Nathan J., 3558 Rus, Violeta, 3962 Rebrovich, Michelle, 2950 Robson, Bryanne E., 1896 Russano, Anna M., 3620 Rechavi, Gideon, 2307 Robson, Simon C., 5921 Russell, Michael W., 4811 Recio, Marı´a J., 2556 Rocha, Benedita, 4351 Rutigliano, John A., 2737 Reddington, Faye, 6181 Rocha, Paulo N., 7747 Rutjens, Erik, 1702 Redman, Christopher W., 5949 Rochester, Carolyn, 1948 Rutkowski, Melanie, 6604 Reed, Elaine F., 7911 Rochman, Irina, 6720 Rydstro¨m, Anna, 5789 Regueiro, Jose´ R., 2556 Rock, Kenneth L., 2844, 6923 Rynda, Agnieszka, 1791 8250 AUTHOR INDEX

Sa, Gaurisankar, 6642 Saruta, Masayuki, 3293 Schulz, Beate, 8064 Sa, Susan M., 2229 Sarvetnick, Nora, 6236 Schumann, Ralf R., 7520 Saada, Jamal I., 8097 Sasakawa, Chihiro, 2476 Schuurhuis, Danita H., 7581 Saalbach, Anja, 4966 Sasaki, Tomomi, 1767 Schuyler, Mark, 4584 Sa-Ard-Iam, Noppadol, 1151 Sastre, Xavier, 3373 Schved, Jean-Franc¸ois, 3307 Sabat, Robert, 5973 Sather, Blythe D., 887 Schwaller, Ju¨rg, 4373 Sacha, Jonah B., 2746 Sathish, Jean G., 330 Schwan, M. Alexander, 3918 Sack, Ulrich, 4966 Sato, Katsuaki, 2979 Schwanninger, Angelika, 2611 Sacks, Gavin P., 5949 Sato, Keisuke, 1189 Schwartz, Allan, 5329 Sacre, Sandra M., 2148 Sato, Marimo, 7571 Schwartz, Michal, 163 Sad, Subash, 2396 Sato, Masahiro, 192 Schwartzberg, Pamela L., 1692 Saeland, Sem, 4362 Sato, Motohiko, 2901 Schwarz, Agatha, 877 Sa´ez, Juan C., 6949 Sato, Wakiro, 7525 Schwarz, Benjamin A., 2008 Sae´z, Pablo J., 6949 Satoh, Hitoshi, 103 Schwarz, Nicole, 8064 Saffar, Arash Shoja, 2535 Satoh, Tadayuki, 5209 Schwarz, Thomas, 877 Safrit, Jeffrey T., 8002 Satterthwaite, Anne B., 740 Schwarze, Ju¨rgen, 2609 Safroneeva, Ekaterina, 7984 Saudan, Philippe, 67 Schweitzer, George, 122 Saftig, Paul, 8064 Saulnier, Patrick, 6821 Scott, Bernadette, 4089, 7540 Saggar, Rajan, 511 Saunders, Thomas L., 3680 Scott, Diane, 3558 Saha, Bhaskar, 2047 Saveanu, Loredana, 2241 Scott, Martin L., 2249, 4342 Saha, Nil Ratan, 5682 Sawa, Hirofumi, 397 Scott, Phillip, 7259 Saibil, Samuel D., 2932 Sawamura, Sadaaki, 5209 Scott-Tucker, Anthony, 6200 Saidi, He´la, 1086 Sayama, Koichi, 489 Scumpia, Philip O., 3886 Saijo, Shinobu, 6444 Sayegh, Mohamed H., 3345, 5419 Seach, Natalie, 4956 Saito, Takashi, 6715 Sayles, Peter, 976 Seagrave, JeanClare, 8107 Saito, Yasuyuki, 6164 Sayo´s, Joan, 808 Seaman, Michael S., 7132 Sakai, Yoshio, 574 Scandella, Elke, 1468 Sedy, John R., 6073 Sakk, Vadim, 3797 Scannell, Michael, 4595 Seemanapalli, Sunita V., 5109 Sakurai, Fuminori, 1767 Scapini, Patrizia, 7325 Segal, Benjamin M., 6695 Salagianni, Maria, 4771 Scapozza, Leonardo, 389 Segal, Dina, 2307 Salajegheh, Mohammad, 547 Scarpellino, Le´onardo, 1277 Sehrawat, Seema, 5879 Salama, Alan D., 5419 Scearce, Richard M., 4424 Seitsonen, Sanna, 3831 Salazar-Gonzalez, Rosa-Maria, 6342 Schaefer, Julia, 7902 Seitz, Heather M., 5635 Salazar-Onfray, Flavio, 6949 Schall, Thomas J., 7395 Sejas, Daniel P., 5277 Salek-Ardakani, Shahram, 6814 Schaller, Matthew A., 5820 Sekaly, Rafick-Pierre, 788 Salgame, Padmini, 5192 Schaper, Fred, 2813 Seki, Shuhji, 3886 Salio, Mariolina, 2721, 2908 Schaubert, Keri L., 7756 Seki, Yoh-ichi, 262 Salmon, Mike, 7710 Scheinin, Joonas, 3648 Sekine, Shinichi, 6058 Salunke, Dinakar M., 7923 Schenal, Monica, 1931 Sel, Sarper, 7805 Salvetti, Marco, 6208 Schiemann, Matthias, 4908 Sel, Serdar, 7805 Sama, Andrew E., 3856 Schiffer, Ce´cile, 6465 Seligman, Eva, 1450 Sambandam, Arivazhagan, 2008 Schifitto, Giovanni, 3226 Sellati, Timothy J., 1013 Sami, Malkit, 5727 Schildgen, Verena, 4650 Selleri, Silvia, 4296 Samson, Michel, 5435 Schirmacher, Peter, 3427, 8203 Selvaraj, Ramesh K., 7667 Samuelsson, Martin, 6316 Schirmbeck, Reinhold, 2083 Sen, Jyoti Misra, 5028 Sanal, Ozden, 2556 Schjetne, Karoline W., 4169 Sen, Pritha, 3409 Sanchez, Phillip J., 1564 Schlesinger, Larry S., 4445 Sengupta, Sadhak, 6083 Sa´nchez-Go´mez, Marı´a Victoria, 6549 Schlichtemeier, Rick, 6975 Senju, Satoru, 918 Sanchez-Guajardo, Vanesa, 7550 Schlitt, Hans-Ju¨rgen, 5859 Senn, Beatrice M., 1468 Sa´nchez-Madrid, Francisco, 8053 Schmid, Sybille, 3198 Sentandreu, Rafael, 2038 Sandau, Michelle M., 6342 Schmid-Grendelmeier, Peter, 389 Sentman, Charles L., 6140 Sander, Howard W., 6590 Schmidt, Marc, 3198 Seoane, Elena, 2556 Sanders, Andrew B., 5200 Schmitt, Anne-Marie, 5571 Seong, Rho H., 7088 Sanderson, Joseph P., 5533 Schmitter, Tim, 3797 Serezani, Carlos H., 1628 Sandler, Laurel L., 3837 Schmitz, Thomas, 1115 Serghides, Lena, 3954 Sandor, Matyas, 520 Schmuth, Matthias, 4362 Serhan, Charles N., 496, 3912 Saner, Catherine, 6746 Schneider, Elke, 5435 Serra, Maria, 6307 Sanjabi, Shomyseh, 6777 Schnepple, David J., 4846 Serrao, Graziano, 4296 Sanjanwala, Bharati, 2688 Schoeb, Trenton R., 851 Serre, Karine, 6200 Sankar, Uma, 3511 Schoenberger, Stephen P., 5563 Sethi, Gautam, 2507 Sansonetti, Philippe J., 2476 Schofield, Louis, 5779 Setiady, Yulius, 7173 Santamaria, Pere, 1415 Schoon, Renee A., 3575 Sette, Alessandro, 6374, 6814, 7890 Santiago-Raber, Marie-Laure, 8195 Schoonjans, Kristina, 4362 Severa, Martina, 6208 Santiuste, Ine´s, 2778 Schori, Hadas, 163 Se´ve`re, Sabine, 7458 Santoni, Angela, 4039 Schouft, Marie-The´re`se, 3323 Severgnini, Mariano, 6191 Santori, Fabio R., 6109 Schramm, Gabriele, 6023 Sevigny, Charles P., 4240 Santoro, Helen, 5390 Schraven, Burkhart, 4632 Sewell, Andrew K., 5727, 7756 Santosuosso, Michael, 2387 Schreiber, Robert D., 7540 Seya, Tsukasa, 397, 489 Sanz, In˜aki, 6624 Schreiber, Stefan, 8203 Seymour, John F., 6435 Sanz, Marianela, 2572 Schreiner, Sheila, 908 Shachar, Idit, 163 Saresella, Marina, 1931 Schroeder, John T., 2171 Shafer-Weaver, Kimberly, 1268 Sargent, Ian L., 5949 Schuler, Gerold, 4908, 7703 Shah, Aaloki, 1013 Saric, Tomo, 3390 Schuler-Thurner, Beatrice, 7703 Shah, Ali H., 2883 Sarisky, Robert T., 7833 Schulmeister, Ulrike, 6290 Shahidain, Seif, 111 Sarma, J. Vidya, 7902 Schulte, Alexander, 8064 Shahlaee, Amir H., 378 Sa¨rndahl, Eva, 7357 Schultz, Erwin S., 7703 Shakya, Arvind, 1774 Sarobe, Pablo, 748 Schultz, Jackie, 3983 Shammas, Masood, 7730 Sartory, Nico, 2458 Schultze, Joachim L., 6931 Shamshiev, Abdijapar, 2182 AUTHOR INDEX 8251

Shan, Lianyu, 2535 Siegel, Richard M., 6426 Song, Dae Jin, 5321 Shankar, Malini, 2996 Sijts, Alice J. A. M., 7557 Song, Haifeng, 926 Shannon, M. Frances, 7097 Silk, Jonathan D., 2721 Song, Kyung W., 2641 Shao, Hui, 474 Silver, Phyllis B., 5578 Sontag, Mario, 7151 Shao, Jinyi, 4097 Silverman, Gregg J., 2636 Sonza, Secondo, 6581 Shapiro, Steven D., 5912, 8090 Silvers, Willys K., 4007 Soorana, Suren R., 5949 Sharma, Rahul, 1251 Silvestri, Guido, 1680, 8002 Sopper, Sieghart, 5812 Sharpe, Arlene, 5563 Sim, Davis, 2565 Sørensen, Ole E., 7190 Shasby, D. Michael, 6395 Simeone-Penney, Marina C., 6191 Soroczyn´ska-Cybula, Monika, 771 Shaulov, Angela, 3695 Simmons, Randi M., 3107 Souil, Evelyne, 1115 Shaw, Albert C., 970 Simms, Benjamin T., 1896 Soumelis, Vassili, 3373 Shaw, David, 2641 Simon, Amy R., 6191 Sousa, Ana E., 3252 Shaw, Iain, 5744 Simon, Jan C., 4966 Sozzani, Silvano, 145, 6616 She, Jin-Xiong, 7173 Simon, Markus M., 7292 Spaargaren, Marcel, 1405 Shearer, Gene M., 3492 Simons, F. Estelle R., 2535 Speiser, Daniel E., 3566, 4112 Sheasley-O’Neill, Stacey L., 1512 Simpson, Elizabeth, 3558 Spencer, Sean P., 2746 Shechter, Ravid, 163 Simpson-Abelson, Michelle R., 5552 Spencer, Trent, 4194 Sheehan, Kathleen C. F., 7540 Sims, Gary P., 2872 Sperr, Wolfgang R., 6290 Sheibanie, Amir F., 8138 Simson, Ljubov, 4222 Spierings, Diana C. J., 2287 Shelhamer, James H., 5262 Sina, Christian, 8203 Spies, Thomas, 961 Sheller, James R., 6504 Sinai, Parisa, 2028 Spinozzi, Fabrizio, 3620 Shen, David T., 7814 Sing, Andreas, 2803 Spits, Hergen, 3551 Shen, Hao, 4080 Singh, Gyanesh, 4757 Spitzauer, Susanne, 6290 Shen, Huahao, 7879 Singh, Mahavir, 1671 Spohn, Gunther, 7450 Shen, Lianjun, 2844 Singh, Narendra P., 6840 Springhorn, Jeremy, 5595 Sheng, Hongmiao, 4097 Singh, Prem Prakash, 7302 Sprott, G. Dennis, 2396 Shenker, Bruce J., 5099 Singh, Rajendra, 1013 Sribar, Martina, 3918 Shepelkova, Galina S., 976 Singh, Ram Pyare, 7649 Srinivasan, Aparna, 6342 Shepherd, Dawn, 2721 Singh, Sanjay K., 1158 Sriram, Uma, 6268 Sherrill, Taylor P., 6504 Singh, Subhash, 3099 Srivastava, Amit, 1736 Sherry, Barbara, 2344 Sˇinkora, Marek, 711, 6320 Srivastava, Mrigank, 5828 Sherry, Christina L., 663, 6886 Sˇinkorova´, Jana, 711 Staal, Frank J. T., 3551 Sherwin, Catherine, 6549 Siraganian, Reuben P., 926 Stacy, Sue, 3544 Shevach, Ethan M., 4022, 6901 Sircar, Monica, 5879 Stadanlick, Jason E., 7531 Shi, Fu-Dong, 6227 Sistonen, Lea, 3944 Staeheli, Peter, 2241 Shi, Lei, 6395 Si-Tahar, Mustapha, 3368 Staelens, Jan, 5069 Shi, Ming, 6634 Sitaru, Cassian, 6514 Stamataki, Zania, 1981 Shi, Xiaoyan, 5496 Sitkovsky, Michail, 7747 Stambas, John, 1285 Shi, Yongzhong, 7376 Siu, Gerald, 1523 Sta¨mpfli, Martin R., 936 Shiao, Stephen L., 3237 Sivasankar, Baalasubramanian, 1783 Standifer, Nathan E., 3544 Shiau, Ai-Li, 4688 Sizing, Irene D., 2249 Stanley, Amanda C., 6033 Shibata, Kensuke, 4466 Skerka, Christine, 5848, 7292 Stanley, Sarah A., 3143 Shibuya, Akira, 605, 765 Skerrett, Shawn J., 1896 Stanton, Richard J., 4473 Shibuya, Kazuko, 605, 765 Skinner, Pamela J., 6975 Staples, Karl J., 4779 Shida, Kyoko, 397 Sklar, Larry A., 3903, 6828 Stapleton, Cliona, 3208 Shigeoka, Alana A., 6252 Skog, Patrick, 6332 Staprans, Silvija I., 1680, 8002 Shigeta, Akiko, 2499 Skolimowska, Keira, 7190 Staudt, Margaret K., 2440 Shiina, Takashi, 7162 Sleeman, Jonathan, 4966 Steeber, Douglas A., 291 Shill, Holly A., 6590 Slifka, Mark K., 1654 Steel, Alan, 8212 Shim, Doo-Hee, 2476 Smallie, Timothy, 4779 Steele, Chad, 1800, 3702 Shimano, Kyoko, 3437 Smeltz, Ronald B., 4786 Steenwinckel, Vale´rie, 3244 Shimizu, Kanako, 2853 Smit, Joost J., 5820 Steffen, Lori A., 1523 Shimizu, Sayoko, 7162 Smith, Aleah L., 4159 Steimle, Viktor, 6677 Shimoda, Kazuya, 4482 Smith, Arnold L., 1002 Stein, Juergen M., 2458 Shimohata, Homare, 605 Smith, Courtney, 6109 Steiner, Theodore S., 5735 Shin, Hae-Sook, 1164 Smith, Kelly D., 4717 Steinkasserer, Alexander, 5454 Shiomi, Tetsuya, 489 Smith, Philip, 4557 Steinman, Ralph M, 5 Shirahama, Yuko, 5888 Smith, Terry J., 3281 Stel, Alja J., 2287 Shirai, Yuri F., 4296 Smolen´ska, Z˙ aneta, 771 Stendahl, Olle, 7357 Shiraishi, Yoshiki, 489 Smyth, Mark J., 2827, 4222, 4764, 7540 Stepensky, Vitaly A., 7520 Shiratsuchi, Akiko, 2448, 4917 Snapper, Clifford M., 7283 Stephany, Jason J., 2746 Shiroki, Fumiko, 1349 Sniderhan, Lynn F., 3226 Stephens, Geoffrey L., 6901 Shirwan, Haval, 6840 Snounou, Georges, 6416 Stephenson, Susan T., 7720 Shivers, Debra K., 6268 So, Jenny, 2737, 3091 Steptoe, Raymond J., 2094 Shizukuishi, Satoshi, 6058 Soares, Rui S., 3252 Stern, Lawrence J., 788 Shlomchik, Mark, 6028 Sobieszczuk, Peter, 5116 Sterry, Wolfram, 5973 Shobab, Leila A., 5735 So¨derstro¨m, Thomas S., 3944 Stevens, Rosemary, 1388 Showell, Henry, 7395 Sodora, Donald L., 1680 Stewart, Allan S., 5329 Shriver, Leah P., 39, 3447 Sohn, Dong H., 7088 Stillion, Richard J., 4975 Shu, Suyu, 2278 Soininen, Raija, 5912 Stingl, Georg, 2262 Shufesky, William J., 7006 Sokol, Seth I., 592 Stockinger, Brigitta, 5488 Shukla, Arti, 1800 Sollinger, Hans W., 3983 Stoiber, Heribert, 7840 Shurin, Galina V., 7787 Solomon, Ajantha, 6581 Stoitzner, Patrizia, 4362 Shurin, Michael R., 7787 Soloviev, Dmitry A., 2038 Stolfi, Carmine, 5957 Siddiqui, Mahveen Ruby, 338 Sonawane, Samsher, 6028 Storkus, Walter J., 3400 Sideri, Mario, 3186 Sondo, Elvira, 5144 Story, Brian T., 6374 Sidney, John, 6814, 7890 Song, An, 5496 Stout, Barbara A., 8107 Sidwell, Robert W., 5200 Song, Changjie, 1852 Stout, Robert D., 1357 8252 AUTHOR INDEX

Strahotin, Simona, 4194 Suzuki, Yuzuru, 5682 Tary-Lehmann, Magdalena, 1372, 4749 Strasser, Andreas, 4177 Swaidani, Shadi, 6482 Tateno, Masatoshi, 1189 Strauss, Laura, 320 Swain, Susan L., 1030, 1321, 7563 Taub, Dennis, 4891 Streeck, Hendrik, 7658 Swann, Jeremy B., 7540 Taube, Christian, 1433 Strickland, Deborah, 2609 Swanson, Steven J., 7467 Taut, Katharina, 5828 Strieter, Robert M., 511 Swedo, Susan E., 7412 Tavares, Delfina, 1379 Stritesky, Gretta L., 4901 Sweet, Matthew J., 6557 Taxman, Debra J., 1256 Strober, Samuel, 6242 Swoboda, Ines, 6290 Tayade, Chandrakant, 4267 Strober, Warren, 5859, 6725 Syed, Mohsin Md., 4528 Taylor, Corinne, 2148 Strowig, Till, 4947 Sylva-Steenland, Regien M. R., 1986 Taylor, Diane Wallace, 2770 Strutt, Tara M., 1030, 7563 Syrbe, Uta, 8073 Taylor, Kristen R., 1829 Stubenrauch, Frank, 3186 Szabo, Gyongyi, 1243, 7686 Taylor, Mark J., 1068 Stumbles, Philip, 2609 Szeliga, Wojciech, 6730 Taylor, Philip R., 4975 Su, Chih-Hau, 4688 Szliter, Elizabeth A., 1105 Taylor, Rebekah T., 5659 Su, Grace L., 7902 Szodoray, Peter, 7511 Taylor, Simon R. J., 3474 Su, Houfen, 6912 Szomolanyi-Tsuda, Eva, 5124 Taylor, Stephen M., 641 Su, Kaihong, 3272, 6867 Tazzyman, Simon, 7405 Su, Shao-Bo, 5578 Tabarias, Hy, 4764 Tchepeleva, Svetlana N., 4667 Su, Song-Nan, 5237 Tabriz, Navid A., 5940 Tckacheva, Olga A., 7006 Suarez, Giovanni, 8097 Tachibana, Hirofumi, 4854 Teague, Brittany N., 7511 Subauste, Angela, 1645 Tadje, Janine, 4632 Teague, Ryan M., 6849 Subauste, Carlos S., 1645 Tagawa, Masatoshi, 5086 Tecle, Tesfaldet, 8046 Subbramanian, Ramu A., 3409 Taggart, Clifford C., 5871 Tedder, Thomas F., 291 Suciu, Dominic, 961 Tagoh, Hiromi, 5668 Tedesco, Francesco, 1312 Suciu-Foca, Nicole, 7432 Tahara, Hideaki, 7571 Teichberg, Vivian I., 683 Suda, Takashi, 3786 Tahara-Hanaoka, Satoko, 765 Teicher, Beverly A., 2883 Suda, Toshio, 103 Tahvanainen, Johanna, 3648 Teigen, Nickolas, 7658 Suda, Yasuo, 2610 Tai, Yu-Tzu, 7730 Teillet, Florence, 5710 Sudo, Katsuko, 3786 Taillardet, Morgan, 7779 Teja, Kabir, 6426 Sueblinvong, Viranuj, 8148 Tait, Lauren M., 211 Tellides, George, 592 Suetake, Hiroaki, 5682 Tajiri, Hisao, 613 ten Berge, Ineke J. M., 2612 Suetomi, Katsutoshi, 2923 Takagi, Katsumasa, 3777 Tenbrock, Klaus, 3198 Suffia, Isabelle, 4136 Takahashi, Kazue, 6514 ten Cate, Bram, 2287 Sugahara, Kunio, 3437 Takahashi, Munehisa, 2171 Teo, Pearline, 6242 Sugaya, Kaoru, 4926 Takahashi, Naoyuki, 192 Tesfaigzi, Yohannes, 8107 Sugimoto, Yukihiko, 7042 Takahashi, Satoru, 605 Tessarz, Anja S., 1991 Sugita, Sunao, 6994 Takahashi, Sentaro, 2923 Tesselaar, Kiki, 5762 Sugiyama, Fujimi, 2636 Takai, Toshiyuki, 480, 765, 4250 Teti, Giuseppe, 3126, 4417 Sugui, Janyce A., 6367 Takaki, Toshiyuki, 1415 Tetley, Teresa D., 463 Suguitan, Amorsolo L., Jr., 2770 Takase, Hiroshi, 6994 Teunissen, Marcel B. M., 1986 Sui, Ziye, 3226 Takatsu, Kiyoshi, 6058 Teyton, Luc, 1332 Sukkar, Maria, 7366 Takayama, Tadatoshi, 7571 Thaker, Harshwardhan M., 7432 Sullivan, Con, 4517 Takeda, Katsuyuki, 480, 1433 Thakker, Paresh, 2589 Sumitomo, Kenya, 4891 Takemoto, Clifford M., 378 Thalhamer, Josef, 3924 Sumiya, Michiko, 5116 Takenaka, Shunsuke, 7984 Thananchai, Hathairat, 33 Summerfield, John A., 5116 Takeshita, Fumihiko, 3186 Theander, Thor G., 428 Sumpter, Beth, 1680, 8002 Taketomi, Yoshitaka, 7042 Thelen, Marcus, 4373 Sun, Deming, 474 Takeya, Motohiro, 8183 Theodoridis, Alexandros A., 5454 Sun, Jessica, 8183 Takiguchi, Masafumi, 5513 Theofilopoulos, Argyrios N., 5366, 8195 Sun, Jie, 1635 Takihara, Takahisa, 489 Theurl, Milan, 1748 Sun, Rui, 4548 Takizawa, Takenori, 2448 Thiel, Andreas, 4947 Sun, Shaoli, 3219 Takubo, Keiyo, 103 Thiel, Martina, 7623 Sun, Weimin, 6700 Talbot, Brian G., 2171 Thiel, Steffen, 3016, 5710 Sun, Wensheng, 503 Talvensaari, Kimmo, 1208 Thielemans, Kris, 1301, 7703 Sun, Yee-Ping, 3912 Tamassia, Nicola, 1312, 7325, 7344 Thielens, Nicole M., 5710 Sun, Zhaojun, 7703 Tamayo, Esther, 2778 Thiruudaian, Vasuky, 4395 Sun, Zhen-Yu J., 3668 Tan, Jamie W., 2794 Thomas, James W., 5643 Sun, Zuoming, 312 Tan, Xiaoxio, 6849 Thomas, Lisa S., 4033 Sunaga, Kohei, 7042 Tan, Yanping, 3447 Thomas, Matthew J., 4771 Sung, Sun-sang J., 1251, 1882, 5899 Tanaka, Kazuo, 5209 Thomas, Paul G., 2737, 3091 Suo, Zhiyong, 1059 Tanaka, Masato, 5001 Thomas, Sunil, 5802 Suratt, Benjamin T., 8148 Tanaka, Satoshi, 7042 Thomas, Venetta, 970 Suresh, Madathilparambil V., 1158 Tanaka, Shinya, 262 Thomas, Wayne R., 2794 Suri, Anish, 6051 Tanaka, Toshiyuki, 2499 Thomas-Rudolph, Deirdre, 7283 Suscovich, Todd J., 7658 Tanchot, Corinne, 7550 Thome, Margot, 4373 Sutherland, Duncan B., 2370 Tang, Daolin, 7376 Thompson, Katherine S., 6387 Sutherland, Jayne S., 7473 Tang, Jun, 5578 Thomsen, Allan Randrup, 1662 Sutter, Gerd, 5839 Tang, Xiaolei, 6043 Thomson, Angus W., 7018 Suttles, Jill, 1357 Taniguchi, Masaru, 2853 Thorley, Andrew J., 463 Suzuki, Akane, 4926 Tanimoto, Mitsune, 480 Thornton, Mark, 6642 Suzuki, Harumi, 1349 Tannenbaum, Charles S., 2278, 6642 Thurman, Joshua M., 1819, 6514 Suzuki, Hideaki, 6058 Tao, Jian, 2730 Tian, Zhigang, 2141, 4548 Suzuki, Motohiko, 5480 Taparowsky, Elizabeth J., 58 Ticchioni, Michel, 5930 Suzuki, Nobutaka, 6715 Tapping, Richard I., 6387, 7520 Tighe, Mike, 1059 Suzuki, Shinobu, 6715 Targan, Stephan R., 3293, 4033, 5524 Tilanus, Hugo W., 6066 Suzuki, Takashi, 5086 Tarilonte, Leticia, 2249 Tilg, Herbert, 1748 Suzuki, Toshihiko, 2476 Tarleton, Christy A., 4584 Tili, Esmerina G., 5443 Suzuki, Yusuke, 489 Tarlinton, David M., 4104, 4764 Till, Andreas, 8203 AUTHOR INDEX 8253

Tilley, Stephen L., 3208 Tse, Hubert M., 908 van der Poll, Tom, 993, 1845 Tilson, M. David, 5329 Tsichlis, Philip N., 5443 Van der Put, Elaine, 3521 Tinazzi, Ilaria, 7325 Tsing, Stan, 2641 Van der Veen, Annemarthe G., 7199 Ting, Adrian T., 7767 Tsokos, George C., 1938, 1960 van der Voort, Ellen I. H., 7581 Ting, Jenny P-Y., 1256 Tsoukatou, Debbie, 6735 van Driel, Ian R., 4089 Tippett, Emma, 6581 Tsubata, Takeshi, 2901 van Duin, David, 970 Tirosh, Boaz, 2192 Tsuboi, Shigeru, 2987 van Endert, Peter, 2241, 7458 Tisch, Roland, 1388 Tsubouchi, Yasunori, 3316 van Faassen, Henk, 2396 Tiwari, Neeraj, 7932 Tsuchiya, Kiichiro, 4737, 4937 van Griensven, Martijn, 5940 Tjoe, Kartono H., 7473 Tsuchiyama, Tomoya, 574 Vanhaesebroeck, Bart, 2328 Tobias, Peter S., 6252 Tsujita, Tadayuki, 397 van Hall, Thorbald, 657 Todorov, Ivan, 838 Tu, Powen, 6191 van Hateren, Andrew, 5744 Toellner, Kai-Michael, 6200 Tucker, M. Jane, 5533 Van Hove, Chris L., 7501 Toes, Rene´ E. M., 7581 Tugores, Antonio, 8053 Van Keulen, Virginia P., 1426, 3583 Togni, Mauro, 4632 Tull, Dedreia, 4956 van Kooten, Cees, 7581 Tokmoulina, Gouzel, 7822 Tuma, Ronald, 8138 van Kooten, Peter, 6894 Tokunaga, Daisaku, 3316 Tung, Kenneth, 1938, 7173 Vanlaere, Ineke, 5069 Tolosa, Eva, 5465 Tuomela, Soile, 3648 van Leeuwen, Ester M. M., 2612 Tomai, Mark, 6208 Tuovinen, Heli, 1208 van Lier, Rene´ A. W., 652, 2612 Tomasec, Peter, 4473 Turka, Laurence A., 7503 van Lint, Philippe, 5069 Tomasello, Francesco, 3126 Turley, Danielle M., 2212 van Montfoort, Nadine, 7581 Tomizawa, Takeshi, 6164 Turner, Louise, 428 van Montfort, Thijs, 3177 Tommasino, Massimo, 3186 Turner, Martin, 1981 van Oers, Nicolai S. C., 4120 Toniato, Elena, 720 Turner, Michael S., 2787 VanOosten, Rebecca L., 2679 Topham, David J., 4506 Turner, Stephen J., 1285, 2370, 7616 van Oosterhout, Antoon J. M., 7678 Topp, Max S., 5465 Turnquist, He៮th R., 7018 van Putten, Jos P. M., 7110 Torgler, Ralph, 7054 Turza, Nadine M., 5454 van Rooijen, Nico, 4557 Torigoe, Chikako, 3530 Van Roy, Frans, 5069 Torii, Akira, 613 Uchida, Takefumi, 3886 Van Roy, Maarten, 5069 Torrealba, Jose R., 3983 Udagawa, Nobuyuki, 192 van Spriel, Annemiek B., 154 Toscano, Marta A., 436 Udey, Mark C., 7251 van Wijk, Femke, 6894 Toshchakov, Vladimir Y., 2655 Ueda, Yoshihiro, 3593 van Zoelen, Marieke A. D., 1845 Tosti, Claudio, 5957 Uede, Toshimitsu, 6567 Vareille, Marjolaine, 8168 Totsuka, Naoya, 765 Uematsu, Satoshi, 2182, 4717 Varol, Chen, 2000 Totsuka, Teruji, 4737, 4937 Uemura, Yasushi, 918 Vaudry, Hubert, 3323 Tough, David F., 4184 Ueno, Aito, 2755 Veas, Francisco, 407 Touma, Maki, 3668 Ueno, Takamasa, 5513 Vecchi, Annunciata, 6616, 7325 Tourkova, Irina L., 7787 Ueno, Tomoo, 4956 Veckman, Ville, 253 Tournier, Jean-Nicolas, 7994 Uhrberg, Markus, 3918 Vega, Jose, 6994 Tournoy, Kurt G., 7501 Umemura, Masayuki, 3786 Vela, Jose´ Luis, 6332 Tourtellotte, Warren G., 3038, 6796 Umland, Oliver, 4147 Velededeoglu, Ergun, 6028 Toussaint, Yann, 5571 Unanue, Emil R., 122, 6051 Veler, Haviva, 3627 Touvrey, Ce´dric, 4112 Underhill, David M., 3107, 4250 Vella, Anthony T., 3219, 4194 Towne, Charles F., 6923 Unutmaz, Derya, 5668 Vellenga, Edo, 7678 Toyama, Yoichi, 613 Uqoezwa, Mweia, 3511 Venereau, Emilie, 4615 Toyama-Sorimachi, Noriko, 5296 Urizar, Eneko, 1450 Venkataraman, Gopalakrishnan M., 961 Toyka, Klaus V., 1372 Urlaub, Doris, 5606 Venkataraman, Thiagarajan, 2429, 6444 Trabattoni, Daria, 407, 1931 Usherwood, Edward J., 5227 Ventura, Florence L., 3265 Tracey, Kevin J., 3856, 6573 Usmani, Omar S., 2491 Venturi, Guglielmo M., 291 Traidl-Hoffmann, Claudia, 7623 Utermo¨hlen, Olaf, 3390 Venzon, David, 3492 Tran, Hung, 817 Uto, Tomofumi, 2979 Verbeek, J. Sjef, 530, 7581, 7587 Trapnell, Bruce C., 2440 Uyttenhove, Catherine, 6761 Verdaguer, Joan, 6533 Trautmann, Lydie, 788 Verdino, Petra, 6290 Traversari, Catia, 2617 Vaccari, Monica, 3492 Vergnon, Isabelle, 6821 Tremblay, Michel J., 2862, 8036 Vacek, Pamela, 1800 Verjans, Georges M. G. M., 3551 Treml, Laura S., 7531 Vaeremans, Elsy, 1301 Verkoczy, Laurent, 6332 Triantafilou, Kathy, 4811 Vainberg, Mitchell G., 2932 Vermaelen, Karim V., 5305 Triantafilou, Martha, 4811 Valdes, Maikel, 6444 Vermijlen, David, 4304 Trichel, Anita, 6958 Valdez, Patricia A., 2229 Verrier, Bernard, 7994 Tridandapani, Susheela, 4445 Valencia, Xavier, 2579 Verthelyi, Daniela, 39 Triebel, Fre´de´ric, 4184 Valent, Peter, 6290 Vestergaard, Lasse S., 428 Trieu-Cuot, Patrick, 1379 Valenta, Rudolf, 3924, 6290 Vezys, Vaiva, 7267 Trigilio, James, 1164 Valentine, Catherine, 1164 Via, Charles S., 95, 3962 Trimble, William S., 5769 Valentine, William J., 986 Victorino, Rui M. M., 3252 Trinchieri, Giorgio, 3 Valenzuela-Ferna´ndez, Agustı´n, 8053 Vidal, Dominique, 7994 Trindade, Christopher J., 3492 Valiante, Nicholas M., 2688 Vidal, Silvia M., 369 Tripathi, Pulak, 4027 Vallon-Eberhard, Alexandra, 7994 Vieira, Marta, 1379 Trottein, Franc¸ois, 7607 van Aubel, Re´mon A. M. H., 7110 Viemann, Dorothee, 3198 Trouche, Nathalie, 6700 VanBuskirk, Anne M., 3983 Viga´rio, Ana Margarida, 6416 Trucco, Massimo, 908, 4260 VanCompernolle, Scott E., 5668 Vignali, Dario A. A., 4214 Trunkle, Theresa, 1059 Vandenabeele, Peter, 8022 Vilain, Nathalie, 6746 Truong, Nga, 2961 van den Brink, Marcel R. M., 7473 Vilanova, Manuel, 1379 Truscott, Steven M., 6280 Van den Eynde, Benoıˆt J., 2617, 6761 Vilches, Carlos, 4402 Trushin, Sergey A., 4846 van den Pangaart, Petra S., 1845 Vilen, Barbara J., 4803 Tryggvason, Karl, 5912 van der Aar, Angelic M. G., 1986 Villadangos, Jose A., 2094 Tryniszewska, Elzbieta, 3492 van der Bruggen, Pierre, 2617, 7703 Villamor, Neus, 1923 Tsai, Chung-Wei, 3023 van der Laan, Luc J. W., 6066 Villarroya, Francesc, 6130 Tsai, Wen-Po, 3492 van der Loo, Johannes C. M., 2440 Villasen˜or, Armando G., 2641 8254 AUTHOR INDEX

Villinger, Francois, 3492, 7720 Wang, Jing, 6028 Wei, Zheng, 7395 Vincent, Isabelle, 3186 Wang, John, 5357 Weigt, Samuel, 511 Vinet, Heather C., 3409 Wang, Juhua, 2018 Weiler, Sandra, 1991 Viney, Joanne L., 1523 Wang, Jun, 7097 Weilguny, Dietmar, 5710 Vitale, Laura A., 6259 Wang, Junmei, 6777 Weinberg, Andrew D., 7694 Vitale, Marco, 4011 Wang, Kangkai, 7376 Weinberger, Birgit, 2611 Vitour, Damien, 3368 Wang, Min, 4811 Weiner, Howard L., 172, 179, 4017 Vivar, Nancy, 5340 Wang, Minhui, 3116 Weinstein, Arthur, 1960 Vives-Pi, Marta, 6533 Wang, Ping, 3856 Weis, Janis J., 7139 Vlad, George, 7432 Wang, Pu, 2018 Weis, John H., 7139 Vladau, Costin, 5480 Wang, Shengdian, 6634 Weiss, Daniel J., 8148 Vlahakis, Stacey R., 4846 Wang, Shiyong, 3116 Weiss, Siegfried, 6941 Vocanson, Marc, 5571 Wang, Shuhe, 1048 Weiss, Stephanie, 953 Vockley, Jerry, 3702 Wang, Stewart C., 7902 Wekerle, Thomas, 3924 Vodovotz, Yoram, 6573 Wang, Tao, 4260 Welsh, Raymond M., 5124 Voermans, Carlijn, 3511 Wang, Wei, 6968, 7072 Welte, Tobias, 5828 Vogel, Stefanie N., 2655, 3602 Wang, Wengang, 4885 Wen, Renren, 49 Vogel, Ulrich, 4489 Wang, Xianxi, 5312 Werner-Klein, Melanie, 7738 Vogt, Peter M., 7902 Wang, Xiaohua, 6181 Wernet, Peter, 3918 Vogtenhuber, Christine, 280 Wang, Xiaoyun, 8158 Wessendarp, Matthew, 1645 Voleti, Bhavya, 7302 Wang, Xin, 2979 West, Sadie M., 3492 Volk, Hans-Dieter, 5973 Wang, Xingyu, 6770, 6777 Westfall, Margaret V., 7902 Volpe, Elisabetta, 3373 Wang, Xi-Tao, 6259 Wettstein, Peter J., 2950 Volsky, David J., 869 Wang, Xiuyan, 6770 Whalen, Mary S., 7442 von Aulock, Sonja, 2610 Wang, Yaming, 1388 White, Cara, 6975 von Garnier, Christophe, 2609 Wang, Ying, 1938, 1960 White, Hilary, 2527 von Hundelshausen, Philipp, 8064 Wang, Yu, 7395 White, Mitchell R., 8046 von Stebut, Esther, 7251 Wang, Yue, 3483 Whiteside, Theresa L., 320 von Wasielewski, Reinhard, 1573 Wang, Yufei, 1671 Whittaker, Laurie A., 7064 Vorup-Jensen, Thomas, 3016 Wang, Zhiliang, 7018 Whittall, Trevor, 1671 Vos, Johanna C. M., 1405 Wang, Zhuangzhi, 6148 Wick, Mary Jo, 5789 Vray, Bernard, 6700 Ward, E. Sally, 134 Wieckowski, Se´bastien, 6700 Vukmanovic´, Stanislav, 6109, 7814 Ward, Peter A., 5940, 7902 Wiehagen, Karla R., 3583 Vukmanovic-Stejic, Milica, 6689 Ward, Richard A., 2421 Wielockx, Ben, 5069 Vuk-Pavlovic, Zvezdana, 2950 Warnier, Guy, 3244, 6761 Wiens, Gregory D., 7955 Vulcano, Marisa, 145 Warren, Bryan F., 2908 Wiertz, Emmanuel J. H. J., 657 Vyas, Jatin M., 7199 Warren, H. Shaw, 1164 Wiest, David L., 5443, 6796 Vyse, Timothy J., 2352 Warren, Sarah, 4846 Wiethe, Carsten, 4908 Waruk, Jillian L. M., 3750 Wigglesworth, Kim, 4676 Wachihi, Charles, 3750 Watanabe, Hiroyuki, 3777 Wilcock, Louisa K., 4658 Wada, Makoto, 3316 Watanabe, Hisami, 3786 Wild, Martha A., 5595 Wagemaker, Gerard, 3551 Watanabe, Ikuko, 4917 Wilder, Tuere, 7747 Wagner, Claudia S., 3536 Watanabe, Mamoru, 4737, 4937 Wiles, Michael V., 5744 Wagner, Gerhard, 3668 Watanabe, Masaki, 5888 Wilflingseder, Doris, 7840 Wagner, Oswald, 5921 Watanabe, Michiaki, 613 Wilkinson, Gavin W. G., 4473 Wahl, Christian, 2083 Watanabe, Norihiko, 6720 Wilkinson, Katalin A., 7190 Waiboci, Lilian W., 5058 Watanabe, Takeshi, 2794 Wilkinson, Robert J., 7190 Wajjwalku, Worawidh, 3806 Watanabe, Tomohiro, 5859 Wille, Lucia, 4984 Wakaki, Misa, 489 Watanabe, Yoshiteru, 1767 Willems, Fabienne, 7607 Walker, Juliette C., 4147 Waterfield, J. Douglas, 6616 Williams, Bryan R. G., 5166 Walker, Lisa P., 5099 Watkin, Levi B., 6923 Williams, Calvin B., 2961 Walker, Samantha M., 4658 Watkins, David I., 2746 Williams, Cortny A., 7694 Waller, Anna, 6828 Watkins, Simon C., 3400 Williams, David A., 5277 Wallet, Mark A., 1388 Watkins, Stephanie K., 1357 Williams, David L., 7317 Wallich, Reinhard, 7292 Watry, Debbie, 5812 Williams, Ifor R., 5659 Walport, Mark J., 2352, 2916 Watson, Susan R., 6806 Williams, Kristi L., 1256 Walsh, Caitriona M., 4557 Watzl, Carsten, 5606 Williams, Lynn M., 4779 Walsh, Meghan, 2249 Waxman, Stephen G., 7822 Williams, Michael J., 4711 Walter, Lisa, 6038 Way, Sing Sing, 3695, 4498, 4731 Williams, Roger, 1914 Walter, Lutz, 7151 Webb, Andrew C., 5413 Willimann, Katharina, 4304 Walters, Nancy, 1059 Webb, Carol F., 2996 Willis, Lucy M., 7473 Wan, Bing, 4709 Webb, Dianne C., 219 Wils, Evert-Jan, 3551 Wan, Meimei, 652 Webby, Richard J., 3091 Wilson, Anne, 6746 Wan, Ni, 4260 Weber, Christian, 8064 Wilson, Bridget, 4584, 8107 Wan, Suigui, 271 Weber, Joerg R., 6476 Wilson, Christopher B., 3695, 4731 Wan, Yonghong, 936 Weber, Patrick, 6320 Wilson, Justin E., 2065 Wang, Chrong-Reen, 4688 Webster, David, 7710 Wilson, Mark A., 6573 Wang, Demin, 49, 5496 Webster, Steve, 7405 Wilson, Nancy A., 2746 Wang, Eddie C. Y., 4473 Wegiel, Barbara, 5921 Wilson, Nicholas S., 2094 Wang, Emilie-Jeanne, 6770 Wegmann, Michael, 7805 Wilson, Patrick C., 7511 Wang, Fu-Sheng, 6634 Wehrens, Ellen J. M., 6894 Wilson, Robert, 8212 Wang, Gang, 1534 Wehrmann, Manfred, 8127 Wilton, Rosemarie, 2483 Wang, Haichao, 3856, 7376 Wei, Chungwen, 6624 Winchester, Robert, 1227, 5329 Wang, Hongwei, 2609 Wei, Haiming, 2141, 4548 Winer, Jane, 2229 Wang, Huiying, 7879 Wei, Lai, 986 Wines, Bruce D., 1096 Wang, Jennifer P., 3363, 5173 Wei, Ping, 7325 Winslow, Gary, 976 Wang, Jianhua, 6867 Wei, Sheng, 7787 Winslow, Monte M., 4315 Wang, Ji Ming, 1450, 1759 Wei, Shuang, 6730 Winston, John, 8097 AUTHOR INDEX 8255

Winter, Christine, 5828 Yadav, Deepak, 6236 Yoshida, Seiya, 613 Winter, Michael C., 6395 Yadav, Satya, 2038 Yoshikai, Yasunobu, 757, 3806, 4466, 4482 Winter, Ulrike, 8064 Yagita, Hideo, 652, 1564, 2272, 5227 Yoshikawa, Toshikazu, 3316 Wirtz, Stefan, 3427 Yahagi, Ayano, 3786 Yoshimoto, Takayuki, 7251 Wiseman, Jeremy C. D., 6456 Yajima, Toshiki, 757, 3806, 4482 Yoshimura, Teizo, 2171 Wither, Joan E., 1608 Yamada, Akiko, 605 Younes, Souheil-Antoine, 788 Withers, David, 2872 Yamada, Hisakata, 757, 3806, 4466, 4482 Young, Alan, 463 Withoff, Sebo, 2287 Yamada, Koji, 4854 Young, Cheryl A., 5859 Witkowski, Jacek M., 771 Yamagami, Satoru, 3288 Young, Deborah A., 3822 Witte, Ellen, 5973 Yamaguchi, Kazuhiro, 489 Young, Neal S., 4159 Wittig, Bianca Maria, 5973 Yamaguchi, Tomoko, 1767 Young, Scott K., 3153 Wodrich, Maren, 6023 Yamamoto, Kenji, 5296 Youssef, Lama A., 4584 Wohlfert, Elizabeth A., 4129 Yamamoto, Masafumi, 4937 Yssel, Hans, 407, 4615 Woisetschla¨ger, Maximilian, 4335 Yamamoto, Masahiro, 3153, 3170 Yu, Aixin, 4062 Wojciechowski, Jason, 5717 Yamamoto, Yohei, 192 Yu, Chia-Hsien, 5237 Wo¨lbing, Florian, 7251 Yamamura, Takashi, 7525 Yu, Guowu, 5643 Wolff, Sheldon M., 5413 Yamashita, Masakatsu, 4926 Yu, Qi T., 3293, 4033 Wolk, Kerstin, 5973 Yamashita, Shizuya, 4854 Yu, Qing, 4901, 5028 Wollenberg, Kurt, 6590 Yamashita, Teruhito, 192 Yu, Shaohua, 6867 Wolpl, Alois, 2262 Yamaya, Mutsuo, 489, 5086 Yu, Shuang, 2469 Yuan, Chong, 5366 Woltring, Donna, 7097 Yan, Ming, 5769 Yuan, Jing, 172, 179 Womer, Karl L., 5419 Yanaga, Katsuhiko, 613 Yanagawa, Yoshiki, 6173 Yuan, Xiaoning, 1450 Wong, Carmen P., 1388 Yanagi, Yusuke, 817 Yue, Wen, 2737, 3091 Wong, Jamie, 7032 Yanagisawa, Satoru, 613 Yull, Fiona E., 6504 Wong, Kok Loon, 4771 Yanagiya, Kazuyo, 7162 Yusuf, Isharat, 817 Wong, Larry Y., 2883 Yanai, Mitsuru, 1189 Wong, Maida, 7649 Yang, Cheng-De, 5351 Zabel, Brian A., 3713 Wong, Min-Hui, 5200 Yang, Chuan He, 986 Zack, Jerome A., 3492 Woodgett, James R., 2932 Yang, De, 2171 Zafari, Mohammad, 2249 Woodland, David L., 1030, 1692, 4721 Yang, Feng-Chun, 2527 Zafer, Ahmed, 2396 Woodward, Emily J., 5643 Yang, Hengxuan, 3272 Zahn, Nadine, 2458 Woolard, Matthew D., 2065 Yang, Huan, 3856, 6573 Zahn, Sabine, 7251 Workman, Jennifer, 2996 Yang, Jianying, 262, 280 Zahorchak, Alan F., 7018 Worthen, G. Scott, 3153 Yang, Jinming, 5480 Za¨hringer, Ulrich, 2803 Woszczek, Grzegorz, 5262 Yang, Kaiyong, 3593 Zaiss, Dietmar M. W., 7557 Woulfe, Susan, 3886 Yang, Lihong, 3856 Zaloudik, Jan, 6789 Wouters, Emiel F. M., 3814 Yang, Lin, 5879 Zamai, Loris, 4011 Wrann, Christiane D., 5940 Yang, Otto O., 2746, 7756 Zamlynny, Beata, 5192 Wrenger, Sabine, 4632 Yang, PingAr, 5357 Zander, Thomas, 6931 Wright, Mark D., 154 Yang, Wen-Chin, 6984 Zandonatti, Michelle, 5812 Wu, Bo, 3688 Yang, Xi, 1048, 7859 Zanobbio, Laura, 4296 Wu, Chao-Liang, 4688 Yang, Ximing, 2883 Zanzinger, Kai, 1991 Wu, Dayang, 5595 Yang, Xinghong, 1059 Zapata-Gonzalez, Fernando, 6130 Wu, Dayong, 1443 Yang, Yang, 2755, 3661 Zarek, Paul E., 2163 Wu, Henry D., 5329 Yang, Yiping, 3505 Zarember, Kol A., 6367 Wu, Jianfeng, 2229 Yang, Ziyan, 1077 Zavitz, Caleb C. J., 936 Wu, Jianming, 3973 Yarboro, Cheryl, 2579 Zegarra-Moran, Olga, 5144 Wu, Judy, 3511 Yarilina, Anna, 2204 Zeller, Sabine, 389 Wu, Qi, 5357 Yarlett, Nuriza C., 2344 Zemlin, Cosima, 1180 Wu, Rongqian, 3856 Yassine-Diab, Bader, 788 Zemlin, Michael, 1180 Wu, Yalei, 5357 Yasuda, Kei, 6876 Zemski-Berry, Karin, 6540 Wuelfing, Christoph, 4120 Yasuhara, Masato, 5296 Zen, Ke, 2483 Wurbel, Marc-Andre´, 3358, 7598 Yawata, Makoto, 33, 7943 Zeng, Defu, 838 Wynne, Kieran J., 4595 Yawata, Nobuyo, 33 Zeng, Hu, 49 Wysocki, Lawrence J., 5035 Yazdanpanah, Benjamin, 3390 Zerafa, Nadeen, 7540 Ye, Alice L., 2104 Zernetkina, Valentina, 3962 Ye, Jian, 5982 Zganiacz, Anna, 2387 Xia, Changqing, 271 Ye, Richard D., 416 Zhang, Benyue, 4194 Xiang, Jialing, 8107 Yegin, Olcay, 7520 Zhang, Buyi, 6297 Xiao, Weimin, 7376 Yeh, Wen-Chen, 2272 Zhang, Chunyan, 838 Xiao, Xianzhong, 7376 Yen, Jui-Hung, 8138 Zhang, Hong, 3874 Xiao, Yuanyuan, 1457 Yeung, Mandy, 7632 Zhang, Huang-Ge, 6867 Xie, Fenglong, 3973 Yi, Bing, 7173 Zhang, Hui-Fen, 6259 Xie, Jenny X., 693 Yi, Woelsung, 1488 Zhang, Huiming, 1542 Xie, Shaoping, 7366 Yin, Zhinan, 2730 Zhang, Jingwu Z., 4709 Xin, Yao, 2491 Yo, Yi-Te, 4688 Zhang, Jiyuan, 6634 Xing, Zhou, 2387, 7984 Yoh, Keigyou, 605 Zhang, Juan, 926 Xu, Jiayong, 1723, 7222 Yokoi, Toyoharu, 360 Zhang, Liming, 6867 Xu, Jihong, 1904 Yokoo, Seiichi, 3288 Zhang, Lingzhi, 1759 Xu, LiLi, 6725 Yokota, Sandra J., 5552 Zhang, Lining, 503 Xu, Qilong, 5109 Yolcu, Esma S., 6840 Zhang, Manling, 3483 Xu, Qin, 1783 Yongvanichit, Kosol, 1151 Zhang, Ming, 1523, 8138 Xu, Qingyong, 3983 Yonkers, Nicole L., 4436 Zhang, Ping, 474 Xu, Sailong, 3016 Yoon, Ho Joo, 1948 Zhang, Qiang, 2883 Xue, Liquan, 49 York, Ian A., 6923 Zhang, Qing-Yin, 7432 Xue, Xin, 2272 Yoshida, Hisahiro, 2272 Zhang, Qingzhao, 7511 Xue, Ying Ying, 511 Yoshida, Kazuhiko, 6567 Zhang, Qiu, 503 8256 AUTHOR INDEX

Zhang, Tian Y., 2517 Zheng, Xiufen, 5480 Ziegler, Steven, 1396 Zhang, Tong, 6140 Zheng, Yan, 2163 Ziegler-Heitbrock, Loems, 4779 Zhang, Weiguo, 4230 Zheng, Ye, 6777 Zilian, Olav, 6746 Zhang, Xia, 1077 Zheng, Yi, 986 Zillikens, Detlef, 6514 Zhang, Xiaohai, 7911 Zhong, Fiona, 2229 Zimmerer, Jason M., 4832 Zhang, Xiaoling, 5277 Zhong, Robert, 5480 Zinkernagel, Annelies S., 7516 Zhang, Xizhong, 2387 Zhou, Bin, 5588 Zipfel, Peter F., 5848, 7292 Zhang, Xusheng, 5480 Zhou, Gang, 2155 Zippelius, Alfred, 320, 4112 Zhang, Yan, 7173 Zhou, Jian, 1819 Zipris, Danny, 693 Zhang, Yiping, 557 Zhou, Lu, 5496 Zisman, David A., 511 Zhang, Yixia, 5390 Zhou, Meixia, 5496 Zisoulis, Dimitrios G., 4901 Zhang, Yuanyuan, 4194 Zhou, Penghui, 1542 Zitt, Christof, 4820 Zhang, Zheng, 6634 Zhou, Qing, 5753 Ziv, Omer, 2307 Zhang, Zhidong, 6634 Zhou, Rongbin, 2141, 4548 Zhang, Zhu-Xu, 5480 Zhou, Shenghua, 5173 Zong, Lili, 944 Zhao, Xiaojian, 2469 Zhou, Tong, 3272 Zou, Jian-Ping, 5366 Zheng, Biao, 5010 Zhou, Weisong, 702, 2651 Zou, Linhua, 6730 Zheng, Bo, 6624 Zhu, Jiangao, 3505 Zou, Weiping, 4706, 6730 Zheng, Guoxing, 3301 Zhu, Qing, 7211 Zozulya, Alla L., 520 Zheng, Lingjie, 1251 Zhu, Ren, 5435 Zudaire, Enrique, 3602 Zheng, Mingquan, 3702 Zhu, Wei, 5578 Zufferey, Madeleine, 6677 Zheng, Pan, 1542 Zhu, Zhou, 5375 Zullo, Alfred J., 58 Zheng, Song Guo, 2018 Zhuang, Yuan, 5717 Zummo, Sebastiana, 3126 Zheng, Wei-Peng, 7173 Zidanic, Michael, 1938 Zwartz, Gordon J., 6828 SUBJECT INDEX TO VOLUME 178

␣ ␤ A3G, CCR5 and CD40 stimulation up-regu- Adhesion, integrin 4 1 regulates cell adhe- inhibited in Smad 3-deficient mouse, 7310 lates expression of, DCs and CD4 sion by affinity and conformational Airway smooth muscle, SAg presentation by, T cells, 1671 unbending, 6828 to CD4 T cells elicits proasthmatic Abortions, spontaneous, CD4CD25 T cell Adipocytokines, visfatin, proinflammatory changes, 3627 and FOXP3 Treg cell expansion and immunomodulating properties, Akt during follicular phase of menstrual 1748 decreased phosphorylation of, telomerase cycle, 2572 Adiponectin, as growth factor, hemopoietic activity loss and, CD8 T cells, N-Acetylcysteine, ICAM-1 induction by stem cells, 3511 7710 mito-Q and, via glutathione, 1835 Adoptive immunity in glucocorticoid conditioning of myeloid Acetyltransferase, p300, activity suppresses in innate defense and adoptive immunity, progenitors, 2517 SLE-like disease, mouse, 6941 psoriasis, 2229 isoforms of, in DN to DP thymocyte tran- Actin insect baculoviruses potentiate mammalian sitions, 5443 Bcl10 controls TCR- and Fc␥R-induced immune responses via type I IFN, Alcohol, exerts anti-inflammatory effects via polymerization, 4373 2361 IKK inhibition and p65 phosphory- cytoskeletal protein transformation, HIV-1- ␤1-Adrenergic receptors, impair immune cell lation, monocytes, 7686 infected multinucleated giant cells, innate responses to L. monocyto- Alefacept, signaling in leukocytes of psoria- 6404 genes, 4876 sis patients, 7442 F-Actin, Cdc42 inactivation required for pha- AFC. see Antibody-forming cells ALI. see Acute lung injury - gosomal maturation and depoly- Agammaglobulinemia, reduction of B220 Allergen immunotherapy, grass pollen, IgA2 -/-␮ -/- ␤ merization of, neutrophils, 7357 CD138 plasma cells, AID s and mucosal TGF- responses, Activated T cell death, unrestrained GSK-3␤ agammaglobulinemic mice, 2192 4658 activity causes, 6083 Age/aging Allergens Activation-induced cell death, tumor-medi- Ag unresponsiveness in, CD4 RTE, aged airway remodeling induced by, inhibited in ated, CD5 protects tumor Ag-spe- mouse, 1321 Smad 3-deficient mouse, 7310 cific T cells from, 6821 aged B cell precursors, E47 degradation peanut, CD28/CTLA-4-B7 pathway in sen- Activation-induced deaminase associated with ERK MAPK acti- sitization and tolerance induction, expression and autoantibody production, B vation, 3521 6894 cells, 5357 defects in TLR1 and TLR2 associated pollen immunomodulatory mediators en- with, 970 hance DC migratory capacity, 7623 immature/transitional 1 B cell expression ␥ of, 3593 normal and RA-related, Klotho in, normal ROR controls Ig and cytokine produc- mouse deficient in, lupus nephritis abroga- and RA, 771 tion in adaptive immune response PI3K in innate immune functioning of to, 3208 tion, 7422 DCs, elderly humans, 6912 Allergic airway disease, catalase overexpres- Activator protein 1 vitamin E reverses age-associated decline sion and attenuation of, 3814 BATF and, in NKT cell maturation, thy- in CD4 T cell IS formation, 1443 Allergic airway inflammation mus, 58 Age-related macular degeneration, wet-type, CCR2 mediates increase in pulmonary controlled by BCR via Ras-mediated Ral CD59 controls CNV, mouse, 1783 DCs, 5305 activation, 1405 AHR. see Airway hyperresponsiveness SR-AI/II and MARCO limit DC migration Fc⑀ R-induced, Bcl10 essential for, mast AID. see Activation-induced deaminase and, 5912 cells, 49 AIDS. see also HIV Allergies SDF-1 stimulates IL-10 secretion via, 1581 pathogenesis of, implications from CD4 T airway epithelial STAT3 required for in- Acute lung injury cell homeostasis during infection, flammation, mouse asthma model, CD73 and CD39 in innate protection, 8127 sooty mangabeys, 1680 6191 SDF-1 and neutrophil recruitment, 8148 SIV, loss of myeloid and plasmacytoid costimulation blockade inhibits sensitiza- AD. see Atopic dermatitis DCs, macaques, 6958 tion, grass pollen allergy model, ADAM8, expression and effect on L-selectin Aire gene 3924 shedding, neutrophils, 8053 controls genes for epithelial function, thy- effect of UVB and histamine receptor ADAM9, role in granuloma/macrophage fu- mus, 7173 function on responses to Inhaled sion induced by mycobacterial lipo- role in epithelial differentiation, thymus, antigens, 2794 mannan, 3161 3007 fish, parvalbumin hypoallergenic mutant ADAM10, shedding of CXCL1 and AIRID. see Airway inflammation-related in- for IgE-mediated immunotherapy, CXCL16, detachment of adherent hibition of disease 6290 leukocytes facilitated by disintegrin Airway epithelial cells impaired mast cell maturation and allergic and, 8064 control inflammation via NF-␬B pathway, responses, Ndrg1-deficient mouse, ␣ ADAM17. see TNF- -converting enzyme 6504 7042 Adenosine, in inflammation response, macro- IL-8 induced by Pen c 13 via PAR-1 and inflammation in, effects of immunotherapy phages, 5921 PAR-2, 5237 on B7 family in, 1931 Adenosine 2A receptors paracellular permeability restricts re- Alloantigens, A2AR activation attenuates al- activation attenuates allograft rejection, sponses, 6395 lograft rejection, 4240 4240 Airway hyperresponsiveness Allograft inflammatory factor-1, in pathogen- in inflammation response, macrophages, allergen-induced, roles of FcR␥ on APCs, esis of RA, 3316 5921 480 Allophenic mice, intrinsic immune tolerance Adenoviruses CD4CD25 T cell regulation of allergic in, Pillars of Immunology, 4007 directed to lysosomes by PU.1, alveolar responses via IL-10 induction of ␣-Fetoprotein, CD4 T cells specific for, re- macrophages, 2440 TGF-␤, lung, 1433 sponses in HCC patients undergo- fiber-modified, decrease liver toxicity via dampened by PD1, asthma, 496 ing embolization, 1914 IL-6 reduction, 1767 Airway inflammation-related inhibition of Aluminum hydroxide adjuvants, activate IFN type I required for Ab response to, disease, novel pathway regulating caspase 1 and induce IL-1␤ and CD4 T cells and B cells, 3505 respiratory tract inflammatory dis- IL-18 release, 5271 P815, comparison of SFV, ALVAC vec- ease, 3846 ALVAC, P815, comparison of SFV, adenovi- tors and, in CTL responses to P815 Airway remodeling, allergen-induced rus vectors and, in CTL responses tumors, 6761 increased by ETS exposure, mouse, 5321 to P815 tumors, 6761 8258 SUBJECT INDEX ͓VOL. 178

AMD. see Age-related macular degeneration P. berghei-infected hepatocytes present protection by anti-sTNF-␣ vaccine without AMD3100, effect on bleomycin-induced pul- CSP to CD8 T cells, 7054 activating latent tuberculosis, 7450 monary fibrosis, mouse, 5888 SAg presentation by ASM to CD4 T cells rheumatoid, AIF-1 in pathogenesis, 3316 Amphiregulin, release of, MIP-3␣ mediates elicits proasthmatic changes, 3627 rheumatoid, autoantibodies specific for EGFR activation and ERK1/2 Antigen presenting cells determinants on IgG, Pillars of Im- MAPK signaling via, colonic epi- B7–2 regulates survival, phenotype, and munology, 1227 thelial cells, 8013 function, 6236 rheumatoid, high molecular weight protein Amyloid ␤, guanosine inhibits expression of, CD8 T cell conjugation with, increased by component in serum, 1229 microglia, 720 SHP-1 loss, 330 rheumatoid, IL-1␣ induced by 17␤ E2 in- ANA. see Anti-nuclear antigen FcR␥ on, role in allergen-induced AHR, duces via ER␣, Sp1 and dissociat- Anaplastic anemia, H60-mediated, amelio- 480 ing HDAC2 from ER␣, 3059 rated by Treg cell infusion, 4159 suppressive Treg cell mode via B7-H4 rheumatoid, KLOTHO gene in normal and Anergy induction via IL-10 on, letter, 4705 RA-related CD4 T cell aging, 771 effects of VEGF, Cav-1 and NO on, ECs, Antigen recognition rheumatoid, synovial T cell activation by 1505 CD1-restricted ␥␦ T cell recognition of soluble costimulatory molecules, T cell, predisposes to retinal autoimmu- lipid antigens, 3620 letter, 4708 nity, 4276 CD8 T cell recognition patterns of immu- rheumatoid, TNF-like cytokine production T cell, regulated by mTOR, 2163 nodominant CMV Ags, 4455 by IC-stimulated monocytes, 7325 T cell, role of PPAR-␥ in, 2122 cowpox virus evades CTL recognition, VEGF expression regulated by SAF-1, Angiogenesis 1654 1774 ␬ EPC recruitment and angiogenic switch Antigens ASC:CLR, POP modulates NF- B and dis- dependent on Th cells, asthma, density of, effector/memory T cell regula- rupts interactions of, 3837 6482 tory check point and, 2307 Aspergillus fumigatus, PMNs inhibit conidial nickel triggers inflammatory and proangio- inhaled, effect of UVB and histamine re- growth via lactoferrin-mediated genic gene expression via NF-␬B ceptor function on allergic re- iron depletion, 6367 and HIF-1␣, 3198 sponses, 2794 Asthma Angiopoietin 2, Tie-2 expression and, mono- processing rate determines immunogenicity allergic, inhibited by H4R activation-in- cytes, 7405 of immunoproteasome-generated duced Foxp3 T cells, 8081 Anion channels, role in bronchial epithelial epitopes, 7557 eosinophil-dependent murine model of, cell thiocyanate transport, 5144 unresponsiveness in CD4 RTE, aged created by IL-5 and eotaxin-2 co- Annexin 1, phagocytosis of apoptotic neutro- mouse, 1321 expression, 7879 phils by macrophages stimulated Antinuclear antibodies, production of, Bright EPC recruitment and angiogenic switch by, 4595 overexpression, autoimmunity and, dependent on Th cells, 6482 transgenic mouse, 2996 I. scapularis Anthrax, DCs mediate spore entry into lung, experimental, Salp15 inhibits Antiphospholipid syndrome, binding of plas- development of, 7064 7994 min-induced Abs to cardiolipin, experimental, types 1 and 2, development Anti-nuclear antigen, B cells expressing, 5351 determined by airway exposure down-regulate BCR during foreign Aortic stenosis, calcific, infiltration by levels of LPS, 5375 antigen response, 5623 clonally expanded T cells, 5329 experimental, viral TLR ligand immuno- Antibodies AP-1. see Activator protein 1 modulatory effects dependent on levels of, regulation in B cell memory, 67 APECED. see Autoimmune polyendocrinopa- IL-12 and IL-10, 7805 repertoires, B cells undiversified with hy- thy-candidiasis-ectodermal dystro- histamine release by basophils, control and drophobic HCDR3s, proliferation in phy asthmatic subjects, 4584 PRRSV, 6320 Apoptosis IgE modulates neutrophil survival, 2535 Antibody-Antigen database, information re- Fas/FasL in osteoblast and osteoclast dif- IL-4, IL-13 and IL-4R␣ in maturation and source, letter, 4705 ␥ ferentiation and, 3379 function of CD4 Th2 cells and Antibody-forming cells, Fc RIIB, regulates Fas/FasL-mediated, PKC␪ in, T cells, 312 DCs, 219 B cell activity, 897 Fas-mediated, plasmid DNA vaccine-elic- murine model, airway epithelial STAT3 Antigen presentation ited responses limit Ag expression required for allergic inflammation, ␥ bacterial, enhanced by CRP via Fc Ron via, 5652 6191 DCs, 7283 ionizing radiation-induced, Mcl-1 depletion PD1 dampens inflammation and AHR, 496 ␦ BCR-mediated, PI-3K p110 isoform in, in, macrophages, 2923 risk modulated GITR and CD25-express- 2328 TRAIL-induced, Bax in HBV sensitization ing T cells, 1477 bleomycin hydrolase in, CD8 T cells re- of hepatocytes to, 503 SAg presentation by ASM to CD4 T cells sponses and, 6923 Arachidonic acid, mediates cardiac fibrosis elicits proasthmatic changes, 3627 to CD8 and CD T cells, by CD103 BLN associated with inflammation, re- Astrocytes, monocyte networks with, regulate DCs, 6861 view, 641 MMP gene expression, CNS tuber- CD8 T cells primed by cross-presented Archaeosomes, effect on expansion and culosis, 1199 intracranial Ag, 6038 maintenance of memory CD8 T Ataxia-telangiectasia mutated, oxidative direct and indirect, peripheral tolerance cells, 2396 stress responses regulated by, re- induction using ECDI-fixed APCs, Arthritis quired for T cell proliferation, 4757 prevention of EAE and, 2212 Cia4 and Cia6 loci regulate neutrophil Atherosclerosis, coronary, IL-12 in IFN-␥ endosomal trafficking and presentation of migration and TNF-␣ and NO lev- production, 592 autoantigens and lipids by CD1d, els, 2344 Atm. see Ataxia-telangiectasia mutated 6181 collagen-induced, controlled by multiple Atm gene, regulation of ROS by, response to ERAP1 in immunity to infection in cross- loci, 3084 dsDNA breaks, lymphocytes, 103 presentation, 2241 collagen-induced. prothymosin ␣ lacking Atopic dermatitis hepatocyte, T cell tolerance induction by, NLS, effective gene therapy, 4688 murine model of, skin lesions suppressed 6849 collagen-induced, suppressed by STAT4 by transdermal CpG-ODNs, 584 interference with CD8 T cell immu- targeting by antisense phosphoro- skin-infiltrating CD8 T cells initiate le- nodominance and, MCMV, 7235 thioate ODNs, 3427 sions, 5571 MHC-class I, endosomal trafficking of experimental, suppressive function of T2- Autoantibodies transmembrane proteins, 7932 MZP B cells, 7868 Bxs6 locus in gp70 expression and, 4395 NK cells regulate tumor-specific CTLs inflammatory, effector phase suppression production by NKT cells and B1a cells, and, syngeneic lymphoma model, by dsRNA mediated by type I renal disease and, with NZB chro- 6140 IFNs, 2204 mosome 4, mouse, 1608 by nonhemopoietic cells amplifies expan- osteoarthritis, B cell clonal expansion and specific for determinants on IgG, RA sera,

sion of effector CD8 T cells, 5802 VH somatic hypermutation, 557 Pillars of Immunology, 1227 2007] SUBJECT INDEX 8259

Autoantigens IgE and IgA containing, signaling capaci- memory and naive subsets, effector cyto- endosomal trafficking and presentation of ties, 2901 kine profiles of, multiple sclerosis, lipids and, by CD1d, 6181 Lyn-dependent IL-4-induced alternate sig- 6092 interactions regulate BCR expression, 5035 naling pathway, 4726 NTAL N terminus inhibits pre-B cell dif- Autoimmune diabetes, KRV-induced, TLR9- PI-3K p110␦ isoform in Ag presentation ferentiation, 2336 signaling pathways, BBDR rat, 693 mediated by, 2328 positive selection promoted by BCR-di- Autoimmune myocarditis, promoted by CpG, PI3K signaling directed by, positive selec- rected PI3K signaling, 6332 3466 tion promoted by, B cells, 6332 proliferation, triggered by S. aureus pro- Autoimmune polyendocrinopathy-candidiasis- B cells tein A via TLR2 ligands, 2803 ectodermal dystrophy, Treg defect aged precursors, E47 degradation associ- proliferation controlled by TFII-I via NF- in, 1208 ated with ERK MAPK activation, ␬B, 2631 Autoimmunity 3521 regulation of memory Ab levels, 67 apoptotic splenocytes drive response to AID expression and autoantibody produc- required for anti-CD45RB-induced trans- PARP-1, mouse lupus model, 95 tion, 5357 plantation tolerance, 6028 Bright overexpression, anti-nuclear Ab ANA, down-regulate BCR during foreign selection promoted by pancreatic tertiary production and, transgenic mouse, antigen response, 5623 lymphoid structures, autoimmune 2996 anti-Dsg autoreactive, repertoire in PV diabetes, mouse, 5643 ␤ CNS, TGF- 1-mediated control of, CD26 patients, 5982 sensitized to TRAIL via c-FLIP by IKK in, 4632 anti-Influenza responses, TLRs and, effec- inhibition, MCL, 1923 against intracellular Ags, inhibited by C1q, tor T cells, 2182 SpA-mediated death requires Bim, 2636 2916 in antigen-driven humoral response, in- subsets of, kinetics of Blimp-1 induction, ␥ murine, anti-inflammatory effects of IFN- flammatory myopathies, 547 4104 in, 134 autoreactive memory, formation stimulated T cells and, surface molecules trigger tro- NKT cells in TNF-matured DC protection by autoreactive CD4 T cells, 4793 gocytosis of membrane compo- from, EAE, 4908 B-1a, expressing IL-5 and IL-5R ␣-chain, nents, 3637 retinal, T cell anergy predisposes to, 4276 elicited by nasal cholera toxin, T2-MZP, suppressive function in experi- spontaneous, driven by 129-derived chro- 6058 mental arthritis, 7868 mosome 1 loci, expressed on blood contains progenitor populations with T3, do not give rise to mature cells, mu- C57BL/6 mice, 2352 clonogenic B and T lineage poten- rine lupus model, 7511 suppression of, Bcl-2 overexpressing T tial, 4147 TLR agonists promote terminal plasma cells and CD4CD25 T cells in, c-Cbl in early development, 926 cell differentiation, 7779 transgenic mouse, 2778 CCR7-driven B-T helper cell collaboration TLR9 determines CSR to IgG2a, 2415 T-bet regulates Th1 and Th17 lympho- in activation of, 1468 transcriptional targeting for induction of cytes, 1341 peripheral CD8 T cell tolerance, CD4 T cells and, type I IFN required for Th3 cells in peripheral tolerance, IL-2 de- 7738 Ab response to adenovirus, 3505 ficient mice and, 172 undiversified with hydrophobic HCDR3s, changes in gammaherpes virus latency urinary bladder epithelial Ag induces toler- proliferation in PRRSV, 6320 reservoirs and activation of, SAP- ance and autoimmune response B helper cells, CCR7-driven B-T helper cell deficient mouse, 1692 and, CD8 T cells, 539 collaboration in activation of B clonal expansion and V somatic hyper- Axl, macrophages and DCs use Axl/Mertk/ H cells, 1468 mutation, OA, 557 Tyro3 receptors in apoptotic cell B lymphocyte-induced maturation protein-1 EAE recovery requires regulation of clearance, 5634 cytokine-dependent expression of, inhibits CD4CD25 Treg cells and IL-10 by, IL-2 production, T cells, 242 3447 B and T lymphocyte attenuator, in cell sur- immature/transitional 1 B cell expression Fc␥RIIB, regulates primary AFC activity vival, GVHD, 6073 of, 3593 of, 897 4–1BB ligand, role in gammaherpes virus kinetics of induction, B cell subsets, 4104 immune surveillance, 5227 follicular and MZ, TLR modifies BLyS B lymphocyte stimulator receptor, TLR mod- B cell-activating factor belonging to the TNF receptor expression, 7531 ifies expression of, follicular and family H2-O expression patterns in DCs and, MZ B cells, 7531 effect on memory B cell differentiation 1488 B1a cells, NKT cells and, autoantibody pro- into Ig-secreting cells, 5612 hemopoiesis maintained by type I IFN duction and renal disease associ- IL-21 and, in PC differentiation from and, during Pneumocystis lung in- ated with NZB chromosome 4, memory B cells, 2872 fection, 6604 mouse, 1608 B cell-activating transcription factor, AP-1 immature, exposure to Ag causes SHIP1- B7 family and, in NKT cell maturation, thy- dependent reduction in SDF-1 re- B7–2 regulates survival, phenotype, and mus, 58 sponsiveness, 3353 function, APCs, 6236 ␦ B cell antigen receptors immature, PI3K p110 subunit required B7–4, suppressive Treg cell mode via autoantigen interactions regulate expres- for RAG expression, 1981 B7-H4 induction via IL-10 on sion, 5035 immature/transitional 1, express AID and APCs, letter, 4705 controls AP-1 and NFAT activity via Ras- BLIMP-1 and undergo CSR, 3593 B7-DC/PD-L2 cross-linking induces NF- mediated Ral activation, 1405 influence inflammation and bacterial con- ␬B-dependent protection from cell B cell lymphoma 10 tainment, M. tuberculosis, 7222 death, DCs, 1426 Bcl10/Malt signaling essential for TCR- influenza virus causes responses by, via B7-H1 up-regulation on myeloid DCs sup- induced NF-␬B activation, 953 type I IFN, respiratory tract, 1457 presses T cell immune functions, controls TCR- and Fc␥R-induced actin islet-infiltrating, peripherin recognition by, chronic hepatitis B, 6634 polymerization, 4373 6533 B7S3, novel negative regulator of T cells, essential for Fc⑀ R-induced AP-1, NF-␬B marginal zone, transcription factor com- 3661 activation and IL-6 production, plexes of CD21 and CD23 genes, CD28/CTLA-4-B7 pathway in sensitiza- mast cells, 49 mouse, 7139 tion and tolerance induction to pea- B cell lymphomas memory, effects of BAFF on differentia- nut allergens, 6894 CD4CD25 Treg cells in immune evasion, tion into Ig-secreting cells, 5612 EAE recovery requires B cell regulation of 6840 memory, IL-21 and BAFF/BLys in PC and IL-10 via via, 3447 Syk required for growth of, 111 differentiation from, 2872 effective costimulation in T cell-mediated B cell receptors memory, subset loss associated with im- colitis, 5563 down-regulate FOXO1 expression via paired immunization responses, effects of immunotherapy on, allergic in- PI3K and Btk, 740 HIV-1, 8212 flammation, 1931 down-regulated by ANA B cells during memory and CD27neg, presence in SLE, T cells deficient in, suppressed by foreign antigen response, 5623 6624 CD4CD25 Treg cells, 1542 8260 SUBJECT INDEX ͓VOL. 178

Bacillus anthracis, IFN-producing CD4 T Brahma-related gene 1, STAT3 recruitment E-Cadherin, EGFR-dependent Th2 cell-pro- cell mediated spore-induced immu- at IL-6-inducible genes dependent moting activity and, bronchial epi- nity to, 2646 on, 345 thelial cells, 7678 Baculoviruses, insect, potentiate mammalian Brain Calcific aortic stenosis, infiltration by immune responses via type I IFN, DC transmigration through microvessel clonally expanded T cells, 5329 2361 endothelium regulated by MIP-1␣ Callithrix jacchus, NK cell genomics and BAFF. see B cell-activating factor belonging and MMPs, 520 diversity, common marmoset mon- to the TNF family experimental abscess, MyD88 signaling key, 7151 Basophils essential for immune response, Calmodulin/calmodulin-dependent protein histamine release from control and asth- 4528 kinase, p38 activated by, in HIV- matic subjects, 4584 SIV-infected, IL-15 in accumulation of Tat regulation of IL-10, monocytes, IPSE/alpha-1 induces IgE-dependent IL-4 CTLs, 5812 798 production, 6023 Breast cancer, engineered trastuzumab CaMK. see Calmodulin/calmodulin-depen- BATF. see B cell-activating transcription epitopes show antitumor activity dent protein kinase factor against HER-2/neu, 7120 Cancer. see also Tumors; specific Cancers Bax BRG1 gene. see Brahma-related gene 1 functions of NK cells in, review, 4011 airway MCH resolution by IFN-␥ via Bright, overexpression of, anti-nuclear Ab Candida albicans STAT1 and, 8107 production and autoimmunity and, dectin-1 stimulation by, activates NFAT, HBV sensitizes hepatocytes to TRAIL- transgenic mouse, 2996 macrophages and DCs, 3107 Bronchial epithelial cells, pendrin and anion ␣ ␤ induced apoptosis via, 503 Pra1p as ligand for integrin M 2, 2038 Bcl-2 channels in in thiocyanate trans- Capsaicin, immunotherapy of tumors using, restores cell numbers of TCR␥␦ i-IELs, port, 5144 3260 IL-15 deficient mouse, 757 Bronchial lymph nodes, CD103 DCs present Carcinoembryonic antigen-related cell adhe- T cells overexpressing, CD4CD25 T cells antigens to CD8 and CD T cells, sion molecule 3, associates with and, in suppression of autoimmu- 6861 Vav and promotes pathogen phago- nity, transgenic mouse, 2778 Bronchiolitis obliterans syndrome, IL-13 crit- cytosis, 3797 Bcl10. see B cell lymphoma 10 ical in fibro-obliterative process, CARDIAK. see RICK Bet v 1, Treg cells specific for, functional 511 Cardiolipin, binding of plasmin-induced Abs analysis of, 1189 Brother of the regulator of imprinted sites, T to, 5351 BF1 gene, BF2 and, evolutionary histories cell elicitation of tumor responses Caspase 1, activated by alum adjuvants, 5271 following immunization with, 566 and MHC haplotypes, chickens, Caspase-1, IRF-2 regulates apoptosis via, Brucella melitensis, infection by, MyD88- 5744 macrophages, 3602 dependent DC activation, 5182 BF2 gene, BF1 and, evolutionary histories Catalase, overexpression and attenuation of Brugia malayi, IgM responses and suscepti- and MHC haplotypes, chickens, allergic airway disease, 3814 bility to infection, MBL-A-deficient 5744 ␤-Catenin, regulates positive selection of mouse, 5116 BhCRASP-1. see Complement regulator- thymocytes, 5028 Bruton’s tyrosine kinase acquiring surface protein, Borrelia Cathelicidins BCRs down-regulate FOXO1 expression hermsii -associated via PI3K and, 740 blocks TLR4 activation and contact sensi- Bim, SpA-mediated B cell death requires, MyD88 and, in pathogen-specific IgM re- tization, DCs, 1829 2636 sponses, 3740 LL-37 peptide, role in vitamin D-inducible Bleomycin hydrolase, Ag presentation and Btk. see Bruton’s tyrosine kinase suppression of M. tuberculosis, responses of CD8 T cells, 6923 BTNL2, negative costimulatory molecule, in 7190 BLIMP1. see B lymphocyte-induced matura- intestinal inflammation, 1523 Cathepsin B, regulated by neutrophil elas- tion protein-1 Bubonic plague, pneumonic plague and, oral tase, macrophages, 5871 Blood, contains progenitor populations with vaccination with Salmonella ex- Caveolin 1, effects of VEGF,NO and, on an- clonogenic B and T lineage poten- pressing Y. pestis F1 and V Ags ergy, ECs, 1505 tial, 4147 protects against, 1059 CD1d Blood-brain barrier, peroxynitrite-dependent Burns, C5a blockade improves burn-induced endosomal trafficking and presentation of pathway causes permeability cardiac dysfunction, 7902 autoantigens and lipids by, 6181 changes, CNS inflammatory re- Bxs6 locus, role in gp70 expression and auto- prevention of type I diabetes by iNKT cell sponse, 7334 antibodies, 4395 and, NOD mouse, 1332 BLT1. see Leukotriene B4 receptor 1 Bystander effects, virus-associated, effect on CD3 BLyS receptor. see B lymphocyte stimulator CD8 T cell response, 7267 CD3␥, ␤-strand and proximal stalk in thy- receptor mic development, 3668 Bone marrow c-Cbl, in early B cell development, 926 chains, biological roles revealed by human ␣ hematopoiesis mediated by SDGF-1 via C/EBP␨, RBP-J␬-dependent CRP switch to, immunodeficiencies, 2556 Tac1 and substance P, 2075 7302 mAb against, donor CD8 T cells mediate IL-6 in tumor exosome inhibited differen- c-Jun, ␣␤/␥␦ T cell regulation by, 5690 GVL without GVHD, recipients tiation of DCs, 6867 c-Kit, K-ras modulates cellular functions me- conditioned by, 838 myeloid cell DEC205Gr-1 subsets, chemo- diated by, mast cells, 2527 CD3␨, tyrosine phosphorylation induced by kine and TLR expression, 7833 C-Reactive protein TCR-MHC interactions, 4120 Bone marrow transplantation complement factor H polymorphism affects CD4, RTEs, Ag unresponsiveness in, aged FL expands lymphoid progenitors and T affinity to, 3831 mouse, 1321 cell reconstitution after, 3551 enhances bacterial Ag presentation via CD5, protects tumor Ag-specific T cells from host NK T cells prevent GVHD and allow Fc␥R on DCs, 7283 tumor-mediated AICD, 6821 graft antitumor activity, 6241 human, protects mice from S. pneumoniae CD6, extracellular isoforms regulate targeting BORIS. see Brother of the regulator of im- infection, 1158 to immunological synapse, 4351 printed sites RBP-J␬-dependent switch to C/EBP␨ at CD8, blockade of, promotes Ag responsive- Borrelia burgdorferi promoter site, 7302 ness by inhibiting apoptosis of endothelium activated by, IFN-␥ alters suppression of nephrotoxic nephritis, CD4 T cells, 6148 inflammatory responses, 1172 Fc␥R, macrophages and comple- CD8␣ gene, chicken, genomic organization neutrophil recruitment to infection site ment in, 530 of novel family of immunoreceptor attenuates infectivity, 5109 c-Rel genes, 3023 ␣ ␤ Borrelia hermsii, BhCRASP binding speci- gene expression analysis to identify targets CD11b. see Integrins, M 2 ficities for FH and plasminogen, of, T cells, 7097 CD16, monocytes expressing, preferentially 7292 in TLR-induced IL-23 p19 gene expres- harbor HIV-1, 6581 ␣ ␤ BOS. see Bronchiolitis obliterans syndrome sion, DCs, 186 CD18. see Integrins, 1 2 2007] SUBJECT INDEX 8261

CD21, in establishment of extracellular HIV CD56 Chemokine ligands reservoir, LNs, 6968 CD56bright KIR NK cells acquire CD56dim CCL1/CCR8 interactions trigger macro- CD21 gene, transcription factor complexes of features on activation, 4947 phage aggregations, peritoneal ad- CD23 genes and, MZ B cells, marks effector T cell subset, human intes- hesions, 5296 mouse, 7139 tine, 5524 CCL2, lung-specific overexpression en- CD23 gene, transcription factor complexes of CD59, controls CNV, wet-type AMD, hances defense to S. pneumoniae, CD21 genes and, MZ B cells, mouse, 1783 5828 mouse, 7139 CD62L. see L-Selectin CCL3 and CCL4 in CD4 T cell help in CD24, on CNS resident cells, EAE enhanced CD70, TLR/CD40 stimulation regulates ex- generation of IL-6R␣ high IL- by, 6227 pression of, DCs, 1564 7R␣high prememory CD8 T cells, CD25 CD73, CD39 and, in innate protection, ALI, 778 incomplete deletion of Foxp3 Treg cells 8127 CCL3 in eradication of lymphoma by rit- following antiCD25 treatment, ma- CD74, genetic manipulation and responses to uximab, 6616 laria-infected mouse, 4136 CNS injury, 163 CCL11, eosinophils in tumor immune sur- T cells expressing GITR and, modulate CD83, DC, knockdown by siRNA inhibits T veillance, 4222 asthma risk, 1477 cell stimulation, 5454 CCL11, TLR3 mediates release from Treg cell-dependent function, controlling CD85j. see Leukocyte Ig-like receptor-1 dsRNA-stimulated BSMCs, 489 memory CD8 T cell homeostasis, CD89. see Immunoglobulin receptors, Fc␣RI CCL19, expression regulated by NF-␬B 1251 CD99, mediates transendothelial migration, and IRFs, mDCs, 253 CD26, TGF-␤1-mediated control of CNS neutrophils, 1136 CCL23, FPRL1 released by proinflamma- autoimmunity via, 4632 CD103, colon carcinoma-specific CTLs, tory proteases, 7395 CD28 2908 CCL23 induced by IL-4 via STAT6, CD28/CTLA-4-B7 pathway in sensitiza- CD137, lymphocyte dysfunction induced in monocytes, 4335 tion and tolerance induction to pea- anti-CD137-treated mice, 4194 CCL25-deficient intestinal epithelium and nut allergens, 6894 CD152 lamina propria, impaired accumula- requires Vav1 to enhance TCR signaling CD28/CTLA-4-B7 pathway in sensitiza- tion of CD8 Ag-specific T cells, at SLP-76 signalosome, 1363 tion and tolerance induction to pea- 7598 CD32b. see Immunoglobulin receptors, Fc␥ nut allergens, 6894 CXCL1 and CXCL16, ADAM10 shedding RIIb IFN-␥ production controlled by, CD8 T of, detachment of adherent leuko- CD36, disruption impairs cytokine responses cells, 2132 cytes facilitated by disintegrin and, to P. falciparum GPI, 3954 regulates IS in CD4 T cells, 5543 8064 CD37, dectin-1 interaction with, inhibits CD154, impaired induction of, CD40, CD4 T CXCL2 (see Macrophage inflammatory IL-6, 154 cells, HIV-infected patients, 1645 proteins, MIP-2) CD39, CD73 and, in innate protection, ALI, CD154 gene, regulated by NF-ATc2, T cells, CXCL8, fibroblast secretion of, limits my- 8127 SLE, 1960 cobacterial survival in macro- CD40 CD160, MHC-I-specific, effect of release phages, 3767 antibody to, suppresses immune response from activated NK lymphocytes, CXCL10 and CCL5 induced by IFN-␥, to infection with LCMV, 1662 1293 with Ptx promote T cell entry to CCR5 and, stimulation up-regulates A3G CD163, TWEAK interactions with, 8183 CNS, 8175 expression, DCs and CD4 T cells, CD200, expression on tumor cells suppresses CXCL10 gene, selectively regulated by 1671 antitumor immunity, 5595 IFNs, ECs, 1122 CD40L and, role in counteracting antitu- CD272. see B and T lymphocyte attenuator CXCL11 and CXCL10 genes selectively mor immune responses, T cells, CD300f. see Immune receptor expressed by regulated by IFNs, ECs, 1122 2047 myeloid cell 1 CXCL11 gene, selectively regulated by costimulatory function for, T cells, 671 Cdc42, inactivation required for F-actin de- IFNs, ECs, 1122 impaired CD154 induction and, CD4 T polymerization and phagosomal CXCL11 gene, STAT3-dependent IFN- cells, HIV-infected patients, 1645 maturation, neutrophils, 7357 induced expression, 986 targeting Ag to, induces immune responses Cdt. see Cytolethal distending toxin CXCL12 (see Stromal cell-derived fac- against tumors, 4169 CEACAM3. see Carcinoembryonic antigen- tor-1) TLR/CD40 stimulation regulates CD70 related cell adhesion molecule 3 IFN-induced STAT3-dependent CXCL11 expression by DCs, 1564 Celiac disease, anti-gliadin Abs bind to syn- gene expression, 986 CD40 ligand apsin I, 6590 selective settling regulated by cytokine CD40 and, role in counteracting antitumor Cell death receptors and, thymus, 2008 immune responses, T cells, 2047 B7-DC/PD-L2 cross-linking induces NF- Chemokine receptors effects of IFN-␥ and, on FPRL2, micro- ␬B-dependent protection from, CCR2, role in monocyte-lineage cell re- glia, 1759 DCs, 1426 cruitment, human corneal stroma, HIV-1 Tat and, in inflammation, HAD, necrotic, impairs Ag-specific CD8 T cell 3288 3226 immune responses to tumors, 1573 CCR2 expressing Th17 cells, 7525 mimetics enhance IFN-␥-producing T Central nervous system CCR2 mediates increase in pulmonary cells, T. cruzi infection, 6700 autoimmunity, TGF-␤1-mediated control DCs, allergic airway inflammation, CD40 receptor, cytokine-induced expression of, CD26 in, 4632 5305 inhibited by guanosine, microglia, C1q and C3 in innate immune response to CCR4, effector T cells regulated by, role 720 S. pneumoniae, 1861 of FasL, 4891 CD43, PSGL-1 and, mediate E-selectin-de- IFN-␥ -induced CXCL10, CCL5 with Ptx CCR4 required for cutaneous accumulation pendent T cell migration, skin, promote T cell entry into, 8175 of CD4 T cells, 3358 2499 inflammatory responses, peroxynitrite-de- CCR5, surface expression levels, T cells, CD44, regulates inflammation and LPS-TLR pendent pathway causes BBB per- 5668 signaling, macrophages, 2469 meability changes, 7334 CCR5 and CD40 stimulation up-regulates CD45, in Lck regulation, thymic develop- injury to, CD74 genetic manipulation and A3G expression, DCs and CD4 T ment, 2056 responses to, 163 cells, 1671 CD45RB, B cells required for anti-CD45RB- tuberculosis, monocyte-astrocyte networks CCR7, role in Gi-dependent T cell motil- induced transplantation tolerance, regulate MMP gene expression, ity, LN, 2973 6028 1199 CCR7-driven B-T helper cell collaboration CD46, in ursolic acid-induced IL-1␤ release, cGMP-dependent protein kinase, leukocyte in activation of B cells, 1468 peritoneal macrophages, 4854 degranulation regulated by PI3K CCR9, selective settling regulated by, CD47, TSP interactions with, inflammation and, 416 2008 reduced by, 5930 Chemerin, plasma, activated by S. aureus CCR9, T cells expressing, small intestine, CD55. see Decay-accelerating factor staphopain B, 3713 Crohn’s disease, 3293 8262 SUBJECT INDEX ͓VOL. 178

CXCR3 in control of M. tuberculosis in- Collagen, distribution on CD4 and CD8 T Complement regulator-acquiring surface pro- fection, mouse, 1723 cells during influenza infection, tein, Borrelia hermsii-associated, CXCR3 T cells, NK cell-stimulated re- 4506 binding specificities for FH and cruitment of, P. berghei-mediated Collagen-induced arthritis plasminogen, 7292 cerebral malaria, 5779 controlled by multiple loci, 3084 Computer simulations, modeling T cell CXCR4, gp120 binding to, causes p38- prothymosin ␣ lacking NLS, effective gene movement within lymph nodes, dependent T cell apoptosis, 4846 therapy, 4688 5505 effect of CXCR4 antagonist AMD3100 on suppressed by STAT4 targeting by anti- Conservation, binding interactions between J bleomycin-induced pulmonary fi- sense phosphorothioate ODNs, chain and pIgRs, humans and am- brosis, mouse, 5888 3427 phibians, 1589 Chemokines, production in CD11bhigh DC Colon cancer Contact dermatitis, Th1 and Tc1 responses to homeostasis, lung, 1882 CTLs specific for, CD103 expression, T-bet overexpression, Tg mouse, Chemotaxis, coronin required for phagocyto- 2908 605 ␣ sis and, neutrophils, 5769 PGE2 induces IL-1 , colon cancer cells, Contact sensitivity, cathelicidins block TLR4 ChemR23, inflammation regulated by re- 4097 activation and, DCs, 1829 solvin E1 via BLT1 and, 3912 Colony-stimulating factors Corneas Chlamydia muridarum, C. pneumoniae and, CSF-1 and GM-CSF, macrophage cytokine CCR2 in monocyte-lineage cell recruit- NKT cell subsets induced by, 1048 profiles dependent on, 5245 ment, human corneal stroma, 3288 Chlamydia pneumoniae, C. muridarum and, mice deficient in, produce macrophages OAS/PKR and ␣␤ TCR T cells required NKT cell subsets induced by, 1048 and granulocytes and induce in- for Ad:IFN-␥ HSV-1 inhibition, Cholera toxin, nasal administration elicits flammatory responses, 6435 5166 B-1a B cells expressing IL-5 and Combinatorial protein transfer, chemotactic P. aeruginosa-infected, effect of VIP on IL-5R ␣-chain, 6058 and costimulatory molecules, anti- cytokines and corneal perforation, Cholesterol, free, alters lipid raft structure tumor responses, 3301 1105 regulating neutrophil activation, Common variable immunodeficiency, T cell Coronary atherosclerosis, IL-12 in IFN-␥ 5253 abnormalities in, 3932 production, 592 Choriocarcinoma cells, IFN-␥-inducible gene Complement alternative pathway, C3 conver- Coronin, required for chemotaxis and phago- expression regulated via JAK/ tase in DAF mediated decay of, cytosis, neutrophils, 5769 STAT pathway, 1598 352 Corticosteroids, inhibition of GRO-␣ via Choroidal neovascularization, controlled by Complement pathway MKP-1, ASMC, 7366 CD59, wet-type AMD, mouse, alternative activation pathway required for Cowpox virus, evades CTL recognition, 1654 1783 blister induction, experimental CpG, restores T cell proliferation and pro- Chromatin remodeling, SWI/SNF, down- EBA, 6514 mote autoimmune myocarditis, C1q, inhibits autoimmunity against intra- regulated by TCRs, thymocytes, 3466 cellular Ags, 2916 7088 CpG-B oligodeoxynucleotide, Hsp90␤ in C1q and C3 in innate immune response to Chromosome 6, TNF-induced lethal shock, antiapoptotic effect of, 6100 S. pneumoniae, CNS, 1861 mapping of resistance of DBA/2 CREB, p300 and, at proximal IL-2 promoter, C1q augments IC presentation to CD8 T mouse, 5069 T cells, SIV-resistant sooty manga- cells, 7581 Cia4 locus, Cia6 and, regulate neutrophil beys, 7720 C3 convertase in DAF mediated decay of migration and TNF-␣ and NO lev- CREB-1, in HIV-Tat regulation of IL-10, complement alternative pathway, els, 2344 monocytes, 798 352 Cia6 locus, Cia4 and, regulate neutrophil cRel, CD4 and CD8 T cell survival regulated ␣ C3a required for CXC chemokine produc- ␪ migration and TNF- and NO lev- tion after renal I/R, PTEC, 1819 by PKB, PKC and, 2932 els, 2344 C3d binding to MOG, EAE exacerbated Crohn’s disease Cigarette smoke by, 3323 CCR9-expressing T cells in small intes- emphysema induced by, CD8 T cells re- C4b-binding protein interaction with non- tine, 3293 quired for inflammation, 8090 typable H. influenzae and serum IL-22 induces LBP in hepatocytes, 5973 impairs NK cell-dependent tumor immune resistance, 6359 Cryptococcus neoformans ␥ surveillance, 936 C4b deposition on non-typeable H. influ- IFN- -dependent microglial cell activation pulmonary emphysema induced by, IL-18 enzae, lgtC expression modulates protects against cerebral infection, ␣ and IL-18R in pathogenesis, 1948 resistance to, 1002 5753 Circumsporozoite protein, presented to CD8 C4BP interaction with nontypable H. influ- perforin-dependent microbicidal activity T cells by P. berghei-infected enzae and serum resistance, 6359 requires PI3K-dependent ERK 1/2 hepatocytes, 7054 C5a, innate immunity activated by, PI3K signaling, NK cells, 6456 Class switch recombination signaling protects from sepsis via, Cryptopatches, LT-independent stromal cell to IgG2a, determined by TLR9, B cells, 5940 TRANCE expression, 5659 2415 C5a blockade improves burn-induced car- Crystal structures, Mamu-A*01 complexed immature/transitional 1 B cells, 3593 diac dysfunction, 7902 with immunogenic SIV epitopes, Clinical trials, unique human tumor antigena, factor H, polymorphism affects affinity to 944 immunobiology and use in, review, CRP, 3831 CS. see Cigarette smoke 1975 Factor H down-regulation sensitizes to, CSP. see Circumsporozoite protein CNV. see Choroidal neovascularization effect on tumor growth, NSCLC, CTLA-4. see CD152 Colitis 5991 Curcumin, Syk as target for, required for B ameliorated by FTY720 via CD4CD25 HIV-1 opsonization with, enhances DC lymphoma growth, 111 Treg cells, 2458 infection and transfer to CD4 T CVID. see Common variable immunodefi- commensal bacteria-induced, TLR/NF-␬B cells via CR3 and DC-SIGN, 1086 ciency signaling, gnotobiotic mice, 6522 human, effect of P. gingivalis gingipains CXCL1. see Keratinocyte-derived chemokine experimental, prevented by S. mansoni on, 7242 Cyclic diguanylate, bacterial, immunostimu- infection, role of macrophages, macrophages, Fc␥R and, in CRP-mediated latory molecule, 2171 4557 suppression of nephrotoxic nephri- Cyp c 1, mutant of, for IgE-mediated fish IL-7 essential for development, 4737 tis, 530 allergy immunotherapy, 6290 PPAR-␥ required for CD4 Treg cell-medi- Complement receptors Cysteinyl leukotriene receptor 2, IFN-␥ in- ated protection against, 2940 CR3, HIV-1 opsonization with comple- duces CysLTR2 and enhances re- T cell-mediated, effective B7 costimulation ment enhances DC infection and sponsiveness to CysLTs, ECs, 5262 in, 5563 transfer to CD4 T cells via, 1086 Cytokine receptors, selective settling regu- ␤ TNBS-induced, IL-13 triggers TGF- 1- CR3 ligation of DCs suppresses stimula- lated by chemokine receptors and, dependent fibrosis, 5859 tory capacity, 6268 thymus, 2008 2007] SUBJECT INDEX 8263

Cytokines, proinflammatory, PGI2 analogs Decay-accelerating factor, mediates decay of defective in repressing Ig secretion, lupus- inhibit T cell stimulation and pro- complement alternative pathway prone mouse, 4803 duction of, DCs, 702 via C3 convertase, 352 express LAP and inhibit T cell activation Cytolethal distending toxin, subunit B, shows Decoy proteins, bacterial, natural selection via TGF-␤, 4017

PI-3,4,5-P3 phosphatase activity, and interactions of IgA-Fc with expressing MOG and TRAIL, Treg cells in 5099 Fc␣RI and, 7943 EAE-preventive effect of, 918 Cytomegalovirus Dectin-1 expressing mutated I␬B␣, effect of NF-␬B CD8 T cell recognition patterns of immu- interaction with tetraspanin CD37 inhibits activation, 1301 nodominant CMV Ags, 4455 IL-6, 154 Fc␥RIIB on, enforces peripheral tolerance human, UL18 inhibits LIR-1ϩ and acti- stimulation by C. albicans activates via T cell inhibition, 6217 vates LIR-1- NK cells, 4473 NFAT, macrophages and DCs, follicular, GALT in scrapie agent invasion LIR-1 expression and UL18 in response 3107 from intestine, 3757 to, 3536 Dectin-1-Fc fusion protein, defense against function modulated by TLR ligands and murine, indigenous microbiota and mainte- P. carinii mediated by dectin-1-Fc iNKT cells, 2721 nance of virus-specific memory fusion protein, 3702 Gadd45␣ regulates p38-dependent cyto- CD8 T cells, infected lungs, 5209 Defensins, neutrophil, increase phagocytosis kine production, 4153 murine, interference with Ag presentation of influenza A virus, 8046 gap junctions facilitate melanoma Ag and CD8 T cell immunodominance, Degranulation, leukocyte, regulated by PKG transfer between, 6949 7235 and PI3K, 416 generated by CD11c MHC class II precur- Delayed-type hypersensitivity, suppressed by sors, lung, letter, 2609 Cytopiloyne, prevents type 1 diabetes, NOD low mouse, 6984 CD4CD25 adaptive Treg cells H2-O expression patterns in B cells and, Cytoskeleton, cytoskeletal protein transfor- during transplant tolerance, 3983 1488 Dendritic cell-specific ICAM-grabbing nonin- mation, HIV-1-infected multinucle- HIV-1 opsonization with complement en- tegrin ated giant cells, 6404 hances infection and transfer to cells expressing, transfer of Ab-neutralized Cytotoxic T lymphocytes CD4 T cells via CR3 and DC- HIV-1 to CD4 T cells by, 3177 accumulation at HIV-1 replication sites, SIGN, 1086 CR3, HIV-1 opsonization with comple- lymphoid follicles, 6975 HIV-1 transfer to CD4 T cells from, role ment enhances DC infection and Ag-specific, induced by OK-432 enhance of Src and Syk, 2862 transfer to CD4 T cells via, 1086 DC/colorectal cancer cell fusion, HPV VLP uptake mediated by Fc␥R, in Dendritic cells induction of HPV-specific T cells, 613 9cRA exerts immunosuppressive effects Ag-specific lysis, ESCs protected by ser- 7587 via RXR-dependent activation, Hsp90 inhibition of, 7730 pin-6, 3390 6130 avidity/compartmentalization to site of identification in peripheral lymphoid or- acquire LN homing potential via gans, mouse, 5 mucosal vaccination protects CD4CD25 Treg cells, 4184 IFN-␤-preactivated, sensitization to TLR7 against CD4 T cell depletion, activated, induce Th1 response from Th2- agonists, 6208 SHIV, 7211 polarized T cells, 3583 IgG opsonization of HIV inhibits transfer CD8, inhibited by T cell TRAIL, murine B7-DC/PD-L2 cross-linking induces NF- to T cells, 7840 lupus model, 3962 ␬B-dependent protection from cell IL-12p80 in susceptibility to cutaneous CD8, PKC␦ regulates AgR-induced lytic death, 1426 leishmaniasis, 7251 granule polarization, 7814 bacterial Ag presentation enhanced by immature infiltrating, in SCLC, 2763 colon carcinoma-specific, CD103 expres- CRP via Fc␥R on, 7283 influenza-infected, NKp46 and NKG2D sion, 2908 birth of a cell type, Pillars of Immunology, comparison of SFV, adenovirus and AL- 3 recognition required for NK cell VAC vectors in responses to P815 BM-derived, IFN-␥ regulates CpG-induced activation, 2688 tumor, 6761 IL-10, 211 loss of myeloid and plasmacytoid DCs, cowpox virus evades recognition by, 1654 bone marrow, IL-6 in tumor exosome in- simian AIDS, 6958 expression and function of Syt VII, 1498 hibited differentiation of, 6867 LPS up-regulates MHC class II via AP-1 HIV-specific, effect of Ag variants in bone marrow-derived, immunization route enhancer, 6307 HIV-1 on antiviral capacity, 5513 determines integrin expression and lung, mediate anthrax spore entry, 7994 human CD8 self-Ag-specific, cytotoxicity distribution of CD8 T cells, 1512 in lymph node recruitment of NK and T controlled by IL-12, 3566 c-Rel in TLR-induced IL-23 p19 gene ex- cells, 3886 human melanoma gene encoding Ag rec- pression, 186 macrophages and, use Axl/Mertk/Tyro3 ognized by, Pillars of Immunology, cathelicidins block TLR4 activation and receptors in apoptotic cell clear- 2617 contact sensitization, 1829 ance, 5634 IL-15 in accumulation of, SIV-infected CCR5 and CD40 stimulation up-regulates maturation of, induced by dermal fibro- brain, 5812 A3G expression, 1671 blasts, 4966 memory T cells and, differential survival, CD4 Th2 cells and, IL-4, IL-13 and IL- microtubules in endolysosomal tubule for- 3483 4R␣ in maturation and function, mation in, 7199 postpriming control mechanism of, 2307 219 migration limited by SR-AI/II and tumor-specific, NK cells regulate Ag pre- CD8 T cells and, CD40-CD40L interaction MARCO, effect on allergic airway sentation and, syngeneic lymphoma required for T cell responses, 2844 inflammation, 5912 high model, 6140 CD11b , chemokine production in ho- M.leprae inhibits activation and maturation type 1, Th1 and, responses to T-bet over- meostasis, lung, 1882 of, 338 monocyte-derived, NF-␬ expression, Tg mouse, contact der- CD11c, polarize Th17 cells and support B and IRFs regu- late CCL19 expression, 253 matitis, 605 CD25CD4 T cell-mediated immu- monocytes and, TL1A induced by Fc␥R, UL49.5 regulates epitope presentation by nosuppression, murine encephalo- 4033 Qa-1b, 657 myelitis, 6695 CD83 knockdown by siRNA inhibits T MR expression defines new subset, 4975 cell stimulation, 5454 MyD88-dependent activation, B. melitensis DAF. see Decay-accelerating factor CD103 BLN, present antigens to CD8 and infection, 5182 DAP12. see DNAX activation protein of 12 CD T cells, 6861 MyD88 regulates immune responses dur- kDa colonic mucosa-derived, characterization ing RSV infection, 5820 DC-SIGN. see Dendritic cell-specific ICAM- of, 7984 myeloid, synergize with pDCs in Ag-spe- grabbing nonintegrin CR3 ligation of, suppresses stimulatory cific antitumor immune responses, Death-inducing signaling complex, apoptosis capacity, 6268 1534 induced by, rituximab mediated, dectin-1 stimulation by C. albicans acti- myeloid, 1,25(OH)2D3 modulates tolero- 2287 vates NFAT, 3107 genic properties in, 145 8264 SUBJECT INDEX ͓VOL. 178

myeloid, B7-H1 suppress T cell immune transmigration through brain microvessel DTH. see Delayed-type hypersensitivity functions, chronic hepatitis B, 6634 endothelium regulated by MIP-1␣ myeloid, IL-10 exposure during maturation and MMPs, 520 E2A, thymocyte proliferation blocked by determines longevity, 7794 type I IFN production induced by IgG- HEB and, 5717 NF-␬B subunits in regulating T cell stimu- RNA immune complexes is IRF5 E3–19K, adenovirus, recognizes class I MHC latory gene expression, 6777 and IRF7 dependent, 6876 molecules, 4567 ⌬12,14 NK, are innate immune responders to L. 15-Deoxy- -prostaglandin J2, negative 4E10, gp41 membrane proximal envelope monocytogenes, 4411 regulation of rankl by, role of epitopes, binding to HIV-1 of 2F5 peptide-pulsed, H2-M3-restricted CD8 T NF-␬B and EGR, T cells, 4039 and, 4424 cells induced by, protect against M. Diabetes mellitus E47, degradation associated with ERK tuberculosis, 3806 autoimmune, insulin-specific T cells recog- MAPK activation, aged B cell pre- nize insulin MHC-binding segment, cursors, 3521 PGI2 analogs inhibit proinflammatory cy- tokine production and T cell stimu- NOD mouse, 6051 EAMG. see Experimental autoimmune myas- lation, 702 autoimmune, B cell selection promoted by thenia gravis PI3K in innate immune functioning, el- pancreatic tertiary lymphoid struc- Early growth response derly humans, 6912 tures, NOD mouse, 5643 dispensable for differentiation of macro- plasmacytoid, HCV infection impairs TLR autoimmune, KRV-induced, TLR9-signal- phages, 3038 ing pathways, BBDR rat, 693 ␬ ligand-dependent naive CD4 T cell NF- B and, in negative regulation of rankl LPS augments TNF-␣ production, macro- activation by, 4436 by 15d-PGJ2, T cells, 4039 phages, T2D mice, 663 plasmacytoid, low-dose peptide tolerance in thymocyte differentiation and survival, MLDS-induced, prevented by M3, mouse, 6796 therapy causes Treg cell expansion, 4623 EBA. see Epidermolysis bullosa acquisita mouse lupus, 7849 NKT cell Slamf1 mediates Nkt1 gene ex- Ectonucleotidases, CD39 and CD73, in in- plasmacytoid, synergize with mDCs in pression, NOD mouse, 1618 nate protection, ALI, 8127 Ag-specific antitumor immune re- novel NKT cell activator improves out- EDA. see Extradomain A sponses, 1534 comes, NOD mouse, 1415 EECCs. see Enteroendocrine cells plasmacytoid, TLR7 ligands inhibit peripherin recognition by islet-infiltrating Efferocytosis, TNF-␣ inhibits apoptotic cell CpG-A- and CpG-C-ODN-induced B cells, 6533 clearance via cPLA macrophages, ␣ 2, IFN- , 4072 type 1, DNA vaccination identifies autoan- 8117 pollen immunomodulatory mediators en- tigenic epitopes, 7458 Egr. see Early growth response hance migratory capacity of, 7623 type 1, prevented by cytopiloyne, NOD EHEC. see Enterohemorrhagic Escherichia PPAR-␥ in function of, 2122 mouse, 6984 coli pulmonary, CCR2 mediates increase in, type 1, protective effect of Poly(I:C) on, Embolization therapy, AFP-specific CD4 T allergic airway inflammation, 5305 role of NK3-like NK cells, NOD cell responses in HCC patients un- RAPA-conditioned, enrich Ag-specific mice, 2141 dergoing, 1914 Foxp3 Treg cells, 7018 type 2, impairs IRS-2-mediated PI3K and Embryonic stem cells, protected from Ag- required for induction of experimental ce- induces IL-4 resistance, macro- specific CTL lysis by serpin-6, rebral malaria, 6033 phages, 6886 3390 resting, cognate CD4 help and induction of type I, CD1d-independent iNKT cell pre- EMP1. see Erythrocyte membrane protein 1 peripheral tolerance, CD8 T cells vention of, NOD mouse, 1332 Emphysema and, 2094 1,25-Dihydroxyvitamin D3, modulates tolero- cigarette-smoking induced, CD8 T cells retinal Ag-pulsed, initiates EAU, clinical genic properties in myeloid DCs, required for inflammation, 8090 signature, mouse, 5578 145 CS-induced, IL-18 and IL-18R␣ in patho-

S1P regulates functions via S1P3, 3437 Dipeptidyl peptidase IV. see CD26 genesis, 1948 sensitize TCRs via self-MHC-mediated Src DISC. see Death-inducing signaling complex Endocytosis, TNF trafficking via, mast cell family activation, 2262 Disintegrin, detachment of adherent leuko- granules, 5701 SIgA binding and internalization by, Pey- cytes facilitated by ADAM10 shed- Endolysosomal tubules, formation in DCs, er’s patches, review, 27 ding of CXCL1 and CXCL16 and, microtubules in, 7199 small Rho GTPases mediate tumor-in- 8064 Endoplasmic reticulum-associated aminopep- duced inhibition of endocytic activ- Disulfide bonds, engineering traps peptides in tidase 1, role in immunity to infec- ity, 7787 MHC class I binding groove, 6280 tion in cross-presentation, 2241 STAT1 required for immunity to L. major, DMBT1 gene, regulation via NOD2 and Endosomes, acidification of, regulated by 7259 TLR4 modulates bacterial invasion, NaV1.5, macrophages, 7822 sulfamethoxazole and nitrososulfamethox- IECs, 8203 Endothelial cells azole stimulate signaling, 5533 DNA effects of VEGF, Cav-1 and NO on an- double strand breaks, Atm gene regulation targeting of Ag to, with ␥PGA nanopar- ergy, 1505 of ROS response to, lymphocytes, ticles induces specific immunity, FAK in HLA class I-mediated survival, 103 7911 2979 methylation downregulates IL-7R␣,T genes selectively regulated by IFNs, 1122 tissue-specific, migratory behavior of UV- cells, 5473 HIF-1 in cobalt chloride and hypoxia-me- induced Treg cells altered by, 877 DNA vaccination, identifies autoantigenic diated IL-8 expression, letter, 4707 TLR/CD40 stimulation regulates CD70 epitopes, type 1 DM patients, 7458 IFN-␥ induces CysLTR2 and enhances expression by, 1564 DNA vaccines responsiveness to CysLTs, 5262 TLR ligation-induced IL-27 dependent on HIV, CD8 T cell responses induced by, microvascular, immune regulation by, re- IRF3, 7607 2318 view, 6017 TLR-stimulated, activated CD4 T cells fail plasmid DNA vaccine-elicited responses proximal tubular, C3a required for CXC to differentiate into Th2 cells, 1635 limit Ag expression via Fas-medi- chemokine production after renal TLR4- and TLR2-primed, enhanced IL-10 ated apoptosis, 5652 I/R, 1819 production by, 6173 DNAX activation protein of 12 kDa VCAM-1 activation of PTP1B, 3865 TLR4-expressing, fibronectin EDA targets complexes of MAIR-II with FcR␥ chain Endothelial progenitor cells, recruitment and antigens to, 748 and, peritoneal macrophages, 765 angiogenic switch dependent on Th TLR4-stimulated, genistein exposed, p53 NTAL regulates TREM-1/DAP12-induced cells, asthma, 6482 in NF-␬B-dependent gene expres- cytokine production, myeloid cells, Endotoxemia, prednisolone influences inflam- sion, 5048 1991 mation and coagulation during, pa- TLRs in differential regulation of IL-12 receptor associated with, encoded by tients with sepsis, 1845 release in response to Mtb, 5192 KI3DS1 gene, NK cells, 647 Enteroendocrine cells, TLR activation in- TNF-matured, NKT cells in protection Drosophila spp., hemopoiesis and cellular duces hormones, chemokines and from autoimmunity by, EAE, 4908 immunity, review, 4711 defensins, 4296 2007] SUBJECT INDEX 8265

Enterohemorrhagic Escherichia coli, Shiga Escherichia coli protective effect and allergic side reactions toxin, inhibits PI3K/NF␬B path- enterohemorrhagic, Shiga toxin inhibits in tolerization with neuroantigen, way, Gb-3 negative IECs, 8168 PI3K/NF␬B pathway, Gb-3 nega- 4749 Enterotoxin type IIB, A subunit, effect on B tive IECs, 8168 recovery requires B cell regulation of subunit and interaction with TLR2, gram-negative sepsis, oxidized phospholip- CD4CD25 Treg cells and IL-10 via 4811 ids inhibit phagocytosis and impair B7, 3447 Environmental tobacco smoke, exposure to, outcome, 993 Salmonella vaccination stimulates Treg increases allergen-induced airway pneumonia, innate immune responses to, cells and protects against, 1791 remodeling, mouse, 5321 role of TRIF, lung, 3153 Treg cells in EAE-preventive effect of Eomesodermin, role in IFN-␥ production, ␥␦ TLR5 in susceptibility to UTIs, mouse, DCs expressing MOG and TRAIL, T cells, 2730 4717 918 Eosinophils V␦1 ␥␦T cells control neutrophil infiltra- Experimental autoimmune myasthenia gravis murine model of asthma dependent on, tion after infection via IL-17, 4466 effect of neonatal FcR blockade, rat, 5390 ␥ created by IL-5 and eotaxin-2 co- 17␤ Estradiol, induces IL-1␣ expression via susceptibility in IL-12-, IL-23- and IFN- - expression, 7879 ER␣, Sp1 and dissociating HDAC2 deficient mice, 7072 role in tumor immune surveillance, 4222 from ER␣, 3059 Experimental autoimmune uveitis, elicited with retinal Ag-pulsed DCs, clini- Eotaxin-1, TLR3 mediates release from Estradiol receptor ␣, IL-1␣ induced by 17␤ dsRNA-stimulated BSMCs, 489 cal signature, mouse, 5578 E2 induces via ER␣, Sp1 and dis- Eotaxin-2, coexpression of IL-5 and, eosino- Experimental autoimmune uveoretinitis, ag- sociating HDAC2 from ER␣, 3059 phil-dependent murine asthma gravated by OPN, 6567 ESX-1, secretion system, required for IFN model created by, 7879 Experimental epidermolysis bullosa acquisita, type I response to M. tuberculosis, EPCs. see Endothelial progenitor cells alternative pathway of complement Epidermal growth factor receptor 3143 activation required for blister in- MIP-3␣ mediates activation of, via amphi- Ethanol, TLR4, lipid rafts and, mechanisms duction, 6514 regulin release, colonic epithelial of ethanol action, review, 1243 Extracellular signal-regulated kinases, cells, 8013 Evolution ERK1/2, galectin-1 regulates mono- Th2 cell-promoting activity dependent, BF1 and BF2 genes, MHC haplotypes and, cyte/macrophage physiology via, E-cadherin in, bronchial epithelial chickens, 5744 436 ␣ cells, 7678 chicken CD8 gene, genomic organization Extradomain A, fibronectin targets antigens Epidermolysis bullosa acquisita, experimen- of novel family of immunoreceptor to TLR4-expressing DCs, 748 tal, alternative pathway of comple- genes, 3023 Eyes, CD8 T cells mediate intraocular tumor ment activation required for blister conserved binding interactions between J rejection via TNF-␣, 6115 induction, 6514 chain and pIgRs, humans and am- Ezrin, radixin and moesin, phosphorylation Epilepsy, dysregulation of Src family ki- phibians, 1589 causes increased T cell adhesion nases, mast cells, ASK versus EL natural selection and interactions of and migration, SLE, 1938 mice, 455 IgA-Fc with Fc␣RI and bacterial Epithelial cells decoy proteins, 7943 2F5, gp41 membrane proximal envelope airway, control inflammation via NF-␬B TICAM1 function in vertebrates, 4517 epitopes, binding to HIV-1 of 4E10 pathway, 6504 TLR16 ligand specificity and species-spe- and, 4424 airway, IL-8 induced by Pen c 13 via cific interaction with TLR2, F2L. see Formylpeptide receptor-like-2 li- PAR-1 and PAR-2, 5237 chicken, 7110 gand airway, NF-␬B activation modulates asbes- TNF superfamily diversification in teleosts, Factor H tos-induced inflammation and mu- characterization and analysis, 7955 BhCRASP binding specificities for plas- cin production, 1800 zebrafish, origin of vertebrate IFN system, minogen and, 7292 airway, paracellular permeability restricts 4385 binding in sialylated pathogenic neisseriae responses, 6395 Experimental asthma, types 1 and 2, devel- influenced by porin, 4489 alveolar type II, LPS-stimulated cytokine opment determined by airway ex- down-regulation sensitizes to complement release and leukocyte migration posure levels of LPS, 5375 and reduces tumor growth, regulated by macrophages and, 463 Experimental autoimmune encephalomyelitis NSCLC, 5991 bronchial, E-cadherin and EGFR-depen- ␣ ␤ ␣ ␤ interacts with S. pneumoniae Pspc protein, 5 1 and v 5 integrins mediate MMP-9 dent Th2 cell-promoting activity, expression and fibronectin- and 5848 7678 vitronectin-induced microglial acti- polymorphism affects affinity to CRP, bronchial, pendrin and anion channels in vation, 8158 3831 thiocyanate transport, 5144 critical role of IL-23 in induction phase, FADD. see Fas-associated death domain- bronchial, recognition of TLR-dependent 2589 containing protein microbial ligands by, 3134 enhanced by CD24 on CNS resident cells, Fanconi anemia, inflammatory ROS mediate colonic, MIP-3␣ mediates EGFR activa- hemopoietic suppression, Fancc- 6227 tion and ERK1/2 MAPK signaling deficient mouse, 5277 exacerbated by C3d binding to MOG, via amphiregulin release, 8013 Fas, Fas/FasL in osteoblast and osteoclast 3323 lung, influenza A virus activates TLR3- differentiation and apoptosis, 3379 ICAM expression on multiple cell types and RIG-1-dependent antiviral re- Fas-associated death domain-containing pro- sponses, 3368 required for development of, 851 tein, Irf7 regulated by, role in in- lung, IL-13 mediates IL-9 activities, 3244 IL-2/NAg fusion proteins as Ag-specific nate immune signaling, 2429 TGF-␤ suppresses IFN-␥-driven STAT1- tolerogens, 2835 Fas ligand ␣␤ dependent gene expression, 4284 MOG-induced, TCR repertoire and re- effector T cells regulated by CCR4 via, thymic, Aire gene in differentiation of, lapse, 4865 4891 3007 NKT cells in TNF-matured DC protection Fas/FasL in osteoblast and osteoclast dif- ERAP1. see Endoplasmic reticulum-associ- from autoimmunity, 4908 ferentiation and apoptosis, 3379 ated aminopeptidase 1 onset of, GM-CSF production required for Fas receptor, role in rituximab-mediated apo- ErbB receptors, antireceptor therapy induces microglial cell activation, autoreac- ptosis, 2287 inactivated tetrameric form of, tive T cells, 39 FDC-SP. see Follicular dendritic cell secreted 1021 peripheral tolerance induction using ECDI- protein ERM. see Ezrin, radixin and moesin fixed APCs uses Ag presentation Fetus, human tolerance, maternal acceptance Erythrocyte membrane protein 1, P. falcipa- for prevention of, 2212 of, review, 3345 rum, target of naturally acquired PLP 139–151-induced, distribution of IL- Fgr, Hck and, regulate responses to fMLP, antibodies, 428 17-producing CD4 cells, 1372 neutrophils, 3874 Erythropoiesis, IL-7 induces myelopoiesis prevented by nonintestinal CD8␣␣ TCR␣␤ Fibroblasts and, 1553 Treg cells, 6043 dermal, induce DC maturation, 4966 8266 SUBJECT INDEX ͓VOL. 178

secretion of CXCL8 limits mycobacterial macrophages infected by, release PGE2 Gene therapy survival in macrophages, 3767 blocking T cell proliferation, 2065 fiber-modified Ad vectors decrease liver T. gondii inhibits IFN-␥-inducible gene Schu4 suppresses pulmonary immune re- toxicity via IL-6 reduction, 1767 expression, 5154 sponses to, 4538 prothymosin ␣ lacking NLS, CIA, 4688 thymic, unique population identified by types A and B, MMP9 enhances host sus- transcriptional targeting for induction of MTS-15, 4956 ceptibility to pulmonary infection peripheral CD8 T cell tolerance, B tumor-associated, modulate tumor-associ- by, 1013 cells, 7738 ated T cell activation, lung, 5552 FTY720, ameliorates colitis via CD4CD25 Genomic analysis Fibronectin Treg cells, 2458 chicken CD8␣ gene organization, 3023 EDA, targets antigens to TLR4-expressing Fungal infections, integrins mediate response diversity and, NK cells, common marmo- DCs, 748 to pathogen-associated molecular set monkey, 7151 microglial activation induced by vitronec- pattern, PMNs, 7276 extended genetic map of the MHC-B gene, ␣ ␤ ␣ ␤ tin and, 5 1 and v 5 integrins Fusion proteins, IL-2/NAg, as Ag-specific chicken, 7162 mediate MMP-9 expression and, tolerogens, EAE, 2835 gene expression analysis to identify c-Rel EAE, 8158 Fyn, Fyn/PI3K and p38 activation regulates targets, T cells, 7097 Fibrosarcomas, IL-28 elicits antitumor re- IL-4 production, BM-derived mast Germinal centers, Ab responses and, regu- sponses to, mouse, 5086 cells, 2549 lated by FDC-FP, 7859 Fibrosis, cardiac inflammation-associated, Gingipains, P. gingivalis, effect on human mediated by arachidonic acid, re- G2A, lyso-PL mobilize secretory vesicles complement system, 7242 view, 641 and induce signaling via, neutro- GITR. see Glucocorticoid-induced TNF re- FL. see Fms-like tyrosine kinase 3 ligand phils, 6540 ceptor family-related gene Flagellin, TLR5 interaction with PKD re- Gadd45␣, regulates p38-dependent DC cyto- Gleevec. see Imatinib mesylate quired for response to, 5735 kine production and Th1 differenti- Glia, activated, PPAR-␥ agonists suppress FLIP ation, 4153 IL-12 family cytokine production, cellular, B cells sensitized to TRAIL via, Gag, CD8 T cells specific for, early recogni- 1904 MCL, 1923 tion of AIDS-infected cells, 2746 Gliadin, anti-gliadin Abs bind to synapsin I, T cell persistence controlled by hyperther- ␣-Gal glycolipids, intratumoral injection in- celiac disease, 6590 mia via of c-FLIPs degradation, duces xenograft-like destruction, Glucocorticoid, conditions myeloid progeni- 3944 4676 tors, role of TLR4 and PI3K-Akt, FLT1. see FMS-like tyrosine kinase-recep- ␣-Galactosylceramide, tumor cells loaded 2517 tor-1 with, induce innate-NKT and NK Glucocorticoid-induced TNF receptor family- fMLP. see N-Formyl-methionyl-leucyl-phe- cell-dependent resistance, 2853 related gene, T cells expressing nylalanine Galectin-1, regulates monocyte/macrophage CD25 and, modulate asthma risk, Fms-like tyrosine kinase 3 ligand, expands physiology via ERK1/2, 436 1477 lymphoid progenitors and T cell ␥ϪHV. see Gammaherpes virus Glutamate receptors, GluR3, cell surface, reconstitution after BMT, 3551 Gammaherpes virus eliminated by TCR activation via FMS-like tyrosine kinase-receptor-1, selec- 4–1BB ligand in immune surveillance for, GB, T cells, 683 tive settling regulated by, 2008 5227 Glutamate transporter, microglial toxicity to Focal adhesion kinase, role in HLA class latency reservoirs, B cell activation and oligodendrocytes mediated by sys- I-mediated survival, ECs, 7911 changes in, SAP-deficient mouse, tem xc- and inhibition of, 6549 Follicular dendritic cell secreted protein, reg- 1692 Glutathione, ICAM-1 induction by NAC and ulates GC and Ab responses, 7859 Gap junctions, facilitate melanoma Ag trans- mito-Q via, 1835 Follicular lymphomas, intratumoral fer between DCs, 6949 Glycogen synthase kinase-3␤, unrestrained CD4CD25 GITR Treg cells sup- GAPDH, acts as VIP, S. agalactiae, 1379 activity causes activated T cell press allogeneic CD8 and CD4 T Gastric mucosa, H. pylori-infected, IL-21 death, 6083 cells, 4051 production promotes gelatinase Glycoprotein 41, membrane proximal enve- Forkhead box transcription factor class O 1, synthesis, 5957 lope epitopes, 2F5 and 4E10 bind- down-regulated by BCRs via PI3K Gastroenteritis, TLR3 recognition of rotavi- ing to HIV-1, 4424 and Btk, 740 rus dsRNA induces severe intesti- GM1, T cell, decreased by oseltamivir, 2651 N-Formyl-methionyl-leucyl-phenylalanine, nal injury, mouse, 4548 GM2, TNF-␣-induced, kills T cells, RCC, Fgr and Hck and regulate re- GATA-1, GATA-2 and, in mast cell activa- 6642 sponses, neutrophils, 3874 tion, 360 gp70, expression of, Bxs6 locus in autoanti- Formylpeptide receptor 1 GATA-2, GATA-1 and, in mast cell activa- bodies and, 4395 mRNA, LPS-induced stabilization of, peri- tion, 360 gp96, TLR4 potentiates Treg functions via, toneal macrophages, 2542 GATA-3, phosphorylation of, Th2 regulation 3219 released from CCL23 by proinflammatory of cytokine genes by, 2491 gp120, binding to CXCR4 causes p38-depen- proteases, 7395 Gelatinases, IL-21 production promotes syn- dent T cell apoptosis, 4846 Formylpeptide receptor 2, effects of IFN-␥ thesis of, H. pylori-infected gastric gp120 vaccine, Abs induced by, inhibit and CD40L on, microglia, 1759 mucosa, 5957 HIV-1, 6596 Formylpeptide receptor-like-2 ligand, che- Gender, TLR4 and Tim-3 cross-regulation Gpnmb gene, induced by IFN-␥ and LPS, moattracts neutrophils via Fpr2 determines sex differences in in- macrophages, 6557 activation, 1450 flammatory heart disease, 6710 Graft-versus-host disease FOXO1. see Forkhead box transcription fac- Gene expression profiling abrogated by SHIP deficiency, 2893 tor class O 1 histamine release from basophils, control BTLA in cell survival, 6073 Foxp3 and asthmatic subjects, 4584 GVL without, mediated by donor CD8 T induction by TGF-␤, T cells, 7667 identification of genes in early Th1 and cells, anti-CD3 mAb conditioned latent tuberculosis infection characterized Th2 cell differentiation, 3648 recipients, 838 by mRNA of IL-8, IL-12␤ and, multiple myeloma, cancer/testes genes, prevented by host NKT cells, BMT, 6241 3688 expression patterns and prognostic Graft-versus-leukemia, without GVHD, me- suppression of autoimmunity by CD8 T value, 3307 diated by donor CD8 T cells, anti- cells depends on, mouse lupus T. gondii inhibits IFN-␥-inducible gene CD3 mAb conditioned recipients, model, 7649 expression, fibroblasts, 5154 838 FPR1. see Formylpeptide receptor 1 Gene mapping, TNF-induced lethal shock, GRAIL. see Gene related to anergy in lym- Fpr2, neutrophil chemoattraction by F2L via mapping of resistance of DBA/2 phocytes activation of, 1450 mouse, 5069 Granulocyte colony-stimulating factor, mice FPRL. see Formylpeptide receptor Gene related to anergy in lymphocytes, up- deficient in, produce macrophages Francisella tularensis regulation and Notch-mediated hu- and granulocytes and induce in- induces IL-23, monocytes, 4445 man T cell suppression, 6158 flammatory responses, 6435 2007] SUBJECT INDEX 8267

Granulocyte-macrophage colony-stimulating PI3K mediates protection against myocar- Herpes simplex virus-1 factor dial I/R injury, TLR-4 deficient L. monocytogenes expressing immune autoreactive T cells production of, required mouse, 7317 dominant peptide from, confers for microglial cell activation, onset Heat shock proteins immunity to, 4731 of EAE and, 39 Hsp27 regulates chemotaxis and exocyto- OAS/PKR and ␣␤ TCR T cells required circulating IC and, during sodium stiboglu- sis, neutrophils, 2421 for Ad:IFN-␥ inhibition of, cornea, conate treatment of visceral L. do- Hsp72 regulates oxidative stress-induced 5166 novani infection, 5383 HMGB1 translocation and release, High-mobility group box 1 CSF-1 and, macrophage cytokine profiles 7376 HMGB1-TLR4 signaling in HS-induced dependent on, 5245 Hsp90 inhibition of DCs, 7730 NAD(P)H oxidase activation, 6573 mice deficient in, produce macrophages Hsp90␤ antiapoptotic effect of CpG-B oxidative stress-induced, Hsp72 regulates and granulocytes and induce in- ODN, 6100 translocation and release of, 7376 flammatory responses, 6435 HEB, thymocyte proliferation blocked by release of, apoptosis and, LPS or poly(I:C) Granulocytes, produced by CSF-deficient E2A and, 5717 stimulated macrophages, 6495 mice, inflammatory responses and, Helicobacter pylori tanshinone IIA rescues mice from lethal 6435 gastric mucosa infected by, IL-21 produc- sepsis via, 3856 Granulomas, fusion of cells with macro- tion promotes gelatinase synthesis, Histamine receptors phages, induced by mycobacterial 5957 H4R activation induces Foxp3 T cells and lipomannan, 3161 NAP, promotes neutrophil adhesion, 1312 inhibits allergic asthma, 8081 Granulysin, mediates tumor rejection, trans- Hematopoiesis, mediated by SDGF-1␣ via UVB and, effect on allergic responses to genic mouse, 77 Tac1 and substance P, BM cells, inhaled antigens, 2794 Granzyme B, cell surface GluR3 eliminated 2075 Histamines, basophil release of, control and by TCR activation via, T cells, 683 Hematopoietic stem cell transplantation asthmatic subjects, 4584 Grass pollen allogeneic, immune reconstitution by sex Histone deacetylase 2, dissociation ER␣, allergen immunotherapy, IgA2 and muco- IL-1␣ ␤ ␤ steroid ablation, 7473 induced by 17 E2 induces sal TGF- responses, 4658 HLA-C-specific KIR, 3918 via ER␣, Sp1 and, 3059 murine allergy model, costimulation block- Heme oxygenase-1, induction by hydrogen HIV ade inhibits sensitization, 3924 peroxide, 3893 CD21 in establishment of extracellular Graves’ disease, aberrant expression of Hemopoiesis reservoir, LNs, 6968 IGF-1R by T cells from, 3281 cellular immunity and Drosophila, review, central and effector memory CD8 T cells GRO-␣. see Growth-related oncogene pro- 4711 specific for, differentiated by tein-␣ lymphopoiesis and, Nb and Nbl dispens- epitope cross-reactivity, 3750 Group B meningococcal capsules, peptide able for, 6746 DNA vaccines, CD8 T cell responses in- mimics of, induce protective anti- maintained by type I IFN and B cells dur- duced by, 2318 bodies after immunization, 4417 ing Pneumocystis lung infection, duration of exposure to, modulates mainte- Growth-related oncogene protein-␣, cortico- 6604 nance of HIV-specific memory steroids of, MKP-1 in, ASMC, Hemopoietic stem cells, adiponectin as CD4 T cells, 788 7366 Guanosine, inhibits CD40R expression in- growth factor, 3511 IL-7 in Fas-mediated T cell apoptosis dur- duced by cytokines and A␤, micro- Hemorrhagic shock, HMGB1-TLR4 signaling ing infection, 5340 glia, 720 in HS-induced NAD(P)H oxidase Nef activates T cells via lymphopenia, Guanylate-binding protein-1 gene, EC, selec- activation, 6573 5762 tively regulated by IFNs, 1122 Hemoxygenase-1, in inflammation response, simian (see also SIV) Gut-associated lymphoid tissue macrophages, 5921 CTL avidity/compartmentalization to fDCs in scrapie agent invasion from intes- Hepatic fibrosis, resolution of, SAMS as site of mucosal vaccination protects tine, 3757 source of MMP13 in, 5288 against CD4 T cell depletion, 7211 monocyte recruitment and activation in, Hepatitis B virus Tat regulation of IL-10 involves CaMK- oral salmonella infection, 5879 CD8 T cells specific for, suppressed by activated p38, Sp-1 and CREB-1, GVHD. see Graft-versus-host disease PD-1:PD-L1 interactions, 2714 monocytes, 798 GVL. see Graft-versus-leukemia chronic infection, myeloid DCs with up- HIV-1 regulated B7-H1 suppress T cell Ab-neutralized, transfer to CD4 T cells by H2-O, expression patterns in B cells and immune functions, 6634 DC-SIGN expressing cells, 3177 DCs, 1488 sensitizes hepatocytes to TRAIL-induced Ag variants in HIV-1 and antiviral capac- H4R. see Histamine receptors, H4R apoptosis via Bax, 503 ity of HIV-specific CTLs, 5513 H60, anaplastic anemia mediated by, amelio- Hepatocellular carcinoma CCR5 surface expression levels, T cells, rated by Treg cell infusion, 4159 AFP-specific CD4 T cell responses in pa- 5668 HAD. see HIV-1-associated dementia tient undergoing embolization, CD8 T cell repertoire specific for HLA- Haemophilus influenzae 1914 A2-restricted HIV-1 capsid epitope, non-typeable, lgtC expression modulates antitumor effects of suicide gene therapy 7756 resistance to C4b deposition on, with MCP-1, 574 cytoskeletal protein transformation in in- 1002 Hepatocytes fected macrophage giant cells, 6404 nontypable, C4BP interaction with serum CD8 T cell tolerance induction by Ag pre- defective Fc␥R-mediated phagocytosis, resistance of, 6359 sentation, 6849 infected human MDM, 1096 serotype b, characterization of IgD binding IL-22 induces LBP in, 5973 gp41 membrane proximal envelope site, 6316 P. berghei-infected, present CSP to CD8 T epitopes in 2F5 and 4E10 binding Hck, Fgr and, regulate responses to fMLP, cells, 7054 to, 4424 neutrophils, 3874 priming of IL-10-producing CD8 T cells HIV-2 and, circulating IL-7 and IL-7R␣ Heart by, facilitated by type I IFN-pro- expression, 3252 arachidonic acid mediates cardiac fibrosis ducing CD4 V␣14i NKT cells, IgG opsonization of, inhibits transfer to T associated with inflammation, re- 2083 cells, 7840 view, 641 sensitized by HBV to TRAIL-induced apo- IL-10-positive CD8 T cells specific for, autoimmune myocarditis promoted by ptosis via Bax, 503 suppress cytolysis and IL-2 produc- CpG, 3466 Hepititis C virus, TLR ligand-dependent na- tion by CD8 T cells, 3265 C5a blockade improves burn-induced car- ive CD4 T cell activation by pDC IL-22 in innate anti-HIV-1 host resistant diac dysfunction, 7902 impaired in infection, 4436 network using induction of acute- inflammatory disease, TLR4 and Tim-3 HER2/neu, engineered trastuzumab epitopes phase protein, 407 cross-regulation determines sex show antitumor activity against, infection by, NKp30 inducibility in chim- differences in, 6710 7120 panzee NK cells, 1702 8268 SUBJECT INDEX ͓VOL. 178

inhibited by gp120 vaccine-induced anti- Hypoxia-inducible factors TGF-␤ producing tumor cells evade im- bodies, 6596 HIF-1, cobalt chloride and hypoxia-medi- mune system via CD4ϩCD25- T memory B cell subset loss associated with ated IL-8 expression, ECs, letter, cell conversion to Treg cells, 2883 impaired immunization responses, 4707 Immune privilege, CD8 T cells mediate in- 8212 HIF-1␣, nickel triggers inflammatory and traocular tumor rejection via opsonization with complement enhances proangiogenic gene expression via TNF-␣, eye, 6115 DC infection and transfer to CD4 T NF-␬B and, 3198 Immune receptor expressed by myeloid cell cells via CR3 and DC-SIGN, 1086 HIF-1␣ in development of LPS-induced 1, associates with PI3K p85␣ sub- patients infected by, CD40 and impaired sepsis, 7516 unit, 808 CD154 induction in, CD4 T cells, Immune response genes, control of, Pillars of 1645 Immunology, 6675 ICAM-1. see Intercellular adhesion mole- preferentially harbored by CD16 subset of Immune responses cule-1 monocytes, 6581 adaptive, ROR ␥ controls Ig and cytokine IDO, TLRs in expression of, HGF, 1151 production in response to allergens, replication sites, CTL fail to accumulate ␥ at, lymphoid follicles, 6975 IFN- -inducible protein 10, TCR antagonizes 3208 specific antibody against, properties altered TEM mediated by, effector memory ␤1ARs impair immune cell innate re- by glycosylation, 7132 CD4 T cells, 3237 sponses to L. monocytogenes, 4876 ssRNA derived from, NK cells activated IFN-regulatory factors CD8 T cells, bleomycin hydrolase in Ag by, 7658 IRF2 regulates apoptosis via STAT1/3 and presentation and, 6923 Tat, CD40 ligand and, in inflammation, caspase-1 mechanisms, macro- cellular, hemopoiesis and, Drosophila, re- HAD, 3226 phages, 3602 view, 4711 Tat elicits mitochondrial hyperpolarization IRF3, TLR ligation-induced IL-27 depen- fetal, P. falciparum Ags, Cameroon, 2770 and respiratory deficit, cortical neu- dent on, DCs, 7607 flexibility of memory T helper cells, 4080 rons, 869 IRF5 and IRF7, DC production of IFN FoxP3 Treg cells in control of, 6901 transfer from DCs to CD4 T cells, role of type I induced by IgG-RNA im- human TLR1 P315L SNP impairs innate Src and Syk, 2862 mune complexes is dependent on, immunity to microbial components, HIV-1-associated dementia, CD40L and 6876 6387 HIV-1 Tat in inflammation, 3226 Ig-like transcripts humoral Ag-driven, B cells in, inflamma- HIV-1 pox virus, mucosal immunization in- ILT3 inhibits T cell responses in cancer tory myopathies, 547 duces high-avidity CD8 T cells patients, 7432 IL-7 in control of contraction of responses, with specific cytokine/granzyme B ILT5 and ILT2 receptors for bacteria, CD4 T cells, 4027 profiles, 2370 4250 impaired host defense in ONZIN-deficient ␣ HIV-2, HIV-1 and, circulating IL-7 and IL- Igh locus, Ig VDJC transcription does not mouse, 5132 induced by immunization with WNV en- 7R␣ expression, 3252 require hs4, 6297 velope domain 3 protein, 2699 HIV/AIDS, early Gag-specific CD8 T cell IglC gene, expression modulates resistance to innate, C1q and C3 in, to S. pneumoniae, recognition of infected cells, 2746 C4b deposition on non-typeable H. CNS, 1861 HLA, class II variation in modulating sever- influenzae, 1002 ␬ innate, mediated by RICK via Nod1 and ity of streptococcal sepsis, 3076 I B kinases Nod2, 2380 HLA-A, HLA-B and, KIR3DL1 interactions alcohol exerts anti-inflammatory effects via innate, PI3K signaling protects via C5a- with, 33 p65 phosphorylation and inhibition mediated activation of, spepsis, HLA-B, HLA-A and, KIR3DL1interactions of, monocytes, 7686 5940 with, 33 B cells sensitized to TRAIL via c-FLIP by innate, to E. coli pneumonia, role of TRIF, HLA-C, KIR specific for, role in HSCT, inhibition of, MCL, 1923 I␬B␣, mutated, effect of NF-␬B activation lung, 3153 3918 innate, to LPS, amplified by iNKT cells, HMGB1. see High-mobility group box 1 on DCs expressing, 1301 I␬B␣ in simvastatin potentiated TNF-␣- 2706 Homeostasis to LCMV infection, suppressed by anti- CD8 virus-specific T cells, IFN-␥ and, induced apoptosis, 2507 IKK␣ and IKK␤ in ERK-dependent regu- CD40, 1662 7616 modulation and tolerance induction by high lation of MUC5AC transcription, S. CD11b DCs, chemokines production in, RelB-silenced DCs, 5480 pneumoniae, 1736 lung, 1882 MyD88 signaling essential for, experimen- IL-1 receptor-associated kinase 4, human, memory CD8 T cells, Treg cell-dependent tal brain abscess, 4528 crystal structure, 2641 CD25 function, 1251 NKDCs are innate immune responders to IL-2 gene, regulated by NF-ATc2, T cells, mucosal, secretory IgA in, review, 27 L. monocytogenes, 4411 SLE, 1960 Homing, receptors, Foxp3 T cell develop- paratope plasticity and Ab responses and, ment of, 301 IL-2-inducible T cell kinase, regulates human molecular mimicry, 7923 Human gingival fibroblasts, TLRs in expres- NK cell-mediated cytotoxicity, primary, to foreign Ag, controlled by Treg sion of IDO and IL-8, 1151 3575 cells, 2961 Human papilloma viruses Ileitis, mouse, commensal bacteria exacerbate properties of specific antibody against HIV DC HPV VLP uptake mediated by Fc␥R intestinal inflammation, 1809 altered by glycosylation, 7132 in induction of HPV-specific T ILTs. see Ig-like transcripts pulmonary, suppressed by F. tularensis cells, 7587 Imatinib mesylate, Ag-specific memory CD8 Schu4, 4538 HPV16, TLR9 expression and function T cell responses inhibited by, 2028 regulated by MyD88 during RSV infec- abolished by, 3186 Immune check points tion, DCs, 5820 Hydrogen peroxide, in NF-␬B activation, CD18 and, intestinal T cells, 2104 SmD peptide induces Ab responses within 3893 effector/memory T cells, antigen density snRNPs, 2565 Hyperoxia, mortality induced by, acute lung and, 2307 TCR␣␤ CD8␣␣ IELs express genes down- injury and, IL-13 deficient mouse, Immune complex regulating Ag reactivity, 4230 4993 C1q augments presentation to CD8 T cells, Th1- and Tc1-biased, promoted by NK1R Hyperoxic acute lung injury, mortality in 7581 signaling, LCs, 7006 IL-13 null mouse, 4993 circulating GM-CSF and, during sodium TLR3 essential for immunity induction to

Hyperthermia, T cell persistence controlled stibogluconate treatment of visceral PTV by dsRNA and poly(I:C12U), by, role of c-FLIPs degradation, L. donovani infection, 5383 5200 3944 monocytes stimulated by, TNF-like cyto- against tumors, targeting of CD40 Ag in- Hyporesponsiveness, Ag-specific, caused by kine production by, RA, 7325 duces, 4169 disruption of innate-mediated Immune evasion virus-specific memory CD8 T cell re- proinflammatory cytokine and CD4CD25 Treg cells in mechanisms of, B sponse elicited by CD4 T cells dis- ROS-signal 3, 908 cell lymphomas, 6840 playing viral epitopes, 5465 2007] SUBJECT INDEX 8269

Immune surveillance human VDJ rearrangements, lack of strand CD43 and PSGL-1 mediate E-selectin- 4–1BB ligand in, gammaherpes virus, specificity, somatic hypermutations, dependent T cell migration, skin, 5227 4322 2499 tumors, role of eosinophils, 4222 IgA, secretory, role in mucosal homeosta- CD44 regulates LPS-TLR signaling and, Immune synapses sis, review, 27 macrophages, 2469 CD4 T cell formation of, vitamin E re- IgA, Fc␣RI alleles determine proinflam- CNS responses, peroxynitrite-dependent verses age-associated decline in, matory potential, 3973 pathway causes BBB permeability 1443 IgA2, mucosal responses of TGF-␤ and, changes, 7334 extracellular CD6 isoforms regulate target- grass pollen immunotherapy, 4658 controlled via NF-␬B pathway, airway ing to, 4351 IgD, characterization of binding site, H. epithelial cells, 6504 Immunization influenzae serotype b, 6316 CSF-deficient mice produce macrophages with BM-DCs, administration route deter- IgE, IL-4 production dependent on, in- and granulocytes and, 6435 mines integrin expression and dis- duced by IPSE/alpha-1, basophils, dampened by PD1, asthma, 496 tribution of CD8 T cells, 1512 6023 effect of TIM on T cell immune responses, BORIS, elicitation of T cell tumor re- IgE and IgA containing BCRs, signaling lung, 2249 sponses following, 566 capacities, 2901 Fc␣RI alleles determine proinflammatory mucosal, HIV-1 pox virus, induces high- IgE modulates neutrophil survival, asthma, potential, 3973 avidity CD8 T cells with specific 2535 IFN-␥ alters responses, B. burgdorferi- cytokine/granzyme B profiles, 2370 IgE responses mediated by CD8 T cells, activated endothelium, 1172 mucosal protection by parenteral immuni- IL-18 in suppression of, 4771 inflammation-seeking homing by CD4 ef- zation dependent on T cell geogra- IgG, autoantibodies specific for determi- fector T cells, 8073 phy, 2387 nants on, RA sera, Pillars of Immu- intestinal, BTNL2 as negative costimula- peptide mimics of MenD CP induce pro- nology, 1227 tory molecule, 1523 tective antibodies after, 4417 IgG, high molecular weight protein com- intestinal, exacerbated by commensal bac- Immunodeficiencies, human, biological roles ponent in serum, RA, 1229 teria, murine ileitis, 1809 of CD3 chains revealed by, 2556 IgG H chain repertoire, human preterm intestinal, suppressed by lamina propria Immunoglobulin receptors and term neonates, 1180 CD4CD25 Treg cells, 4937 ␥ Bcl10 controls TCR- and Fc R-induced IgG opsonization of HIV inhibits transfer intrauterine, PDE-4 inhibitors prevent pre- actin polymerization, 4373 to T cells, 7840 term delivery induced by, 1115 effect of neonatal FcR blockade, EAMG, IgG2a, CSR determined by TLR9, B cells, macrophage response involves adenosine, rat, 5390 HO-1, CO and A2aR, 5921 ␣ 2415 Fc RI, alleles determine proinflammatory IgM, pathogen-specific responses, role of Mkp-1 gene knockout, enhances inflamma- potential, 3973 MyD88 and Btk, 3740 tory responses to gram-positive Fc⑀R, AP-1 induced by, Bcl10 essential bacteria, 5312 IgM, tetrameric, transported by PIgR into for, mast cells, 49 nickel triggers inflammatory and proangio- skin, teleost fish, 5682 Fc⑀RI aggregation, connective tissue-like genic gene expression via NF-␬B Immunological synapses mast cell survival promoted by, and HIF-1␣, 3198 CD4 T cells, regulated by CTLA-4, 5543 4177 PGE proinflammatory effect mediated via NK cell inhibitory signals suppress 2 Fc␥R, macrophages and complement in IL-23 to IL-17 axis, experimental NKG2D recruitment to GM1-rich CRP-mediated suppression of neph- IBD, 8138 domains at, 5606 rotoxic nephritis, 530 proinflammatory and immunomodulating Immunotherapy Fc␥R, DC HPV VLP uptake mediated by, properties of visfatin, 1748 cytokine-based, CD4 TI Treg cells limit in induction of HPV-specific T reduced by CD47 and TSP interactions, effectiveness of, 3400 cells, 7587 5930 Fc␥R, TL1A induced by, DCs and mono- effects on B7 family, allergic inflamma- regulated by resolvin E1 via BLT1 and cytes, 4033 tion, 1931 ChemR23, 3912 ␥ grass pollen allergen, IgA2 and mucosal Fc R on DCs, bacterial Ag presentation ␤ STBM in systemic inflammatory priming, enhanced by CRP via, 7283 TGF- responses, 4658 pregnancy and preeclampsia, 5949 Fc␥RII and Fc␥RIII costimulation, re- IgE-mediated fish allergy, parvalbumin TLR2 mediates neuroinflammation and quired for novel Ab-defense against hypoallergenic mutant for, 6290 neuronal damage, 6476 malaria, monocytes, 3099 of tumors with capsaicin, 3260 Inflammatory bowel disease, experimental, ␥ Infection Fc RIIA, transmembrane mutation affects PGE2 proinflammatory effect medi- lipid raft association, 3048 experimental brain abscess, MyD88 signal- ated via IL-23 to IL-17 axis, 8138 Fc␥RIIB, regulates primary AFC B cell ing essential for immune response, Inflammatory disease, heart, TLR4 and activity, 897 4528 Tim-3 cross-regulation determines Fc␥RIIB on DCs enforces peripheral toler- host Tyk2 in contraction of Ag-specific sex differences in, 6710 ance via effector T cell inhibition, CD8 T cells, mouse, 4482 Influenza A virus 6217 Inflammation activates TLR3- and RIG-1-dependent an- Fc␥RIIb on leukocytes, expression profile alcohol exerts anti-inflammatory effects via tiviral responses, lung epithelial in SLE, 3272 IKK inhibition and p65 phosphory- cells, 3368 FcR ␥ chain, complexes of MAIR-II with lation, monocytes, 7686 CD8 T cells specific for, hidden epitopes DAP-12 and, peritoneal macro- allergic, airway epithelial STAT3 required in secondary responses, 3091 phages, 765 for, mouse asthma model, 6191 CD8 T cells specific for, survival in liver, FcR␥ on APCs in allergen-induced AHR, allergic, effects of immunotherapy on B7 2737 480 family in, 1931 CD8 virus-specific T cell homeostasis and ligand-Fc⑀RI interactions and LAT phos- allergic airway, SR-AI/II and MARCO IFN-␥, 7616 phorylation, kinetic proofreading, limit DC migration and, 5912 cold-adapted, elicits long-lived protection 3530 anti-inflammatory effects of IFN-␥ in mu- against supralethal challenge, 1030 natural selection and interactions of rine autoimmunity, 134 effector and memory T cells specific for, IgA-Fc with Fc␣RI and bacterial arachidonic acid mediates cardiac fibrosis in vivo cytotoxicity threshold, 1285 decoy proteins, 7943 associated with, review, 641 MEM71, infection causes B cell responses polymeric, conserved binding interactions asbestos-induced, modulated by NF-␬B via type I IFN, respiratory tract, between J chain and, humans and activation, airway epithelial cells, 1457 amphibians, 1589 1800 neutrophil defensins increase phagocytosis Immunoglobulins CD8 T cells required for, cigarette-smoke- of, 8046 DCs defective in repressing secretion of, induced emphysema, 8090 phagocytosis of apoptotic cells infected by, lupus-prone mouse, 4803 CD40L and HIV-1 Tat in, HAD, 3226 neutrophils and macrophages, 2448 8270 SUBJECT INDEX ͓VOL. 178

Influenza virus IFN-␣, CpG-A- and CpG-C-ODN-induced, Influenza virus infection causes B cell Ag depots do not induce cytotoxic re- inhibited by TLR7 ligands, pDCs, responses via, respiratory tract, sponse, CD8 T cells, 7563 4072 1457 B cell responses to, TLRs and, effector T IFN-␣ inhibits cerebral malaria and re- insect baculoviruses potentiate mamma- cells, 2182 duces parasite burden, mouse, 6416 lian immune responses via, 2361 collagen distribution and integrin expres- IFN-␤, DCs preactivated by, sensitization NF-␬B subunits in virus-induced expres- sion on CD4 and CD8 T cells dur- to TLR7 agonists, 6208 sion, 6770 ing infection, 4506 IFN-␤, transcriptional network, humans, required for Ab response to adenovirus, DCs infected by, NKp46 and NKG2D rec- 5076 CD4 T cells and B cells, 3505 ognition required for NK cell acti- IFN-␥ response to M. tuberculosis requires vation, 2688 in activated DCs induction of Th1 re- ESX-1 secretion system, 3143 Information management, antibody-antigen sponse from Th2-polarized T cells, signaling essential for host resistance database, letter, 4705 3583 against pathogenic bacteria, 3126 Innate immune system, in allograft rejection airway MCH resolution by, STAT1 and signaling in LPS-induced IL-10 produc- and tolerance, review, 7503 Bax in, 8107 tion, role of macrophages, 6705 Innate immunity alters inflammatory response, B. burg- zIFN, TICAM1 function in vertebrates, FADD-regulated Irf7 in signaling, 2429 dorferi-activated endothelium, 1172 4517 in innate defense and adoptive immunity, anti-inflammatory effects in murine au- Interleukin 1 psoriasis, 2229 toimmunity, 134 cloning of, new era in cytokine biology, TLR-2-mediated survival of S. aureus in CD8 virus-specific T cell homeostasis Pillars of Immunology, 5411 macrophages, 4917 and, 7616 human monocyte, nucleotide sequence of Insulin, T cells specific for, recognize insulin CpG-induced IL-10 regulated by, BM- precursor cDNA, Pillars of Immu- MHC-binding segment, NOD nology, 5413 mouse, 6051 derived DCs, 211 CXCL10 and CCL5 induced by, Ptx Interleukin 1 receptor antagonist, soluble, Insulin like growth factor 1 receptor, aberrant PI3Ks regulate production in expression by T cells from Graves’ with, promote T cell entry to CNS, 8175 monocytes, 446 disease, 3281 Interleukin 1␣, induced by PGE , colon can- Insulin receptor substrate 2, DM type 2 im- deficiency, EAMG susceptibility in IL- 2 12/IL-23/IFN-␥-deficient mice, cer cells, 4097 pairs PI3K mediation by, macro- ␣ ␤ 7072 Interleukin-1 gene, induced by 17 E2 in- phages, 6886 duces via ER␣, Sp1 and dissociat- Integrins effects of CD40L and, on FPRL2, mi- ␣ ␣ ␤ croglia, 1759 ing HDAC2 from ER , 3059 1 1, regulation of cell adhesion by affin- ␤ functional signatures of IL-2 and, Mtb- Interleukin 1 ity and conformational unbending, increases intestinal epithelium TJ perme- 6828 specific T cells, 5217 ability, 4641 ␣ ␤ , SDF-1␣ triggers increases in affinity gene expression induced by, inhibited 1 1 induced by alum adjuvants, 5271 of, 3903 by T. gondii, fibroblasts, 5154 PI3Ks regulate production in monocytes, ␣ ␤ and ␣ ␤ , expression on CD4 and gene expression inducible by, regulated 1 1 2 1 446 CD8 T cells during influenza infec- via JAK/STAT pathway, choriocar- ursolic acid-induced release of, role of tion, 4506 cinoma cells, 1598 CD46, peritoneal macrophages, ␣ ␤ immune check point responses and, Gpnmb gene induced by LPS and, mac- 1 2, 4854 intestinal T cells, 2104 rophages, 6557 Interleukin 2 ␣ ␤ and ␣ ␤ , mediate MMP-9 expres- IL-12 and IFN-I synergise for produc- 5 1 v 5 functional signatures of IFN-␥ and, Mtb- sion and fibronectin- and vitronec- tion of, CD4 T cells, 4498 specific T cells, 5217 tin-induced microglial activation, IL-12 in production of, coronary athero- production by CD8 T cells suppressed by EAE, 8158 sclerosis, 592 ␤ , in granuloma/macrophage fusion in- HIV-specific IL-10-positive CD8 T 1 IL-15 enhances IL-12/IL-18 pathway for cells, 3265 duced by mycobacterial lipoman- secretion of, memory CD8 T cells, nan, 3161 production inhibited by cytokine-depen- 4786 dent Blimp-1 expression, T cells, expression of, determined by BM-DCs induces CysLTR2 and enhances respon- immunization administration route, 242 siveness to CysLTs, ECs, 5262 production response, predicted by down- CD8 T cells, 1512 peptide mimetics therapeutic for lethal ␣ ␤ , C. albicans Pra1p as ligand for, stream quantitative TCR network M 2 vaccinia virus infection, 4576 signals, 4984 2038 production controlled by CD152, CD8 T mediate response to pathogen-associated regulates Th17 and Treg cells, tumor mi- cells, 2132 croenvironment, 6730 molecular pattern, PMNs, 7276 production via epigenetic and transcrip- Intercellular adhesion molecule-1 regulating distribution of thymic and pe- tional programs, ␥␦ T cells, 2730 expression on multiple cell types required ripheral CD4CD25 Foxp3 T cells, in protection against cerulein-induced for EAE development, 851 4062 pancreatitis via NF-␬B repression, induction by NAC and mito-Q via gluta- TGF-␤ and, in conversion of naive 7385 - thione, 1835 CD4CD25 T cells to CD25 Foxp3 TGF-␤ suppresses IFN-␥-driven role in activated DCs induction of Th1 Treg cells, 2018 response from Th2-polarized T STAT1-dependent gene expression, in TGF-␤ induction of Foxp3 Treg cells, cells, 3583 epithelial cells, 4284 4022 Interferon ␣␤. see Interferons, type I STAT3-dependent induction of CXCL11 Interleukin 2 promoter, proximal, p300 and Interferon receptors gene expression, 986 CREB at, T cells, SIV-resistant IFN␣␤, VLP displaying VSV glycoprotein type I sooty mangabeys, 7720 induce switch to neutralizing IgG antitumor responses and, NK cells, 7540 Interleukin 2 receptor, in OX40-mediated Abs, 5839 DC production of, induced by IgG-RNA CD4 T cell differentiation, 7694 zebrafish, origin of vertebrate IFN system, immune complexes is IRF5 and Interleukin 2 receptor ␣. see CD25 4385 IRF7 dependent, 6876 Interleukin 2 receptor ␤, STAT5 activation Interferon regulatory factors, NF-␬B and, hemopoiesis maintained by B cells and, dependent on, required for Foxp3 regulate CCL19 expression in during Pneumocystis lung infection, Treg development, 280 monocyte-derived DCs, 253 6604 Interleukin 4 Interferons IL-12 and, synergise for IFN-␥ produc- Fyn/PI3K and p38 activation regulates antitumor activity of immune effector cells tion by CD4 T cells, 4498 production of, BM-derived mast induced by, regulated by SOCS, inflammatory arthritis effector phase cells, 2549 4832 suppression by dsRNA mediated IgE-dependent production of, induced by EC genes selectively regulated by, 1122 by, 2204 IPSE/alpha-1, basophils, 6023 2007] SUBJECT INDEX 8271

IL-12 enhances production of, iNKT cells, Interleukin 10 Interleukin 13 5435 CD8 T cells producing, type I IFN-produc- critical in fibro-obliterative process, BOS, induction by TSLP, CD4 T cells, 1396 ing CD4 V␣14i NIT cells facilitate 511 Lyn-dependent alternate BCR signaling hepatocyte priming of, 2083 in maturation and function of DCs and pathway induced by, 4726 CpG-induced, regulated by IFN-␥, BM- CD4 Th2 cells, 219 in maturation and function of DCs and derived DCs, 211 mediates IL-9 activities, lung epithelial CD4 Th2 cells, 219 EAE recovery requires B cell regulation of cells, 3244 resistance to, induced by DM type 2 im- CD4CD25 Treg cells and, via B7, mice deficient in, increased hyperoxia- paired IRS-2-mediated PI3K, 6886 3447 induced mortality and acute lung S1P1 mediates enhanced production of, T enhanced production by TLR4- and TLR2- injury, 4993 cells, transgenic mouse, 4885 primed DCs, 6173 ␤ TGF- 1-dependent fibrosis triggered by, STAT6 in CCL23 induction by, mono- HIV-Tat regulation of, involves CaMK- TNBS-induced colitis, 5859 cytes, 4335 activated p38, Sp-1 and CREB-1, Interleukin 15 ␣ Interleukin 4 receptor , in maturation and monocytes, 798 abrogates vaccine-induced decreases in function of DCs and CD4 Th2 immunity to T. spiralis controlled by Treg ␤ virus, SIVmac251-infected macaques, cells, 219 cells, TGF- and, 1039 3492 Interleukin 5 immunomodulatory effects of viral TLR in accumulation of CTLs, SIV-infected coexpression of eotaxin-2 and, eosinophil- ligands dependent on IL-12 and, brain, 5812 dependent murine asthma model experimental asthma, 7805 enhances IL-12/IL-18 pathway of IFN-␥ created by, 7879 induces IL-10 via STAT3, monocyte-de- secretion, memory CD8 T cells, eosinophils in tumor immune surveillance, rived macrophages, 4779 4786 4222 LPS-induced CD4 Treg cells producing, ␣ mice deficient in, Bcl-2 restores cell num- IL-5R -chain and, expressed by B-1a B suppress CD8 T cell responses, ␥␦ cells elicited by nasal cholera toxin, 5429 bers of TCR i-IELs, 757 6058 LPS-induced production of, macrophages Interleukin 17 Interleukin 5 receptor, ␣-chain, IL-5 and, in IFN type I signaling and, 6705 CD4 Th cells producing, distribution of, PLP 139–151-induced EAE, 1372 expressed by B-1a B cells elicited mDC exposure during maturation deter- - - by nasal cholera toxin, 6058 mines longevity, 7794 CD4CD25 Foxp3 T cells differentiate into Interleukin 6 regulates enterohepatic CD4 T cell migra- Th17 cells, 6725 Bcl10 essential for production of, mast tion, 7974 PGE2 proinflammatory effect mediated via cells, 49 stimulated by SDF-1 via AP-1, 1581 IL-23 to IL-17 axis, experimental DC-produced, CD4CD25 T cell regulatory suppressive Treg cell mode via B7-H4 IBD, 8138 functions inhibited by, lupus-prone induction via, APCs, letter, 4705 regulates immune responses to M. bovis mouse, 271 in susceptibility to M. avium infection, BCG, 3786 fiber-modified Ad vectors decrease liver 8028 STAT3 and STAT4 in development of Th toxicity via reduction of, 1767 TGF-␤ induction by, CD4CD25 T cell cells which secrete, 4901 genes induced by, STAT3 recruitment de- regulation of allergic responses V␦1 ␥␦T cells control neutrophil infiltra- pendent on BRG1 gene, 345 depends on, lung, 1433 tion after E. coli infection via, induced by pertussis toxin, promotes IL- Interleukin 12 4466 17-producing CD4 cell generation, alters functional profile of tumor-associ- Interleukin 18 6123 ated macrophages, 1357 IL-15 enhances IL-12/IL-18 pathway of induction by hydrogen peroxide, 3893 deficiency, EAMG susceptibility in IL-12/ IFN-␥ secretion, memory CD8 T inhibition by dectin-1 interaction with tet- IL-23- and IFN-␥-deficient mice, cells, 4786 raspanin CD37, 154 7072 IL-18R␣ and, in pathogenesis of CS-in- in tumor exosome inhibited differentiation effect on signal 3 and T cell responses to duced emphysema, 1948 of BM DCs, 6867 solid tumors, 6752 innate immune CD4 T cell activation de- Interleukin 7 enhances IL-4 production, iNKT cells, pendent on, salmonella-infected in control of contraction of responses, 5435 mouse, 6342 ␥ CD4 T cells, 4027 in IFN- production, coronary atheroscle- release induced by alum adjuvants, 5271 essential for development of colitis, 4737 rosis, 592 in suppression of IgE response mediated ␣ ␥ expression of IL-7R and, in HIV-1 and IFN-I and, synergise for IFN- production by CD8 T cells, 4771 HIV-2, 3252 by CD4 T cells, 4498 Interleukin 18 receptor ␣, IL-18 and, in in Fas-mediated T cell apoptosis, HIV in- IL-15 enhances IL-12/IL-18 pathway of ␥ pathogenesis of CS-induced em- fection, 5340 IFN- secretion, memory CD8 T physema, 1948 IL-7/STAT5 signaling pathway and sur- cells, 4786 Interleukin 20, in innate defense and adop- vival of naive CD4 T cells, 262 immunomodulatory effects of viral TLR tive immunity, psoriasis, 2229 induces myelopoiesis and erythropoiesis, ligands dependent on IL-12 and, Interleukin 21 1553 experimental asthma, 7805 BAFF/BLys and, in PC differentiation intracellular domain in T cell development, PPAR-␥ agonists suppress IL-12 family from memory B cells, 2872 228 cytokine production, activated glia, blockade with IL-21R.Fc reduces progres- Interleukin 7 receptor ␣ 1904 downregulated by DNA methylation, T release of, TLRs in differential regulation sion, lupus-prone mouse, 3822 cells, 5473 of, in DC and macrophage response blocks Treg cell-mediated suppression of expression of IL-7 and, in HIV-1 and to Mtb, 5192 CD4 T cells, 732 HIV-2, 3252 role in activated DCs induction of Th1 NKT cell production of, modulates NKT Interleukin 8 response from Th2-polarized T cell activation and cytokine produc- HIF-1 in cobalt chloride and hypoxia-me- cells, 3583 tion, 2827 diated expression of, ECs, letter, self-Ag-specific human CD8 T cytolytic T production promotes gelatinase synthesis, 4707 cell cytotoxicity controlled by, H. pylori-infected gastric mucosa, induced by Pen c 13 via PAR-1 and 3566 5957 PAR-2, airway epithelial cells, systemic administration of IL-23 induces promotes differentiation of naive CD8 T 5237 antitumor immunity via Th1 re- cells, 7640 latent tuberculosis infection characterized sponse and, 7571 Interleukin 21 receptor fusion protein, IL-21 by mRNA of FOXP3, IL-12␤ and, Interleukin 12␤, latent tuberculosis infection blockade with IL-21R.Fc reduces 3688 characterized by mRNA of FOXP3, progression, lupus-prone mouse, TLRs in expression of, HGF, 1151 IL-8 and, 3688 3822 Interleukin 9, activity mediated by IL-13, Interleukin 12p80, DCs, in susceptibility to Interleukin 22 lung epithelial cells, 3244 cutaneous leishmaniasis, 7251 induces LBP in hepatocytes, 5973 8272 SUBJECT INDEX ͓VOL. 178

in innate anti-HIV-1 host resistant network JAK, IFN-␥-inducible gene expression regu- Lampreys, properties of TLRs, 397 using induction of acute-phase pro- lated via JAK/STAT pathway, cho- Langerhans cells tein, 407 riocarcinoma cells, 1598 PPAR␣ activation inhibits function of, Interleukin 23 JAK-STAT pathway, input and output inte- 4362 critical role in induction phase of EAE, gration, review, 2623 Th1- and Tc1-biased immune responses 2589 JM-C. see Junctional adhesion molecule-C promoted by NK1R signaling, 7006 deficiency, EAMG susceptibility in IL-12/ Junctional adhesion molecule-C, neutrophil TLR2, TLR4 and TLR5 loss abolishes IL-23- and IFN-␥-deficient mice, transmigration is independent of, bacterial recognition by, 1986 7072 5789 LAP. see Latency-associated peptide induced by F. tularensis, monocytes, 4445 LAT. see Linker for activation of T cells PGE2 proinflammatory effect mediated via K-ras gene, modulates c-kit-mediated cellular Latency-associated peptide, expressed by IL-23 to IL-17 axis, experimental functions, mast cells, 2527 DCs, 4017 IBD, 8138 Keratinocyte-derived chemokine LBP. see Lipopolysaccharide-binding protein systemic administration induces antitumor C3a required for CXC chemokine produc- Lck, CD45 in regulation of, thymic develop- immunity via IL-12 and Th1 type tion after renal I/R, PTEC, 1819 ment, 2056 response, 7571 CXCL16 and, ADAM10 shedding of, de- Legionella pneumophila, Naip5/Birc1e re- Interleukin 23 p19 gene, c-Rel in TLR-in- tachment of adherent leukocytes stricts growth of, 8022 duced expression of, DCs, 186 facilitated by disintegrin and, 8064 Leishmania amazonensis, infection activates Keratinocytes Interleukin 27, TLR ligation induced by, de- MAPK and ERK, macrophages, activated by OSM secretion by skin infil- pendent on IRF3, DCs, 7607 1077 trating T cells, 4615 Interleukin 28, elicits antitumor responses to Leishmania donovani, visceral infection, cir- skin, cytokine induction of TSLP, 3373 fibrosarcoma, mouse, 5086 culating IC and GM-CSF during KI3DS1 gene, encodes DAP12-associated Intestinal epithelial cells sodium stibogluconate treatment, DMBT1 gene regulation via NOD2 and receptor, NK cells, 647 Kidneys 5383 TLR4 modulates bacterial invasion, Leishmania major 8203 B1a cell and NKT cell autoantibody pro- duction and renal disease associ- DC IL-12p80 in susceptibility to cutaneous Gb-3 negative, EHEC Shiga toxin inhibits leishmaniasis, 7251 PI3K/NF␬B pathway, 8168 ated with NZB chromosome 4, mouse, 1608 DC STAT1 required for immunity to, Intestinal epithelium 7259 CCL25-deficient lamina propria and, im- C3a required for CXC chemokine produc- tion after renal I/R, PTEC, 1819 Leprosy, SNP impairs TLR1 trafficking, pro- paired accumulation of CD8 Ag- tects against, 7520 specific T cells, 7598 lupus nephritis abrogation in AID-deficient mouse, 7422 Lethal shock, TNF-induced, mapping of re- RAGE mediates neutrophil migration ␥ sistance of DBA/2 mouse, 5069 across, 2483 macrophages, complement and Fc Rin CRP-mediated suppression of neph- Leukocyte Ig-like receptor-1 Intestine rotoxic nephritis, 530 human, UL18 inhibits LIR-1ϩ and acti- inflammation of, exacerbated by commen- NKT cell activation mediates neutrophil vates LIR-1- NK cells, 4473 sal bacteria, murine ileitis, 1809 IFN-␥ production and renal I/R role of UL18 in response to CMV in, 3536 inflammation of, BTNL2 as negative co- injury, 5899 Leukocytes stimulatory molecule, in, 1523 TLR2 expressed in, role in ischemic renal adherent, detachment facilitated by disinte- Intracellular trafficking, adenoviruses directed injury, 6252 grin and ADAM10 shedding of to lysosomes by PU.1, alveolar Killer cell Ig-like receptors CXCL1 and CXCL16, 8064 macrophages, 2440 HLA-C-specific, role in HSCT, 3918 alefacept signaling in, psoriasis patients, Intracranial antigen, cross-presented, CD8 T KIR2DL5, expression on NK and T cell 7442 cells primed by, 6038 surfaces, 4402 Intraepithelial lymphocytes degranulation regulated by PKG and PI3K, Killer cell lectin-like receptor G1, associated 416 intestinal, Bcl-2 restores cell numbers of with NK cell maturation and ho- ␥ TCR␥␦ i-IELs, IL-15 deficient Fc RIIb expression profile on, in SLE, meostasis, 4764 3272 mouse, 757 Kinetic proofreading, ligand-Fc⑀RI interac- ␣␤ ␣␣ inhibit A. fumigatus conidial growth via TCR CD8 , express genes downregu- tions and LAT phosphorylation, lating Ag reactivity, 4230 lactoferrin-mediated iron depletion, 3530 6367 Ionizing radiation, apoptosis induced by, KIR. see Killer cell Ig-like receptors Mcl-1 depletion in, macrophages, integrins mediate response to pathogen- KIR3DL1, interactions between HLA-A, associated molecular pattern, 7276 2923 HLA-B and, 33 ␥ migration, LPS-stimulated cytokine release IP-10. see IFN- -inducible protein 10 KIR3DL1/S1 receptor, polymorphism of, on and, regulated by macrophages and IPSE/alpha-1, induces IgE-dependent IL-4 NK cells, 235 ATII epithelial cells, 463 production, basophils, 6023 KLF13. see Kru¨ppel-like factor 13 Leukotriene B , triggers antimicrobial agent IREM-1. see Immune receptor expressed by KLOTHO gene, in CD4 lymphocyte normal 4 release, PMNs, 8036 myeloid cell 1 and RA-related aging, 771 Leukotriene B receptor 1, inflammation reg- Irf7 gene, regulated by FADD, role in innate KLRG1. see Killer cell lectin-like receptor 4 immune signaling, 2429 G1 ulated by resolvin E1 via ChemR23 Iron, lactoferrin-mediated depletion of, KRN7000, improves diabetes outcomes, and, 3912 PMNs inhibit A. fumigatus conidial NOD mouse, 1415 LFA-1, NK cell adhesion mediated by, regu- growth, 6367 Kru¨ppel-like factor 2, controls T cell traffick- lated by Ly-49 receptors, 1261 Ischemia, renal injury, TLR2 expressed in ing via L-selectin and S1P1, 7632 LGP2, loss of, manifests disparate antiviral kidneys, 6252 Kru¨ppel-like factor 13 responses, 6444 Ischemia/reperfusion injury PRP4 interaction with, regulates CCL5, T LILRB1. see Leukocyte Ig-like receptor-1 myocardial, PI3K mediates protection cells, 7081 Linker for activation of T cells, phosphoryla- against, TLR-4 deficient mouse, regulates T cell survival, 5496 tion of, ligand-Fc⑀RI interactions 7317 and, kinetic proofreading, 3530 renal, NKT cell activation mediates neu- Lactoferrin, iron depletion mediated by, Lipid rafts trophil IFN-␥ production and, 5899 PMNs inhibit A. fumigatus conidial association of, affected by Fc␥RIIA trans- Isolated lymphoid follicles, LT-independent growth via, 6367 membrane mutation, 3048 stromal cell TRANCE expression, Lamina propria, CCL25-deficient intestinal free cholesterol alters structure of, role in 5659 epithelium and, impaired accumula- regulating neutrophil activation, Itk. see IL-2-inducible T cell kinase tion of CD8 Ag-specific T cells, 5253 Ixodes scapularis, Salp15, inhibits develop- 7598 TLR4, ethanol and, mechanisms of ethanol ment of experimental asthma, 7064 Lampetra japonica, properties of TLRs, 397 action, review, 1243 2007] SUBJECT INDEX 8273

Lipids DCs generated by CD11c MHC class II Lymphopoiesis, hemopoiesis and, Nb and CD1-restricted ␥␦ T cell recognition of precursors, letter, 2609 Nbl dispensable for, 6746 lipid antigens, 3620 DCs mediate anthrax spore entry, 7994 Lymphotoxin, stromal cell expression of endosomal trafficking and presentation of effect of TIM on T cell immune responses, TRANCE independent of, crypto- autoantigens and, by CD1d, 6181 2249 patches, ILFs and Peyer’s patches, Lipomannan, mycobacterial, induces granu- epithelial cells, influenza A virus activates 5659 loma macrophage fusion, 3161 TLR3- and RIG-1-dependent anti- Lyn, IL-4-induced alternate BCR signaling Lipopolysaccharide viral responses, 3368 pathway dependent on, 4726 augments TNF-␣ production, macro- epithelial cells, IL-13 mediates IL-9 activi- Lysophospholipids, mobilize secretory vesi- phages, T2D mice, 663 ties, 3244 cles and induce signaling via G2A, CD44 regulates LPS-TLR signaling and F. tularensis Schu4 suppresses immune neutrophils, 6540 inflammation, macrophages, 2469 responses, 4538 Lysosomes, PU.1 redirects adenovirus to, development experimental asthma types 1 hemopoiesis maintained by type I IFN and alveolar macrophages, 2440 and 2 determined by airway expo- B cells during Pneumocystis infec- sure levels of, 5375 tion, 6604 Gpnmb gene induced by IFN-␥ and, mac- increased hyperoxia-induced mortality and M3, prevents MLDS-induced diabetes, rophages, 6557 acute lung injury, IL-13 null mouse, 4623 IL-10 producing CD4 Treg cells induced mouse, 4993 m157, recognition of, determined by NK cell by, suppress CD8 T cell responses, inflammation controlled via NF-␬B path- Ly49 residues, 369 5429 way, airway epithelial cells, 6504 Macrophage inflammatory proteins innate immune responses to, amplified by peripheral blood monocyte differentiation MIP-1a, DC transmigration through brain iNKT cells, 2706 potential, 2000 microvessel endothelium regulated stabilization of FPR1 mRNA induced by, protective role for macrophages in nonin- by MMPs and, 520 peritoneal macrophages, 2542 flammatory injury, 5001 MIP-2, C3a required for CXC chemokine TRAM in NF-␬ B activation induced by, SDF-1 and neutrophil recruitment, ALI, production after renal I/R, PTEC, human cells, 2148 8148 1819 MIP-3␣ mediates EGFR activation and TREM-1 induced by, regulated by PGE2, TRIF in host response to P. aeruginosa, macrophages, 1144 3170 ERK1/2 MAPK signaling via am- up-regulates MHC class II via AP-1 en- TRIF in innate immune responses to E. phiregulin release, colonic epithe- hancer, DCs, 6307 coli pneumonia, 3153 lial cells, 8013 Lipopolysaccharide-binding protein, induced tumor-associated fibroblasts modulate tu- Macrophages by IL-22, hepatocytes, 5973 mor-associated T cell activation, aggregations of, triggered by CCL1/CCR8 Lipoproteins, lipotechoic acid and, in S. au- 5552 interactions, peritoneal adhesions, reus, letter, 2610 Lupus nephritis, abrogation in AID-deficient 5296 Lipoteichoic acid mouse, 7422 alveolar, adenoviruses directed to lyso- lipoproteins and, in S. aureus, letter, 2610 Ly49 somes by PU.1, 2440 TRAM in NF-␬ B activation induced by, LFA-1-mediated NK cell adhesion regu- ATII epithelial cells and, LPS-stimulated human cells, 2148 lated by, 1261 cytokine release and leukocyte mi- LIR-1. see Leukocyte Ig-like receptor-1 NK cells, residues determining m157 rec- gration regulated by, 463 Listeria monocytogenes ognition, 369 CD44 regulates LPS-TLR signaling and ␤1ARs impair immune cell innate re- trans and cis interactions with MHC-I li- inflammation, macrophages, 2469 sponses to, 4876 gands, 1277 complement, Fc␥R and, in CRP-mediated expressing immune dominant peptide, con- Lymph nodes suppression of nephrotoxic nephri- fers immunity to HSV-1, 4731 CCR7 in Gi-dependent T cell motility, tis, 530 induction of protective immunity to, mu- 2973 cytokine production regulated by RAR␥, rine neonates, 3695 CD21 in establishment of extracellular 2113 NKDCs are innate immune responders to, HIV reservoir, 6968 DCs and, use Axl/Mertk/Tyro3 receptors 4411 DCs acquire homing potential via in apoptotic cell clearance, 5634 p60 enhances NK cell activation required CD4CD25 Treg cells, 4184 Egr dispensable for differentiation of, 3038 for expansion of, 2407 DCs in recruitment of NK and T cells by, F. tularensis-infected, release PGE2 block- Liver 3886 ing T cell proliferation, 2065 fiber-modified Ad vectors decrease liver modeling T cell movement within, 5505 fibroblast secretion of CXCL8 limits my- toxicity via IL-6 reduction, 1767 requirements for T cell migration, 7747 cobacterial survival in, 3767 HBV-specific CD8 T cells suppressed by Lymphocytes fusion with granuloma cells, induced by PD-1:PD-L1 interactions, 2714 Atm gene regulation of ROS response to mycobacterial lipomannan, 3161 IL-10 regulates enterohepatic CD4 T cell dsDNA breaks, 103 galectin-1 regulates physiology via migration, 7974 dysfunction of, induced in anti-CD137- ERK1/2, 436 influenza A specific CD8 T cell survival treated mice, 4194 GM-CSF and CSF-1-dependent cytokine in, 2737 TACE required for normal development, profiles, 5245 transplantation, detachment of donor 4214 Gpnmb gene induced by IFN-␥ and LPS, CD4CD25 Treg cells from graft, Lymphocytic choriomeningitis virus, anti- 6557 6066 CD40 suppresses immune response inflammatory response involves adenosine, LL-37, cathelicidin peptide, in vitamin D- to infection with, 1662 HO-1, CO and A2aR, 5921 inducible suppression of M. tuber- Lymphomas IRF-2 regulates apoptosis via STAT1/3 culosis, 7190 B cell, CD4CD25 Treg cells in immune and caspase-1 mechanisms, 3602 Lmb gene, characterization of lupus-related evasion, 6840 L. amazonensis infection activates MAPK congenics, 8195 B cell, Syk required for growth of, 111 and ERK, 1077 LTA. see Lipoteichoic acid eradication by rituximab, CCL3 in, 6616 LPS augments TNF-␣ production, T2D Lungs follicular, intratumoral CD4CD25 GITR mice, 663 Ag not required for maintenance of virus- Treg cells suppress allogeneic CD8 LPS or poly(I:C) stimulated, HMGB1 re- specific memory CD8 T cells, 4721 and CD4 T cells, 4051 lease and apoptosis, 6495 CD4CD25 T cell regulation of allergic mantel cell, B cells sensitized to TRAIL Mcl-1 depletion in ionizing radiation-in- responses depends on IL-10 induc- via c-FLIP by IKK inhibition, 1923 duced apoptosis, 2923 tion of TGF-, 1433 NK cells regulate Ag presentation and tu- monocyte-derived, IL-10 induces IL-10 via CD39 and CD73, in innate protection, mor-specific CTLs, syngeneic lym- STAT3, 4779 ALI, 8127 phoma model, 6140 monocyte-derived HIV-1-infected, defec- chemokines production in CD11bhigh DC Lymphopenia, HIV-Nef activation of T cells tive Fc␥R-mediated phagocytosis, homeostasis, lung, 1882 via, 5762 1096 8274 SUBJECT INDEX ͓VOL. 178

NaV1.5 regulates endosomal acidification, Mal. see MyD88 adaptor like MMP2 regulated by neutrophil elastase, 7822 Mala s 13. see Thioredoxin, M. sympodialis macrophages, 5871 neutrophil elastase regulates cathepsin B Malaria MMP9 enhances host susceptibility to pul- and MMP2 expression, 5871 CD36 disruption impairs cytokine re- monary infection by F. tularensis neutrophils and, phagocytosis of influenza sponses to P. falciparum GPI, 3954 types A and B, 1013 A virus-infected apoptotic cells by, cerebral, P. berghei-mediated, NK cells MMP13, SAMs as source of, role in reso- 2448 stimulate CXCR3 T cell recruit- lution of hepatitic fibrosis, 5288 osteopontin induces STAT1 degradation, ment, 5779 MBL. see Mannan-binding lectin 1870 experimental cerebral, DCs required for MCH. see Mucus cell hyperplasia peritoneal, complexes of MAIR-II with induction of, 6033 Mcl-1, depletion in ionizing radiation-in- DAP-12 and FcR␥ chain, 765 IFN-␣ inhibits cerebral malaria and re- duced apoptosis, macrophages, peritoneal, CD46 in ursolic acid-induced duces parasite burden, mouse, 6416 2923 IL-1␤ release, 4854 incomplete deletion of Foxp3 Treg cells MCP-1. see Monocyte chemoattractant pro- peritoneal, LPS-induced stabilization of following antiCD25 treatment, ma- tein-1 FPR1, 2542 laria-infected mouse, 4136 MCSP. see Melanoma-associated chondroitin

PGE2 regulates LPS-induced TREM-1, novel Ab-defense requires monocyte sulfate proteoglycan 1144 Fc␥RII and Fc␥RIII costimulation, Melanoma phagocytosis apoptotic neutrophils stimu- 3099 detection of individual tumor-specific T lated by annexin 1, 4595 P. falciparum EMP1 as target of naturally cell clones, 6789 podosome formation requires WASP/WIP acquired antibodies, 428 gap junctions facilitate Ag transfer be- complex, 2987 T cells and neutrophils in protection from, tween DCs, 6949 in prevention of experimental colitis by S. young susceptible rats, 1713 human, gene encoding Ag recognized by mansoni infection, 4557 Malassezia sympodialis, crystal structure of CTLs, Pillars of Immunology, 2617 produced by CSF-deficient mice, inflam- thioredoxin, 389 patients with, CD4 T cell responses to matory responses and, 6435 Malt, Bcl10/Malt signaling essential for MCSP, healthy individuals and, protective role in noninflammatory lung TCR-induced NF-␬B activation, 7703 injury, 5001 953 Melanoma-associated chondroitin sulfate pro- regulation by synthetic prostacyclin ana- Mamu-A*01, complexed with immunogenic teoglycan, CD4 T cell responses to, logs, 1628 SIV epitopes, crystal structure, 944 melanoma patients and healthy in- scar-associated, source of MMP13, role in Mannan-binding lectin dividuals, 7703 resolution of hepatitic fibrosis, conformational changes after binding to MenD CP. see Group B meningococcal cap- 5288 ligand surfaces, 3016 sules TLR-2-mediated survival of S. aureus in, identification of site interacting with serine Menstrual cycle, follicular phase, CD4CD25 4917 proteases, 5710 T cell and FOXP3 Treg cell, ex- TLR4-mediated survival requires MyD88 Mannose-binding lectin A, mice deficient in, pansion during, 2572 and TNF-␣, 3731 IgM responses and susceptibility to Mertk, macrophages and DCs use Axl/Mertk/ TLRs in differential regulation of IL-12 nematode infection, 5116 Tyro3 receptors in apoptotic cell release in response to Mtb, 5192 Mannose receptor clearance, 5634 TNF-␣ inhibits apoptotic cell clearance via expression defines new DC subset, 4975 Mesotheliomas, tumor rejection after Treg

cPLA2, 8117 human, antigenic targeting induces tumor cell depletion, 4089 tumor-associated, IL-12 alters functional immunity, 6259 MHC-B gene, chicken, extended genetic map profile, 1357 Mantel cell lymphoma, B cells sensitized to of, 7162 type 2 DM impairs IRS-2-mediated PI3K TRAIL via c-FLIP by IKK inhibi- MHC class I-related chain A, transfer from and induces IL-4 resistance, 6886 tion, 1923 target cells to NK cells, 3418 in type I IFN signaling in LPS-induced MARCO, SR-AI/II and, limit DC migration MIC gene, regulation of, 961 IL-10 production, 6705 and allergic airway inflammation, Microbiota, indigenous, in maintenance of MAIR-II. see Myeloid-associated Ig-like re- 5912 virus-specific memory CD8 T cells, ceptor II Mast cells MCMV-infected lungs, 5209 Major histocompatibility complex class I Bcl10 essential for Fc⑀ R-induced AP-1, Microenvironments, of tumors, IL-2 regulates molecules NF-␬B activation and IL-6 produc- Th17 and Treg cells, 6730 CD160 specific for, effect of release from tion, 49 Microglia activated NK lymphocytes, 1293 BM-derived, Fyn/PI3K and p38 activation activation of, GM-CSF production by au- cowpox virus inhibits intracellular trans- regulates IL-4 production, 2549 toreactive T cells required for, on- port, 1654 connective tissue-like, survival promoted set of EAE, 39 disulfide bond engineering traps peptides, by Fc⑀RI aggregation, 4177 effects of IFN-␥ and CD40L on FPRL2, 6280 dysregulation of Src family kinases, ASK 1759 expression impaired by stimulation of versus EL mice, 455 fibronectin- and vitronectin-induced activa- ␣ ␤ ␣ ␤ UPR, 3612 GATA-1 and GATA-2 in activation, 360 tion of, 5 1 and v 5 integrins recognized by adenovirus E3–19K, 4567 granules, TNF trafficking via endocytosis, mediate MMP-9 expression and, trans and cis interactions of Ly49 family 5701 8158 receptors with, 1277 impaired maturation and allergic re- guanosine inhibits CD40R expression in- Major histocompatibility complex class II sponses, Ndrg1-deficient mouse, duced by cytokines and A␤, 720 molecules 7042 toxicity to oligodendrocytes mediated by

epitope selection involves cooperativity of K-ras modulates c-kit-mediated cellular system xc- and inhibition of gluta- hydrophobic anchor interactions, functions, 2527 mate transporter, 6549 7181 peritoneal cell-derived, model for serosal- Microglial cells, IFN-␥-dependent activation, essential for memory CD4 T cell func- type mouse mouse mast cells, 6465 protects against cerebral C. neofor- tions, 5488 transcriptomes regulated by Mitf isoforms, mans infection, 5753 up-regulated by LPS via AP-1 enhancer, 378 Microphthalmia-associated transcription fac- DCs, 6307 Matrix metalloproteinase genes, monocyte- tor, isoforms, mast cell transcrip- Major histocompatibility complex class II astrocyte networks regulate expres- tomes regulated by, 378 transactivator, complementation sion of, CNS TB, 1199 Microtubules, in endolysosomal tubule for- cloning of, hereditary MHC class II Matrix metalloproteinases mation in DCs, 7199 deficiency, 6677 DC transmigration through brain microves- Mig. see Monokine induced by IFN-␥ Major histocompatibility complex molecules, sel endothelium regulated by Minor histocompatibility antigens, HY, natu- CD3␨ tyrosine phosphorylation in- MIP-1␣ and, 520 ral regulation of immunity to, 3558 ␣ ␤ ␣ ␤ duced by TCR-MHC interactions, MMP-9, 5 1 and v 5 integrins mediate Mitf. see Microphthalmia-associated tran- 4120 expression of, EAE, 8158 scription factor 2007] SUBJECT INDEX 8275

Mito-quinone-Q, ICAM-1 induction by NAC Multinucleated giant cells, HIV-1-infected, Myeloid-associated Ig-like receptor II, perito- and, via glutathione, 1835 cytoskeletal protein transformation, neal, complexes with DAP-12 and Mitogen-activated kinase phosphatase-1, cor- 6404 FcR␥ chain, peritoneal macro- ticosteroid inhibition of GRO-␣ Multiple myeloma, cancer/testes genes, ex- phages, 765 via, ASMCs, 7366 pression patterns and prognostic Myeloid basic protein, Treg cells maintain MKP-1. see Mitogen-activated kinase phos- value, 3307 long-term tolerance to, 887 phatase-1 Multiple sclerosis. see also Experimental Myeloid cells Mkp-1 gene, knockout, enhances inflamma- autoimmune encephalomyelitis bone marrow, DEC205Gr-1 subsets, che- tory responses to gram-positive effector cytokine profiles of memory and mokine and TLR expression, 7833 bacteria, 5312 naive B cell subsets, 6092 SLP-76 loss confers resistance to neutro- MOG. see Myelin oligodendrocyte glycopro- Mycobacterium avium, IL-10 and susceptibil- phil-mediated tissue damage, 4606 tein ity to infection, 8028 Myeloid progenitor cells, conditioned by glu- Molecular mimicry, paratope plasticity and Mycobacterium bovis cocorticoids, role of TLR4 and Ab responses, 7923 CD27low CD4 T cell accumulation in PI3K-Akt, 2517 Monarch-1, suppresses NF-␬B activation via lungs protects host against infec- Myelopoiesis NF-␬B-inducing kinase degrada- tion, 976 IL-7 induces erythropoiesis and, 1553 tion, monocytes, 1256 IL-17 regulates immune responses to stimulated in mice deficient in colony Monocyte chemoattractant protein-1 BCG, 3786 stimulating factors, 6435 antitumor effects of suicide gene therapy Mycobacterium leprae Myofibroblasts, intestinal, SEA induces with, HCC, 574 inhibits DC activation and maturation, 338 MCP-1 production, 8097 induced by SEA, intestinal myofibroblasts, SNP impairs TLR1 trafficking, protects Myopathies, inflammatory, B cells in anti- 8097 against, 7520 gen-driven humoral response, 547 Monocytes Mycobacterium tuberculosis alcohol exerts anti-inflammatory effects via B cells influence inflammation and bacte- NAC. see N-Acetylcysteine IKK inhibition and p65 phosphory- rial containment, 7222 Naip5/Birc1e, restricts L. pneumophila lation, 7686 cathelicidin LL-37 peptide in vitamin D- growth, 8022 astrocyte networks with, regulate MMP inducible suppression of, 7190 low NAP. see Neutrophil-activating protein gene expression, CNS tuberculosis, CD27 CD4 T cell accumulation in Natural killer cells 1199 lungs protects host against infec- activated, effect of MHC-I-specific CD160 CCL23 induced by IL-4 via STAT6, 4335 tion, 976 release from, 1293 CCR2 in monocyte-lineage cell recruit- CXCL8, fibroblast secretion of, limits my- activated by HIV-1-derived ssRNA, 7658 ment, human corneal stroma, 3288 cobacterial survival in macro- activation by influenza-infected DCs, CD16 subset preferentially harbors HIV-1, phages, 3767 NKG2D and NKp46 recognition 6581 CXCR3 in control of infection, mouse, required for, 2688 ␥ DCs and, TL1A induced by Fc R, 4033 1723 CD56bright KIR, acquire CD56dim features ␥ dectin-1 stimulation by C. albicans acti- functional signatures of IFN- and IL-2, on activation, 4947 vates NFAT, 3107 Mtb-specific T cells, 5217 chimpanzee, NKp30 inducibility, HIV-1 ␥ ␥ Fc RII and Fc RIII costimulation, re- IFN type I response to, requires ESX-1 infected animals, 1702 quired for novel Ab-defense against secretion system, 3143 CXCR3 T cell recruitment stimulated by, malaria, 3099 peptide-pulsed DC induced H2-M3-re- P. berghei-mediated cerebral ma- galectin-1 regulates physiology via stricted CD8 T cells protect laria, 5779 ERK1/2, 436 against, 3806 DCs in LN recruitment of T cells and, HIV-Tat regulation of IL-10 involves TLRs in differential regulation of IL-12 3886 CaMK-activated p38, Sp-1 and release in DC and macrophage re- functions in cancer, review, 4011 CREB-1, 798 sponse to, 5192 genomics and diversity, common marmo- IC-stimulated, TNF-like cytokine produc- Treg cells prevent clearance of, 2661 set monkey, 7151 tion by, RA, 7325 MyD88 human, Itk regulates cytotoxicity mediated IL-23 induced by F. tularensis, 4445 Btk and, in pathogen-specific IgM re- by, 3575 Monarch-1 suppresses NF-␬B activation sponses, 3740 human, UL18 inhibits LIR-1ϩ and acti- via NF-␬B-inducing kinase degra- DC activation dependent on, B. melitensis vates LIR-1- NK cells, 4473 dation, 1256 infection, 5182 immune surveillance dependent on, im- peripheral blood, differentiation potential, innate responses to Wolbachia bacteria in paired by cigarette smoke, 936 lung, 2000 B. malayi and O. volvulus, depen- inhibitory signals suppress NKG2D re- recruitment and activation in GALT, oral dent on TLR2, TLR9, Mal and, cruitment to GM1-rich domains at salmonella infection, 5879 1068 IS, 5606 TF induced by SAA, 1852 pathway independent of, not mobilized in innate resistance to tumors induced by Tie-2 expression and Ang-2 responses, TLR4-stimulated neutrophils, 7344 ␣-GalCer-loaded tumor cells, 2853 7405 pathways in synergy, priming and toler- KI3DS1 gene encodes DAP12-associated Monokine induced by IFN-␥, tumor cell pro- ance, role of TLR agonists in, 1164 receptor, 647 duction of, essential for T cell-me- regulates immune responses during RSV KIR2DL5 expression on surfaces of T diated cutaneous tumor suppres- infection, DCs, 5820 cells and, 4402 sion, 2278 required for long-term humoral immunity LFA-1-mediated adhesion regulated by mTOR. see Target of rapamycin, mammalian to virus infection, 5124 Ly-49 receptors, 1261 MTS-15, unique thymic fibroblast population in route-dependent susceptibility to VSV, Ly49 residues determining m157 recogni- identified by, 4956 5173 tion, 369 MUC1, transgenic mice, Th/Treg cell imbal- signaling essential for immune response to maturation and homeostasis, associated ance, 2787 experimental brain abscess, 4528 with KLRG1, 4764 MUC5AC gene, IKK␣ and IKK␤ in ERK- in TLR4-mediated macrophage survival, NK3-like, role in Poly(I:C) protective ef- dependent regulation of transcrip- 3731 fect on type 1 diabetes, NOD mice, tion, S. pneumoniae, 1736 MyD88 adaptor like, innate responses to 2141 Mucin, production, asbestos-induced inflam- Wolbachia bacteria in B. malayi p60 enhanced activation of, required for L. mation and, modulated by NF-␬B and O. volvulus, dependent on monocytogenes expansion, 2407 activation, airway epithelial cells, TLR2, TLR9, MyD88 and, 1068 perforin-dependent microbicidal activity 1800 Myelin oligodendrocyte glycoprotein requires PI3K-dependent ERK 1/2 Mucus cell hyperplasia, airways, resolution C3d binding to, EAE exacerbated by, 3323 signaling, 6456 by IFN-␥ via STAT1 and Bax, DCs expressing TRAIL and, Treg cells in polymorphism of KIR3DL1/S1 receptor 8107 EAE-preventive effect of, 918 on, 235 8276 SUBJECT INDEX ͓VOL. 178

regulate Ag presentation and tumor-spe- migration of, regulated by Cia6 and Cia4 EHEC Shiga toxin inhibits PI3K/NF␬B cific CTLs, syngeneic lymphoma loci, 2344 pathway, Gb-3 negative IECs, 8168 model, 6140 RAGE mediates migration across intestinal hydrogen peroxide in activation of, 3893 transfer of MICA from target cells to, epithelium, 2483 inflammation controlled via, airway epithe- 3418 recruitment, SDF-1 and, ALI, 8148 lial cells, 6504 tumor-primed, lyse NK-resistant tumor recruitment to B. burgdorferi infection site and IRFs regulate CCL19 expression in targets, 85 attenuates infectivity, 5109 monocyte-derived DCs, 253 type I IFN and antitumor responses, 7540 SLP-76 loss confers resistance to tissue modulated by POP2, in disruption of ASC: uterine, PlGF in proliferation of, 4267 damage mediated by, myeloid cells, CLR interactions, 3837 Natural killer receptors, profiles imprinted on 4606 Monarch-1 suppresses activation via NF- CD8 T cells, 652 T cells and, in protection from malaria, ␬B-inducing kinase degradation, Natural selection, effect on interactions of young susceptible rats, 1713 monocytes, 1256 IgA-Fc with Fc␣RI and bacterial TLR4-stimulated, MyD88-independent nickel triggers inflammatory and proangio- decoy proteins, 7943 pathway not mobilized in, 7344 genic gene expression via HIF-1␣ Nef, HIV, activates T cells via lymphopenia, transmigration is JM-C independent, 5879 and, 3198 5762 V␦1 ␥␦T cells control infiltration after E. p53 in gene expression dependent on, Neisseriae, sialylated pathogenic, Factor H coli infection via IL-17, 4466 TLR4-stimulated, genistein exposed binding influenced by porin, 4489 Newcastle disease virus, NF-␬B subunits in DCs, 5048 Neonates virus-induced IFN type I expres- protection against cerulein-induced pancre- human preterm and term, IgG H chain sion, 6770 atitis by IFN-␥ via repression of, repertoire, 1180 NF-␬B. see Nuclear factor-␬B 7385 murine, induction of protective immunity Nickel, triggers inflammatory and proangio- RelA subunit, regulation during pneumo- to L. monocytogenes, 3695 genic gene expression via NF-␬B coccal pneumonia, 1896 murine, CD4 T cells in rapid Th2 effector- and HIF-1␣, 3198 simvastatin potentiates TNF-␣-induced like function, 2667 Nitric oxide apoptosis via, 2507 Nephrotoxic nephritis, macrophages in, com- effects of VEGF,Cav-1 and, on anergy, subunits of, in regulating T cell stimula- plement and Fc␥R in CRP-medi- ECs, 1505 tory DC gene expression, 6777 ated suppression, 530 regulated by Cia6 and Cia4 loci, 2344 subunits of, in virus-induced IFN type I Neurodegeneration, TLR2 mediates neuroin- Nitrososulfamethoxazole, stimulates DC sig- expresssion, 6770 flammation and neuronal damage, naling, 5533 TCR activation induced by, Bcl10/Malt 6476 NKG2D signaling in, 953 Neurofibromin, in K-ras modulation of cellu- recognition required for NK cell activation TICAM1 function in vertebrates, 4517 lar function, mast cells, 2527 by influenza-infected DCs, 2688 TLR/NF-␬B signaling in commensal bac- Neurokinin 1 receptor, signaling promotes regulation of MIC gene for ligands of, 961 teria-induced colitis, gnotobiotic Th1- and Tc1-biased immune re- suppressed by inhibitory NK cell signals, mice, 6522 sponses, LCs, 7006 5606 TRAM in LPS- and LTA-induced activa- Neurons, cortical, HIV-1 Tat elicits mito- NKp46, recognition required for NK cell tion of, human cells, 2148 chondrial hyperpolarization and activation by influenza-infected Nuclear factor-␬B2/p100, TCR signaling reg- respiratory deficit, 869 DCs, 2688 ulation by, 7767 Neutrophil-activating protein, H.pylori, pro- Nkt1 gene, Slamf1 mediates expression of, Nuclear factor of activated T cells motes neutrophil adhesion, 1312 NKT cells, NOD mouse, 1618 activated by dectin-1 stimulation by C. Neutrophil elastase, regulates cathepsin B NOD1. see Nucleotide-binding and oligomer- albicans, monocytes and DCs, and MMP2 expression, macro- ization domain 1 3107 phages, 5871 NOD2. see Nucleotide-binding and oligomer- controlled by BCR via Ras-mediated Ral Neutrophils ization domain 2 activation, 1405 activation of, free cholesterol-altered lipid Non-small cell lung cancer NFATc1, osteoclastogenesis modulated by raft structures in, 5253 Factor H down-regulation sensitizes to PIAS3 via OSCAR and, 5588 ADAM8 expression and effect on L-selec- complement and reduces tumor NFATc1 nuclear occupancy, T cell activa- tin shedding, 8053 growth, 5991 tion by enhanced, 4315 apoptotic, phagocytosis by macrophages immature infiltrating DCS in, 2763 NFATc2 regulates CD154, and IL-2 genes stimulated by annexin 1, 4595 tumor-associated fibroblasts modulate tu- in T cells, SLE, 1960 CD99 mediates transendothelial migration, mor-associated T cell activation, TGF-␤1 expression mediated by, tolerant 1136 lung, 5552 T cells, 3067 Cdc42 inactivation required for F-actin Non-T cell activation linker Nucleotide-binding and oligomerization do- depolymerization and phagosomal N terminus inhibits pre-B cell differentia- main 1, RICK mediates innate im- maturation, 7357 tion, 2336 mune responses via Nod1 and chemoattraction of, by F2L via Fpr2 acti- regulates TREM-1/DAP12-induced cyto- Nod2, 2380 vation, 1450 kine production, myeloid cells, Nucleotide-binding and oligomerization do- coronin required for chemotaxis and 1991 main 2 phagocytosis, 5769 Notch, human T cell suppression moderated DMBT1 gene regulation via TLR4 and, defensins increase phagocytosis of influ- by, GRAIL up-regulation and, 6158 modulates bacterial invasion, 8203 enza A virus, 8046 NTAL. see Non-T cell activation linker ␬ RICK mediates innate immune responses Hck and Fgr regulate responses to fMLP, Nuclear factor- B via Nod1 and Nod2, 2380 3874 activation, effect on DCs expressing mu- Numb, Nbl and, dispensable for lymphopoie- HMGB1-TLR4 signaling in HS-induced tated I␬B␣, 1301 sis and hemopoiesis, 6746 NAD(P)H oxidase activation, 6573 activation modulates asbestos-induced in- Numblike, Nb and, dispensable for lympho- H.pylori NAP promotes adhesion, 1312 flammation and mucin production, poiesis and hemopoiesis, 6746 HSP27 regulates chemotaxis and exocyto- airway epithelial cells, 1800 sis, 2421 B cell proliferation controlled by TFII-I IFN-␥ production by, mediated by NKT via, 2631 Ocular pigment epithelial cells, T cell re- cell activation, 5899 B7-DC/PD-L2 cross-linking induces pro- sponses to, role of TSP-1, 6994 IgE modulates survival of, asthma, 2535 tection from cell death dependent OK-432, enhances DC/colorectal cancer cell lyso-PL mobilize secretory vesicles and on, DCs, 1426 fusion and induces Ag-specific induce signaling via G2A, 6540 Bcl10 essential for activation of, mast CTLs, 613 macrophages and, phagocytosis of influ- cells, 49 Oligoadenylate synthetase, OAS/PKR and ␣␤ enza A virus-infected apoptotic EGR and, in negative regulation of rankl TCR T cells required for Ad:IFN-␥

cells by, 2448 by 15d-PGJ2, T cells, 4039 HSV-1 inhibition, 5166 2007] SUBJECT INDEX 8277

Oligodendrocytes, microglial toxicity to, me- Pancreatic islets, B cell-specific CD8 T cell impaired by oxidized phospholipids, gram-

diated by system xc- and inhibition clonotypes in PBLS and, 1388 negative sepsis, 993 of glutamate transporter, 6549 Pancreatitis, cerulein-induced, protection by macrophage, of apoptotic neutrophils, Oligonucleotides, antisense phosphorothioate, IFN-␥ via repression of NF-␬B stimulated by annexin 1, 4595 STAT4 targeting by, suppresses activation, 7385 of pathogens, promoted by CEACAM3 CIA suppressed, 3427 Panitumumab, clinical immunogenicity as- association with Vav, 3797 Oncostatin M, secretion by skin infiltrating T sessed using ELISA and surface Phagosomes, Cdc42 inactivation required for cells activates keratinocytes, 4615 plasmon resonance, 7467 F-actin depolymerization and matu- ONZIN, mice deficient in, impaired host de- Paratope plasticity, Ab responses and, molec- ration of, neutrophils, 7357 fence, 5132 ular mimicry, 7923 PhI p 5, immunotherapy, IgA2 and mucosal OPE cells. see Ocular pigment epithelial PARP1. see Poly(ADP-ribose) polymerase 1 TGF-␤ responses, 4658 cells Parvalbumin, hypoallergenic mutant for IgE- Phosphatidylinositol 3-kinases OPG. see Osteoprotegerin mediated fish allergy immunother- BCR-directed signaling, positive selection OSCAR. see Osteoclast-associated receptor apy, 6290 promoted by, B cells, 6332 Oseltamivir, decreases T cell GM1 and in- Pax5 gene, B lymphoid-specific expression BCRs down-regulate FOXO1 expression hibits RSV clearance, 2651 pattern, 3031 via Btk and, 740 Osteoarthritis, B cell clonal expansion and PD1. see Protectin D1 class IA p85␣ subunit regulates ␤-selec- VH somatic hypermutation, 557 Pemphigus vulgaris, anti-Dsg autoreactive B tion in thymocyte development, Osteoblasts cell repertoire in, 5982 1349 effect of OPG on RANKL derived from, Pen c 13, induces IL-8 via PAR-1 and EHEC Shiga toxin inhibits PI3K/NF␬B 192 PAR-2, airway epithelial cells, pathway, Gb-3 negative IECs, 8168 Fas/FasL in differentiation and apoptosis 5237 Fyn/PI3K and p38 activation regulates of, 3379 Pendrin, role in bronchial epithelial cell thio- IL-4 production, BM-derived mast Osteoclast-associated receptor, osteoclasto- cyanate transport, 5144 cells, 2549 genesis modulated by PIAS3 via Pepidoglycan recognition proteins, zinc-de- in glucocorticoid conditioning of myeloid NFATc1 and, 5588 pendent bacteriocidal activity, 3116 progenitors, 2517 ␥ Osteoclastogenesis, modulated by PIAS3 via Peptide mimetics, IFN- therapeutic for le- innate immune functioning of DCs, elderly NFATc1 and OSCAR, 5588 thal vaccinia virus infection, 4576 humans, 6912 Osteoclasts, Fas/FasL in differentiation and Peptide presentation, in vivo, type B T cell leukocyte degranulation regulated by PKG apoptosis of, 3379 activation and, 122 ␤ and, 416 Osteopontin Peptide recognition, chain forming peptide- mediates protection against myocardial I/R EAU aggravated by, 6567 independent alloreactive TCRs, injury, TLR-4 deficient mouse, induces STAT1 degradation, macrophages, 6109 7317 Perforin, microbicidal activity dependent on, 1870 p85␣ subunit of, IREM-1 associates with, requires PI3K-dependent ERK 1/2 Osteoprotegerin, effect on levels of osteo- 808 signaling, NK cells, 6456 blast-derived RANKL, 192 p110␦ isoform, role in BCR-mediated Ag Periodontitis, P. gingivalis gingipains and OX40, CD4 T cell differentiation mediated presentation, 2328 human complement system, 7242 by, requires IL-2R, 7694 p110␦ subunit required for RAG expres- Peripheral blood lymphocytes, B cell-specific Oxidative stress sion, immature B cells, 1981 CD8 T cell clonotypes in pancre- Atm-regulated responses, required for T regulates IL-1␤ and sIL-1Ra production in atic islets and, 1388 cell proliferation, 4757 monocytes, 446 Peripherin, recognition by islet-infiltrating B Hsp72 regulates translocation and release signaling protects from sepsis via C5a- of HMGB1 induced by, 7376 lymphocytes, 6533 Permeability, paracellular, restricts airway mediated activation of innate im- ICAM-1 induction by NAC and mito-Q munity, 5940 via glutathione, 1835 epithelial cell responses, 6395 Peroxisome proliferator-activated receptor-␣, Phosphatidylinositol 3,4,5-triphosphate phos- activation inhibits LC function, phatase, activity shown by Cdt sub- CIP1/WAF1 p21 , activated/memory T cells regu- 4362 unit B, 5099 lated by, 2296 Peroxisome proliferator-activated receptor-␥ Phosphodiesterase-4 p38 agonists suppress IL-12 family cytokine inhibitors of, prevent preterm delivery in- CaMK-activated, in HIV-Tat regulation of production, activated glia, 1904 duced by intrauterine inflammation, IL-10, monocytes, 798 enhances regulatory T cells, 4129 1115 Fyn/PI3K and p38 activation regulates required for CD4 Treg cell-mediated pro- subtypes, differential expression and func- IL-4 production, BM-derived mast tection against colitis, 2940 tion of, CD4 T cells, 4820 ␣ cells, 2549 role in DC function and CD4 T cell an- Phospholipase A2, cytosolic, TNF- inhibits GATA-3 phosphorylation mediated by, in ergy, 2122 apoptotic cell clearance via, macro- Th2 regulation of cytokine genes, Peroxynitrite, pathway dependent on, causes phages, 8117 2491 BBB permeability changes, CNS Phospholipids, oxidized, inhibit phagocytosis gp120 binding to CXCR4 causes T cell inflammatory response, 7334 and impair outcome, gram-negative apoptosis dependent on, 4846 Pertussis toxin sepsis, 993 in LPS augmented TNF-␣ production, with IFN-␥-induced CXCL10 and CCL5, PIAS1. see Protein inhibitor of activated macrophages, T2D mice, 663 promote T cell entry to CNS, 8175 STAT1 p53, in NF-␬B-dependent gene expression, induces IL-6, promotes IL-17-producing PIAS3. see Protein inhibitor of activated TLR4-stimulated, genistein exposed CD4 cell generation, 6123 STAT 3 DCs, 5048 Peyer’s patches Pillars of Immunology p60, enhances NK cell activation required for LT-independent stromal cell TRANCE allophenic mice, 4005, 4007 L. monocytogenes expansion, 2407 expression, 5659 autoantibodies specific for determinants on p65, phosphorylation of, alcohol exerts anti- SIgA binding and internalization by DCs, IgG, RA sera, 1227 inflammatory effects via inhibition mucosal homeostasis and, review, birth of a cell type, 3 of IKK and, monocytes, 7686 27 complementation cloning of CIITA, hered- p300 TRAF2 in development of, 2272 itary MHC class II deficiency, 6677 acetyltransferase activity suppresses SLE- pH-regulated antigen-1, C. albicans, ligand control of immune response genes, 6675 ␣ ␤ like disease, mouse, 6941 for integrin M 2, 2038 controlling the Ir genes, 6675 CREB and, at proximal IL-2 promoter, T Phagocytosis human melanoma gene encoding Ag rec- cells, SIV-resistant sooty manga- Coronin required for chemotaxis and, neu- ognized by CTLs, Pillars of Immu- beys, 7720 trophils, 5769 nology, 2617 Paired Ig-like receptors, receptors for bacte- defective Fc␥R-mediated, HIV-1-infected human monocyte IL-1, nucleotide se- ria, 4250 human MDM, 1096 quence of precursor cDNA, 5413 8278 SUBJECT INDEX ͓VOL. 178

human tumor immunology at molecular Porcine reproductive and respiratory syn- Protein kinase C␦, PKC␦ regulates AgR- divide, 2615 drome, B cells undiversified with induced lytic granule polarization, IL-1 cloning and new era in cytokine biol- hydrophobic HCDR3s, proliferation CD8 CTLs, 7814 ogy, 5411 in, 6320 Protein kinase C␪ PIR-B. see Paired Ig-like receptors Porins, Factor H binding in sialylated patho- CD4 and CD8 T cell survival regulated by PKG. see cGMP-dependent protein kinase genic neisseriae influenced by, cRel, PKB and, 2932 Placental growth factor, role in uterine NK 4489 role in Fax/FasL-mediated apoptosis, T cell proliferation, 4267 Porphyromonas gingivalis, gingipains, effect cells, 312 Plague, pneumonic and bubonic, oral vacci- on human complement system, Protein kinase D, TLR5 interaction with, nation with Salmonella expressing 7242 required for response to flagellin, Y. pestis F1 and V Ags protects PPAR-␥. see Peroxisome proliferator-acti- 5735 against, 1059 vated receptor-␥ Protein kinase R, OAS/PKR and ␣␤ TCR T Plasma cells Pra1p. see pH-regulated antigen-1 cells required for Ad:IFN-␥ HSV-1 B220-CD138, reduction of, AID-/-␮s-/- Prednisolone, influences inflammation and inhibition, 5166 agammaglobulinemic mice, 2192 coagulation during endotoxemia, Protein tyrosine phosphatase 1B, VCAM ac- BAFF/BLys and IL-21 in PC differentia- patients with sepsis, 1845 tivation of, 3865 tion from memory B cells, 2872 Preeclampsia, pregnancy and, STBM in sys- Protein tyrosine phosphatase 3, TCR signal Plasmin, binding of Abs to cardiolipin in- temic inflammatory priming, 5949 transduction in PTPN3-deficient duced by, 5351 Pregnancy mouse, 3680 Plasminogen, BhCRASP binding specificities human tolerance, maternal acceptance of Proteolipid protein, 139–151, EAE induced for FH and, 7292 fetus, review, 3345 by, distribution of IL-17-producing Plasmodium berghei preeclampsia and, STBM in systemic in- CD4 cells, 1372 ␣ cerebral malaria mediated by, NK cells flammatory priming, 5949 Prothymosin , lacking NLS, effective gene stimulate CXCR3 T cell recruit- Preterm delivery, induced by intrauterine therapy, CIA, 4688 ment, 5779 inflammation, prevented by PDE-4 PRP4, interaction with KLF13 regulates ␣ IFN- inhibits cerebral malaria and re- inhibitors, 1115 CCL5, T cells, 7081 duces parasite burden, mouse, 6416 Prion proteins, GALT fDCs in scrapie agent PRRSV. see Porcine reproductive and respi- infected hepatocytes present CSP to CD8 invasion from intestine, 3757 ratory syndrome T cells, 7054 Profilin 1, cytoskeletal protein transforma- Pseudomonas aeruginosa T cells and neutrophils in protection from tion, HIV-1-infected multinucleated cornea infected with, effect of VIP on cy- tokines and corneal perforation, malaria, young susceptible rats, giant cells, 6404 1105 1713 Programmed cell death, HBV-specific CD8 T TRIF in host response to, lung, 3170 Plasmodium falciparum cells suppressed by PD-1:PD-L1 PSGL-1. see P-Selectin glycoprotein ligand-1 EMP1, target of naturally acquired anti- interactions, liver, 2714 bodies, 428 Psoriasis Prostacyclins, synthetic analogs of, regulate fetal immune responses to Ags from, Cam- alefacept signaling in leukocytes, 7442 macrophage functions, 1628 eroon, 2770 in innate defense and adoptive immunity, Prostaglandin E GPI, CD36 disruption impairs cytokine 2 psoriasis, 2229 induces IL-1␣, colon cancer cells, 4097 responses to, 3954 Pspc. see Pneumococcal surface protein C proinflammatory effect mediated via IL-23 PlGF. see Placental growth factor PTV. see Punta Toro virus to IL-17 axis, experimental IBD, PLP. see Proteolipid protein PU.1, redirects adenovirus to lysosomes to 8138 Pneumococcal surface protein C, S. pneu- alveolar macrophages, 2440 regulates LPS-induced TREM-1, macro- moniae, Factor H interacts with, Pulmonary emphysema, CS-induced, IL-18 5848 phages, 1144 and IL-18R␣ in pathogenesis, 1948 Pneumocystis, hemopoiesis maintained by released by F. tularensis-infected macro- Pulmonary fibrosis, bleomycin-induced, effect type I IFN and B cells during lung phages, blocks T cell proliferation, of AMD3100 on, mouse, 5888 infection by, 6604 2065 Punta Toro virus, TLR3 essential for immu- Pneumocystis carinii, defense against medi- Prostaglandin I2, analogs of, inhibit proin- nity induction by dsRNA and flammatory cytokine production ated by dectin-1-Fc fusion protein, poly(I:C12U), 5200 3702 and T cell stimulation, DCs, 702 Pyrin-only protein 2, modulates NF-␬ B and Pneumonia, E. coli, innate immune responses Prostate cancer, tumor-specific T cell toler- disrupts ASC:CLR interactions, to, role of TRIF, lung, 3153 ization, prostate cancer mouse 3837 Pneumonic plague, bubonic plague and, oral model, 1268 vaccination with Salmonella ex- Protease-activated receptors, PAR-1 and Qa-1b, UL49.5 regulates CTL epitope pre- pressing Y. pestis F1 and V Ags PAR-2, Pen c 13 induces IL-8 via, sentation by, 657 protects against, 1059 airway epithelial cells, 5237 Quantitative trait loci, CIA controlled by Podosomes, formation requires WASP/WIP Proteases, proinflammatory, release FPRL1 multiple loci, 3084 complex, macrophages, 2987 from CCL23, 7395 Pollen, immunomodulatory mediators en- Protectin D1, dampens inflammation and RAG, PI3K p110␦ subunit required for ex- hance DC migratory capacity, 7623 AHR, asthma, 496 pression of, immature B cells, 1981 Poly(ADP-ribose) polymerase 1, apoptotic Protein A RAGE. see Receptor for advanced glycation splenocytes drive autoimmune re- S. aureus, Bim required for B cell death endproducts sponse to, mouse lupus model, 95 mediated by, 2636 Ral, Ras-mediated activation of, BCR con- Poly(␥-glutamic acid) nanoparticles, targeting S. aureus, triggers B cell proliferation via trols AP-1 and NFAT activity via, of Ag to DCs with, induces specific TLR2 ligands, 2803 1405 immunity, 2979 Protein engineering, disulfide bond engineer- Random walk, idealized, modeling T cell Poly(I:C), protective effect on type 1 diabe- ing traps peptides in MHC class I movement within lymph nodes, tes, role of NK3-like NK cells, binding groove, 6280 5505 NOD mice, 2141 Protein inhibitor of activated STAT 3, modu- RANKL. see Receptor activator of NF-␬B Polymeric Ig receptor, teleost fish, transports lates osteoclastogenesis via ligand

tetrameric IgM into skin, 5682 NFATc1 and OSCAR, 5588 rankl gene, negative regulation by 15d-PGJ2, ␬ Polymorphonuclear neutrophils, LTB4 trig- Protein inhibitor of activated STAT1, in role of NF- B and EGR, T cells, gers antimicrobial agent release, TGF-␤ suppression of IFN-␥- 4039 8036 driven STAT1-dependent gene ex- Rapamycin, selective CD4CD25 Foxp3 Treg Polyoma virus, MyD88 required for long- pression, epithelial cells, 4284 cell survival after exposure to, 320 term humoral immunity to infec- Protein kinase B, CD4 and CD8 T cell sur- Ras, Ral activation mediated by, BCR con- tion, 5124 vival regulated by cRel, PKC␪ and, trols AP-1 and NFAT activity via, POP2. see Pyrin-only protein 2 2932 1405 2007] SUBJECT INDEX 8279

RBP-J␬, CRP switch to C/EBP␨ at promoter Rho GTPases, mediate tumor-induced inhibi- Selection, positive site dependent on, 7302 tion of DC endocytic activity, 7787 promoted by BCR-directed PI3K signaling, Reactive oxygen species Ribonuclear proteins, small nuclear, SmD B cells, 6332 Atm gene regulation of, response to peptide induces Ab responses regulated by ␤-catenin, thymocytes, 5028 DNAds breaks, lymphocytes, 103 within, 2565 Self-antigens inflammatory, mediate hemopoietic sup- RICK, mediates innate immune responses via human CD8 cytolytic T cells specific for, pression, Fancc-deficient mouse, Nod1 and Nod2, 2380 cytotoxicity controlled by IL-12, 5277 RIG-1, antiviral responses dependent on, ac- 3566 Reactive oxygen species signal 3, Ag-specific tivated by influenza A virus, lung T cell populations with specificity for neo- hyporesponsiveness caused by dis- epithelial cells, 3368 self Ag and relation to tolerance, ruption of innate-mediated proin- RIP2. see RICK 3544 flammatory cytokine and, 908 Rituximab Self-peptides, TCR repertoire adaptation to, Recent thymic emigrants, CD4, Ag unre- DISC induced by apoptosis mediated by, CD4 T cells, 7032 sponsiveness in, aged mouse, 1321 2287 Self-recognition, DC-specific, V␣14i NKT Receptor activator of NF-␬B ligand, osteo- lymphoma eradication by, role of CCL3, cells activated by foreign lipids blast-derived, effect of OPG on 6616 and, 2755 levels of, 192 RNA, viral, TLR7in Ab-mediated recognition Semliki Forest virus, P815, comparison of Receptor for advanced glycation endproducts, of, 3363 adenovirus, ALVAC vectors and, mediates neutrophil migration RNA helicases, LGP2 loss manifests in dis- in CTL responses to, 6761 across intestinal epithelium, 2483 parate antiviral responses, 6444 Sendai virus, NF-␬B subunits in virus-in- Receptor-ligand interactions, conformational Rolipram, prevents perterm delivery induced duced IFN type I expression, 6770 changes in MBL after binding to by intrauterine inflammation, 1115 Sepsis ligand surfaces, 3016 ROR ␥. see Retinoid-related orphan receptor gram-negative, oxidized phospholipids in- Rejection ␥ hibit phagocytosis and impair out- come, 993 A2AR activation attenuates allograft rejec- Rotavirus, TLR3 recognition of rotavirus tion, 4240 dsRNA induces severe intestinal lethal, tanshinone IIA rescues mice via allograft, role of the innate immune system injury, mouse, 4548 HMGB1, 3856 ␣ in tolerance and, review, 7503 RTE. see Recent thymic emigrants LPS-inducible, HIF-1 in development of, antibody-mediated allograft, CD4 Treg 7516 PI3K signaling protects via C5a-mediated cells, 2221 S1P1, KLF2 controls T cell trafficking via RelB, silenced DCs, immune modulation and activation of innate immunity, 5940 L-selectin and, 7632 prednisolone influences inflammation and tolerance induction by, 5480 SAF-1. see Serum amyloid A activating fac- Renal cell carcinomas, TNF-␣ induced GM2 coagulation during endotoxemia, tor-1 1845 kills T cells, 6642 Salmonella enterica, oral infection, monocyte streptococcal, HLA class II variation in Resolvin E1, regulates inflammation via recruitment and activation in modulating severity, 3076 BLT1 and ChemR23, 3912 GALT, 5789 Serine proteases, identification of MBL site Respiratory syncytial virus Salmonella spp., expressing Y. pestis F1 and interacting with, 5710 MyD88 regulates immune responses dur- V Ags, oral vaccination protects Serpin-6, protects ESCs from Ag-specific ing infection by, DCs, 5820 against pneumonic and bubonic lysis by CTLs, 3390 oseltamivir decreases T cell GM1 and in- plague, 1059 Serum amyloid A, induces TF, monocytes, hibits clearance of, 2651 Salmonella typhimurium 1852 Respiratory tract, pathway regulating inflam- induces switched antibody response, im- Serum amyloid A activating factor-1, VEGF matory disease, letter, 7501 pedes spread of infection, 6200 expression regulated by, arthritic Retina innate immune CD4 T cell activation de- joints, 1774 EAU elicited with retinal Ag-pulsed DCs, pendent on IL-18, mouse, 6342 Sex steroids, immune reconstitution by abla- clinical signature, mouse, 5578 Salmonella vaccination, Treg cells stimulated tion of, allogeneic HSCT, 7473 T cell anergy predisposes to autoimmunity, by, protect against EAE, 1791 SFV. see Semliki Forest virus 4276 Salp15, I. scapularis, inhibits development of Shiga toxin, EHEC, inhibits PI3K/NF␬B Retinoic acid, 9cRA exerts immunosuppres- experimental asthma, 7064 pathway, Gb-3 negative IECs, 8168 sive effects via RXR-dependent SAMs. see Macrophages, scar-associated Shigellosis, new animal model in guinea pig, activation, DCs, 6130 SAP. see SLAM-associated protein 2476 ␥ Retinoic acid receptor , regulates CD4 T Scavenger receptors, SR-AI/II and MARCO SHIP. see Src homology 2 domain-contain- cell effector function and macro- limit DC migration and allergic ing 5-inositol phosphatase phage cytokine production, 2113 airway inflammation, 5912 SHP-1. see Src homology region 2 domain- ␥ Retinoid-related orphan receptor , controls Schistosoma mansoni, infection by, prevents containing protein tyrosine phos- Ig and cytokine production in adap- experimental colitis via macro- phatase-1 tive immune response to allergens, phages, 4557 SHPS-1. see Src homology 2 domain-con- 3208 Schnurri-2, controls memory Th1/Th2 cell taining protein tyrosine phosphatase Retrovirus-like particles, displaying VSV generation, 4926 substrate-1 glycoprotein induce type I IFN re- Schu4, F. tularensis, suppresses pulmonary Signal 3, effect of IL-12 on T cell responses ceptor switch to neutralizing IgG immune responses, 4538 to solid tumors and, 6752 Abs, 5839 SCLC. see Non-small cell lung cancer Simvastatin, potentiates TNF-␣-induced apo- Rheumatoid arthritis Scrapie, GALT fDCs in invasion from intes- ptosis via NF-␬B, 2507 AIF-1 in pathogenesis, 3316 tine, 3757 Sirolimus. see Rapamycin autoantibodies specific for determinants on SEA. see Staphylococcal enterotoxin A SIV IgG, Pillars of Immunology, 1227 E-Selectin, CD43 and PSGL-1 mediate T cell brain infected by, IL-15 in accumulation high molecular weight protein component migration dependent on, skin, 2499 of CTLs, 5812 in serum, 1229 L-Selectin CD4 T cell homeostasis during infection, IL-1␣ induced by 17␤ E2 induces via ADAM8 expression and shedding of, neu- sooty mangabeys, implications for ER␣, Sp1 and dissociating HDAC2 trophils, 8053 AIDS pathogenesis, 1680 from ER␣, 3059 CD4CD25 Treg cell migration requires, CD8 T cell depletion in infected sooty KLOTHO gene in normal and RA-related 291 mangabey monkeys, 8002 CD4 T cell aging, 771 KLF2 controls T cell trafficking via S1P1 CD8 T cells specific for, analysis of synovial T cell activation by soluble co- and, 7632 TCR␣␤ combinations in, 3409 stimulatory molecules, letter, 4708 P-Selectin glycoprotein ligand-1, CD43 and, IL-15 abrogates vaccine-induced decreases

TNF-like cytokine production by IC-stimu- mediate E-selectin-dependent T cell in virus, SIVmac251-infected ma- lated monocytes, 7325 migration, skin, 2499 caques, 3492 8280 SUBJECT INDEX ͓VOL. 178

immunogenic epitopes, Mamu-A*01 com- Somatic hypermutations, human VDJ rear- IRF-2 regulates apoptosis via STAT1/3 plexed with, crystal structure, 944 rangements, lack of strand specific- and caspase-1 mechanisms, macro- sooty mangabeys resistant to, p300 and ity, 4322 phages, 3602 CREB at proximal IL-2 promoter, Sp1 recruitment at IL-6-inducible genes depen- T cells, 7720 in HIV-Tat regulation of IL-10, mono- dent on BRG1 gene, 345 Skin cytes, 798 STAT4 and, in development of IL-17 se- CCR4 required for cutaneous accumulation IL-1␣ induced by 17␤ E2 via ER␣ and, creting Th cells, 4901 of CD4 T cells, 3358 3059 STAT4 CD43 and PSGL-1 mediate E-selectin- Sphingosine 1-phosphate STAT3 and, in development of IL-17 se- dependent T cell migration, 2499 enhancement of Th17 cell development, creting Th cells, 4901 contact dermatitis, Th1 and Tc1 responses 5425 targeting by antisense phosphorothioate to T-bet overexpression, Tg mouse, regulates DC functions via S1P , 3437 ODNs, CIA suppressed by, 3427 3 ␤ 605 S1P1 mediates enhanced IL-4 production, STAT5, IL-2R -dependent activation of, cytokine induction of TSLP, keratinocytes, T cells, transgenic mouse, 4885 required for Foxp3 Treg develop- 3373 Spleen tyrosine kinase ment, 280 DC IL-12p80 in susceptibility to cutaneous in HIV-1 transfer from DCs to CD4 T STAT6 leishmaniasis, 7251 cells, 2862 agonist-driven development of CD4CD25 dermal fibroblasts induce DC maturation, target for curcumin, required for B lym- Foxp3 Treg cells requires, 7550 4966 phoma growth, 111 in CCL23 induction by IL-4, monocytes, lesions suppressed by transdermal CpG- Splenocytes, apoptotic, drive autoimmune 4335 ␥ ODNs, atopic dermatitis mouse response to PARP-1, mouse lupus STATs, IFN- -inducible gene expression model, 584 model, 95 regulated via JAK/STAT pathway, OSM secretion by infiltrating T cells acti- Src, in HIV-1 transfer from DCs to CD4 T choriocarcinoma cells, 1598 vates keratinocytes, 4615 cells, 2862 STBM. see Syncytiotrophoblast micropar- pIgR transports tetrameric IgM into, te- Src family kinases ticles leost fish, 5682 dysregulation in mast cells, ASK versus Streptococcus agalactiae, GAPDH acts as skin-infiltrating CD8 T cells initiate le- EL mice, 455 VIP, 1379 sions, AD, 5571 self-MHC-mediated activation of, DCs Streptococcus pneumoniae Ag presentation enhanced by CRP via tumor cell production of Mig essential for sensitize TCRs via, 2262 ␥ T cell-mediated cutaneous tumor Src homology 2 domain-containing 5-inositol Fc R on DCs, 7283 suppression, 2278 phosphatase, deficiency, GVHD C1q and C3 in innate immune response to, SLAM-associated protein abrogated by, 2893 CNS, 1861 mice deficient in, B cell activation and Src homology 2 domain-containing protein human CRP protects mice from infection, changes in gammaherpes virus la- tyrosine phosphatase substrate-1, 1158 IKK␣ and IKK␤ in ERK-dependent regu- tency reservoirs, 1692 ␣-GalCer-induced antimetastatic lation of MUC5AC transcription, regulation of development and humoral activity of NK T cells regulated by, 1736 immunity, follicular CD4 T cells, 6164 lung-specific CCL2 overexpression en- 817 Src homology region 2 domain-containing hances defense to, 5828 Slamf1 gene, mediates Nkt1 gene expression, protein tyrosine phosphatase-1, loss NF-␬B RelA subunit regulation during NKT cells, NOD mouse, 1618 increases CD8 T cell-APC conju- pneumococcal pneumonia, 1896 SLE. see Systemic lupus erythematosus gate formation, 330 Pspc protein, Factor H interacts with, 5848 Sle1c, augments NZB autoimmune pheno- Staphopain B, S. aureus, activates plasma Stromal cell-derived factor-1 types, murine lupus model, 4667 chemerin, 3713 responsiveness of, exposure of immature B SLP-76, loss confers resistance to neutrophil- Staphylococcal enterotoxin A, induces cells to Ag causes SHIP1-depen- mediated tissue damage, myeloid MCP-1 production, intestinal myo- dent reduction in, 3353 cells, 4606 fibroblasts, 8097 stimulates IL-10 secretion via AP-1, 1581 SLP-76 signalosome, CD28 requires Vav1 to Staphylococcus aureus Stromal cell-derived factor-1␣, triggers in- enhance TCR signaling at, 1363 lipotechoic acid and lipoproteins in, letter, creases in VLA-4 affinity and stabi- Smad 3, required for allergen-induced airway 2610 lizes lymphocyte tethers on remodeling, mouse, 7310 PIR-B receptors for bacteria, 4250 VCAM-1, 3903 Small intestine, CCR9-expressing T cells in, staphopain B activates plasma chemerin, Stromal cells, LT-independent TRANCE ex- Crohn’s disease, 3293 3713 pression, cryptopatches, ILFs and SmD peptide, induces Ab responses within TLR-2-mediated survival in macrophages, Peyer’s patches, 5659 snRNPs, 2565 4917 Stromal-derived factor-1, effect on neutrophil Smoke STAT1 recruitment, ALI, 8148 ␥ emphysema induced by, CD8 T cells re- airway MCH resolution by IFN- via Bax Stromal derived growth factor-1␣, mediates quired for inflammation, 8090 and, 8107 hematopoiesis via Tac1 and sub- exposure to, increases allergen-induced DC, required for immunity to L. major, stance P, BM cells, 2075 airway remodeling, mouse, 5321 7259 Substance P, hematopoiesis mediated by impairs NK cell-dependent tumor immune IRF-2 regulates apoptosis via STAT1/3 SDGF-1␣ via Tac-1 P and, BM surveillance, 936 and caspase-1 mechanisms, macro- cells, 2075 pulmonary emphysema induced by, IL-18 phages, 3602 Suicide genes, therapy with MCP-1 and, an- and IL-18R␣ in pathogenesis, 1948 osteopontin induces degradation of, macro- titumor effects of, HCC, 574 Smooth muscle cells phages, 1870 Sulfamethoxazole, stimulates DC signaling, airway, corticosteroid inhibition of GRO-␣ TGF-␤ suppresses IFN-␥-driven STAT1- 5533 via MKP-1, 7366 dependent gene expression, epithe- Superantigen, presentation by ASM to CD4 bronchial dsRNA-stimulated, TLR3 medi- lial cells, 4284 T cells elicits proasthmatic ates eotaxin-1/CCL11 release from, STAT2, IL-7/STAT5 signaling pathway and changes, 3627 489 survival of naive CD4 T cells, 262 Suppressors of cytokine signaling Sodium channels, NaV1.5 regulates endoso- STAT3 regulate IFN-induced antitumor activity of mal acidification, macrophages, airway epithelial, required for allergic in- immune effector cells, 4832 7822 flammation, mouse asthma model, role in JAK-STAT pathway, review, 2623 Sodium stibogluconate, treatment of visceral 6191 SOCS-3 signaling in T cells exacerbates L. donovani infection, circulating IFN induction of CXCL11 gene expression acetaminophen-induced hepatotox- GM-CSF and IC during, 5383 dependent on, 986 icity, 3777 Somatic hypermutation, VH, B cell clonal IL-10 induces IL-10 via, monocyte-derived SOCS1, KIR binds to JAK2 autophosphor- expansion and, OA, 557 macrophages, 4779 ylation site, 5058 2007] SUBJECT INDEX 8281

SOCS3, TNF-␣ regulates mRNA via binding affinity of, governed by T cell blood contains progenitor populations with MKK6/p38MAPK/MK2, 2813 MHC class restriction, 5727 clonogenic B and T lineage poten- Sydenham’s chorea, tubulin is target of auto- CD3␨ tyrosine phosphorylation induced by tial, 4147 antibodies in, 7412 TCR-MHC interactions, 4120 BM-derived hemopoietic precursors, com- Syk. see Spleen tyrosine kinase CD28 requires Vav1 to enhance signaling mittment to lineage after thymic Synapsin I, anti-gliadin Abs bind to, celiac at SLP-76 signalosome, 1363 arrival, 858 disease, 6590 DCs sensitize TCRs via self-MHC-medi- CCR5 surface expression levels, 5668 Synaptotagmin VII, expression and function ated Src family activation, 2262 CCR9-expressing, role in small intestine, of, CTLs, 1498 downstream quantitative network signals Crohn’s disease, 3293 Syncytiotrophoblast microparticles, in sys- predict IL-2 production response, CD4 temic inflammatory priming, preg- 4984 activated, TSLP action on, 6720 nancy and preeclampsia, 5949 ␥␦, i-IEL numbers restored by Bcl-2, activated by TLR-stimulated DCs fail to System xc-, inhibition of glutamate trans- IL-15 deficient mouse, 757 differentiate into Th2 cells, 1635 porter and, microglial toxicity to NF-␬B activation induced by, Bcl10/Malt AFP-specific, responses in HCC patients oligodendrocytes mediated by, signaling in, 953 undergoing embolization, 1914 6549 repertoire adaptation to self-peptides, CD4 autoreactive, autoreactive memory B Systemic lupus erythematosus T cells, 7032 cell formation stimulated by, 4793 characterization of lupus-related Lmb con- repertoire diversity, cell-mediated immu- B cells and, type I IFN required for Ab genics, 8195 nity independent of, 2950 response to adenovirus, 3505 high deficient CD4CD25 Treg cell function signal transduction in PTPN3-deficient CCL3 and CCL4 in generation of IL- in, 2579 mouse, 3680 6R␣ high IL-7R␣high prememory ␬ ERM phosphorylation causes increased T signaling regulation by NF- B2/p100, CD8 T cells, 778 cell adhesion and migration, 1938 7767 CCR4 required for cutaneous accumula- ␥ expression profile of Fc RIIb on leuko- SWI/SNF chromatin remodeling down- tion of, 3358 cytes in, 3272 regulated by, thymocytes, 7088 CCR5 and CD40 stimulation up-regu- ␣␤ memory and CD27neg B cell presence in, TCR combinations in SIV-specific CD8 lates A3G expression, 1671 6624 T cells, 3409 CD8 blockade promotes Ag responsive- ␣␤ murine model, Sle1c augments NZB auto- TCR repertoire and relapse of MOG- ness by inhibiting apoptosis of, immune phenotypes, 4667 induced EAE, 4865 6148 murine model of, apoptotic splenocytes TIM-1 association with, T cell activation CD27low, accumulation in lungs protects drive autoimmune response to regulated by, 4342 host against TB infection, 976 PARP-1 in, 95 T cells CD40 and impaired CD154 induction, murine model of, IL-21 blockade with IL- ␣␤ ␥ , OAS/PKR and, required for Ad:IFN- HIV-infected patients, 1645 21R.Fc reduces progression, 3822 HSV-1 inhibition, 5166 CTL avidity/compartmentalization to murine model of, low-dose peptide toler- ␣␤/␥␦, regulation by c-Jun, 5690 site of mucosal vaccination protects ance therapy generates DCs and abnormalities in CVID, 3932 against depletion of, SHIV, 7211 causes Treg cell expansion, 7849 activated/memory, regulated by p21CIP1/ differential expression and function of murine model of, suppression of autoim- WAF1, 2296 PDE4 subtypes, 4820 munity by CD8 T cells depends on activation, binding epitope position in tar- effector, inflammation-seeking homing Foxp3, 7649 get molecule determines efficiency, by, 8073 murine model of, T cell TRAIL, regulates 4650 effector memory, TCR antagonizes IP- effector CD4 Th cells and inhibits activation, HIV-Nef function via lym- 10-mediated TEM of, 3237 CD8 CTLs, 3962 phopenia, 5762 murine model of, T3 B cells do not give activation by enhanced NFATc1 nuclear follicular, SAP regulation of develop- rise to mature cells, 7511 occupancy, 4315 ment and humoral immunity, 817 NF-ATc2 regulates CD154, and IL-2 genes activation modulated by tumor-associated HIV-1 opsonization with complement in T cells, 1960 fibroblasts, lung, 5552 enhances DC infection and transfer p300 acetyltransferase activity suppresses activation of, inhibited by DCs via TGF-␤, to, 1086 SLE-like disease, mouse, 6941 4017 HIV-1 transfer from DCs to, role of Src SmD peptide induces Ab responses within activation of, regulated by mTOR, 2163 and Syk, 2862 snRNPs, 2565 activation regulated by TIM-1 association HIV-specific memory, duration of HIV Syt VII. see Synaptotagmin VII with TCR, 4342 exposure modulates maintenance adhesion and migration increased by ERM of, 788 T-bet phosphorylation, SLE, 1938 homeostasis during SIV infection, sooty regulates Th1 and Th17 lymphocytes, au- Ag-specific, CD5 in protection from tu- mangabeys, implications for AIDS toimmunity, 1341 mor-mediated AICD, 6821 pathogenesis, 1680 temporal dissection of functions, 3457 analysis of variables affecting specificity IFN-producing, mediated spore-induced Th1 and Tc1 responses to overexpression repertoire after VACV infection, immunity to B. anthracis, 2646 of, Tg mouse, contact dermatitis, 7890 IL-4 induction by TSLP, 1396 605 anergy, PPAR-␥ in, 2122 IL-7 and control of contraction of re- T cell help, CD4, CD8 T cell responses re- anergy predisposes to retinal autoimmu- sponses, 4027 quire, 6350 nity, 4276 IL-10 producing regulatory, LPS-in- T cell Ig domain and mucin domain 1 anergy regulated by mTOR, 2163 duced, suppress CD8 T cell re- association with TCR, T cell activation autoreactive, activation status determines sponses, 5429 regulated by, 4342 costimulatory blocker effects, 474 IL-10 regulates enterohepatic migration, effect on T cell activity and immune re- autoreactive, GM-CSF production required 7974 sponses, lung, 2249 for microglial cell activation and IL-12 and IFN-I synergise for IFN-␥ T cell Ig domain and mucin domain 3, TLR4 EAE onset, 39 production, 4498 and, cross-regulation determines B cells and, surface molecules trigger tro- IL-21 blocks Treg cell-mediated sup- sex differences in inflammatory gocytosis of membrane compo- pression of, 732 heart disease, 6710 nents, 3637 inhibition of transmethylation down- T cell receptors B7-deficient autoreactive, suppressed by regulates activation of, 5366 antagonize IP-10-mediated TEM of effec- CD4CD25 Treg cells, 1542 innate immune activation dependent on tor memory CD4 T cells, 3237 Bcl-2 overexpressing, CD4CD25 T cell- IL-18, salmonella-infected mouse, apoptosis mediated by, Treg cell resistance inhibition of autoimmunity and, 6342 to, 3474 transgenic mouse, 2778 IS regulated by CTLA-4, 5543 ␤ chain forming peptide-independent allo- Bet v 1-specific regulatory, functional Klotho in normal and RA-related aging, reactive, 6109 analysis of, 1189 771 8282 SUBJECT INDEX ͓VOL. 178

memory, MHC class II molecules and regulatory functions inhibited by DC- mediate intraocular tumor rejection via function of, 5488 produced IL-6, lupus-prone mouse, TNF-␣, eye, 6115 naive, IL-7/STAT5 signaling pathway 271 memory, effect of archeosomes on ex- and survival of, 262 CD4CD25- pansion and maintenance of, 2396 naive, TLR ligand-dependent activation Foxp3-, differentiate into Th17 cells, memory, IL-15 enhances IL-12/IL-18 by pDC impaired in HCV infec- 6725 pathway of IFN-␥ secretion, 4786 tion, 4436 naive, IL-2 and TGF-␤ in conversion to memory, responses require CD4 T cell OX40-mediated differentiation requires CD25 Foxp3 Treg cells, 2018 help, 6350 IL-2R, 7694 CD4CD25low memory, suppression by IDO-mediated RAR␥ regulates cell effector function adaptive, DTH suppressed by, transplan- tryptophan catabolism, 4260 and macrophage cytokine produc- tation tolerance, 3983 memory, Treg cell-dependent CD25 tion, 2113 CD8 function controlling homeostasis of, regulatory, PPAR-␥ required for protec- Ag-specific, host Tyk2 in contraction of, 1251 tion against colitis mediated by, 4482 naive, IL-21 promotes differentiation of, 2940 Ag-specific, impaired accumulation in 7640 regulatory TI, limit effectiveness of cy- CCL25-deficient intestinal epithe- NKR profiles imprinted on, 652 tokine-based immunotherapy, 3400 lium and lamina propria, 7598 p300 and CREB at proximal IL-2 pro- moter, SIV-resistant sooty manga- response to replication-competent VV, Ag-specific, necrotic tumor cell death beys, 7720 6374 impairs tumor-specific immune re- peripheral tolerance induction and cog- responses to MCSP, melanoma patients sponses, 1573 nate CD4 help, resting DCs, 2094 and healthy individuals, 7703 Ag-specific memory, responses inhibited primed by cross-presented intracranial resting, inhibited by TGF␤ under by imatinib mesylate, 2028 B cell-specific, clonotypes in PBLs and Ag, 6038 steady-state conditions, 6931 recognition patterns of immunodominant role in rapid Th2 effector-like function, pancreatic islets, 1388 bleomycin hydrolase in Ag presentation CMV Ags, 4455 murine neonates, 2667 repertoire specific for HLA-A2-re- S1P mediates enhanced IL-4 produc- and responses of, 6923 1 C1q augments IC presentation to, 7581 stricted HIV-1 capsid epitope, 7756 tion, transgenic mouse, 4885 required for inflammation, cigarette- SAgs presentation by ASM to, elicits central and effector memory HIV-spe- cific, differentiated by epitope smoke-induced emphysema, 8090 proasthmatic changes, 3627 responses induced by HIV DNA vac- TCR repertoire adaptation to self-pep- cross-reactivity, 3750 CMV-, EBV- and influenza-specific, cine, 2318 tides, 7032 route of BM-DCs immunization admin- ␣ ␣ ␤ cellular niches, letter, 2611 TNF- regulates 1 1 integrin and istration determines distribution of, Foxp3 T reg cell subsets, 201 conjugation with APCs, increased by SHP-1 loss, 330 1512 transfer of Ab neutralized HIV-1 by self-Ag-specific human cytolytic, cyto- cytolysis and IL-2 production by, sup- DC-SIGN expressing cells, 3177 toxicity controlled by IL-12, 3566 pressed by HIV-specific IL-10- vitamin E reverses age-associated de- SIV-specific, analysis of TCR␣␤ combi- positive CD8 T cells, 3265 cline in IS formation by, 1443 nations in, 3409 depletion in SIV-infected sooty manga- CD4 and CD8 skin-infiltrating, initiate lesions, AD, bey monkeys, 8002 Ag presentation by CD103 BLN DCs, 5571 donor, mediate GVL without GVHD, 6861 suppression of autoimmunity by, de- anti-CD3 mAb conditioned recipi- collagen distribution and integrin ex- pends on Foxp3, mouse lupus ents, 838 pression on, during influenza infec- model, 7649 effect of IL-12 on signal 3 and re- tion, 4506 telomerase activity loss and decreased sponses to solid tumors, 6752 survival regulated by PKC␪, cRel and Akt phosphorylation, 7710 effector, Ag presentation by nonhemo- TNF in survival activation and toler- PKB, 2932 poietic cells amplifies expansion of, CD4CD25 ance, 6735 5802 tolerance induction by Ag presentation Foxp3, IL-2 function in regulating dis- effector memory, functionally distinct tribution of thymic and peripheral by hepatocytes, 6849 populations of, 4112 urinary bladder epithelial Ag induces cells, 4062 Gag-specific, early recognition of AIDS- Foxp3 regulatory, agonist-driven devel- tolerance and autoimmune re- infected cells, 2746 sponse, 539 opment requires STAT6, 7550 H2-M3-restricted, induced by peptide- Foxp3 regulatory, expansion during fol- virus-associated bystander effects and pulsed DCs, protect against M. tu- response of, 7267 licular phase of menstrual cycle, berculosis, 3806 ␥ 2572 virus-specific, homeostasis and IFN- , HBV-specific, suppressed by PD-1: 7616 Foxp3 regulatory, selective survival af- PD-L1 interactions, liver, 2714 virus-specific memory, Ag not required ter rapamycin exposure, 320 helpless, TRAIL generation by, apopto- for maintenance, lung, 4721 immunosuppression mediated by, sup- tic cell-induced tolerance via, 2679 virus-specific memory, indigenous mi- ported by Cd11c DCs, murine en- high-avidity with specific cytokine/gran- crobiota and maintenance of, cephalomyelitis, 6695 zyme B profiles induced by muco- MCMV infected lungs, 5209 regulation of airway allergic responses sal immunization with HIV-1 pox ␤ virus-specific memory, response elicited via IL-10 induction of TGF- , virus, 2370 by CD4 T cells displaying viral lung, 1433 HIV-specific IL-10-positive, suppress epitopes, 5465 regulatory, DCs acquire LN homing cytolysis and IL-2 production by CD40 and CD40L in counteracting antitu- potential via, 4184 CD8 T cells, 3265 mor immune responses, 2047 regulatory, EAE recovery requires B IFN-␥ production controlled by CD152, CD43 and PSGL-1 mediate E-selectin- cell regulation of IL-10 and, via 2132 dependent migration, skin, 2499 B7, 3447 IL-18 in IgE response suppression medi- clonally expanded, calcific aortic stenosis regulatory, migration requires L-selec- ated by, 4771 infiltration by, 5329 tion, 291 immunodominance, interference with Ag costimulatory function for CD40, 671 regulatory, role in immune evasion presentation and, MCMV, 7235 CXCR3, NK cell-stimulated recruitment mechanisms, B cell lymphomas, influenza A-specific, survival in liver, of, P. berghei-mediated cerebral 6840 2737 malaria, 5779 regulatory, suppress B7-deficient autore- influenza Ag depots do not induce cyto- cytokine-dependent Blimp-1 expression active T cells, 1542 toxic response, 7563 inhibits IL-2 production, 242 regulatory, suppress intestinal inflamma- influenza virus-specific, hidden epitopes cytotoxic and memory, differential sur- tion, lamina propria, 4937 in secondary responses, 3091 vival, 3483 2007] SUBJECT INDEX 8283

DC CD83 knockdown by siRNA inhibits influenza A virus-specific effector and populations with specificity for neo-self stimulation of, 5454 memory, in vivo cytotoxicity Ag and relation to tolerance, 3544 DCs in LN recruitment of NK cells and, threshold, 1285 proliferation of, blocked by PGE2 released 3886 iNK, amplify innate immune response to by F. tularensis-infected macro- DNA methylation downregulates IL-7R␣, LPS, 2706 phages, 2065 5473 iNK, IL-12 enhances IL-4 production, proliferation requires Atm-regulated oxida- effect of TIM on immune responses, lung, 5435 tive stress responses, 4757 2249 insulin-specific, recognize insulin MHC- PRP4 interaction with KLF13 regulates effector binding segment, NOD mouse, CCL5, 7081 CD56 marks subset, human intestine, 6051 regulatory 5524 intestinal, CD18 and immune check point CD25 function dependent on, control- inhibition of, Fc␥RIIB on DCs enforces responses, 2104 ling memory CD8 T cell homeosta- peripheral tolerance via, 6217 intratumoral CD4CD25 GITR Treg cells sis, 1251 regulated by CCR4 via FasL, 4891 suppress allogeneic CD8 and CD4 control primary immune response to T cells, follicular lymphomas, 4051 foreign Ag, 2961 TLRs and anti-influenza B cell re- ␣ sponses, 2182 killed by TNF- -induced GM2, RCC, defect in APECED, 1208 effector/memory, antigen density and regu- 6642 in EAE-preventive effect of DCs ex- KIR2DL5 expression on surfaces of NK pressing MOG and TRAIL, 918 latory check point, 2307 cells and, 4402 enhanced by PPAR␥, 4129 elicitation of tumor responses following KLF2 controls trafficking via L-selectin H60-mediated anaplastic anemia amelio- BORIS immunization, 566 and S1P1, 7632 rated by infusion of, 4159 Foxp3 KLF13 regulates survival, 5496 immunity to T. spiralis controlled by development of homing receptors, 301 MHC class restriction governs TCR-bind- IL-10, TGF-␤ and, 1039 induced by H4R activation, 8081 ␤ ing affinity, 5727 maintain long-term tolerance to MBP, induction by TGF- , 7667 modeling movement within lymph nodes, 887 regulatory, development requires IL- 5505 prevent M. tuberculosis clearance, 2661 ␤ 2R -dependent STAT5 activation, Mtb-specific, functional signatures of resistance to TCR-mediated apoptosis, 280 IFN-␥ and IL-2, 5217 3474 ␤ regulatory, IL-2 essential for TGF- - mucosal protection by parenteral immuni- Salmonella vaccination stimulated, pro- mediated induction, 4022 zation dependent on geography of, tects against EAE, 1791 regulatory, in control of immune re- 2387 suppressive mode via B7-H4 induction sponses, 6901 negative regulation by B7S3, 3661 via IL-10 on APCs, letter, 4704 regulatory, incomplete deletion follow- ␤ negative regulation of rankl by 15d-PGJ2, TGF- -producing tumor cells evade ing antiCD25 treatment, malaria- role of NF-␬B and EGR, 4039 immune system via CD4ϩCD25- T infected mouse, 4136 neutrophils and, in protection from ma- cell conversion to, 2883 regulatory, Th3 cells in peripheral toler- laria, young susceptible rats, 1713 Th/Treg cell imbalance in MUC1 trans- ance and induction of, 179 NF-ATc2 regulates CD154, and IL-2 genes genic mice, 2787 GC helper, with suppressive activity to in, SLE, 1960 TLR4 potentiates functions via gp96, CD4 T cells, 5010 NK 3219 ␥␦, cytokine responses and unconventional ␣-GalCer-induced antimetastatic activity tumor rejection after depletion of, me- pleiotropy, 4304 regulated by SHPS-1, 6164 sotheliomas, 4089 ␥␦, CD1-restricted recognition of lipid ␣-GalCer-loaded tumor cells induce in- requirements for migration of, LN, 7747 antigens, 3620 nate-NKT and NK cell-dependent responses to OPE cells, role of TSP-1, ␥␦, IFN-␥ production via epigenetic and resistance, 2853 6994 transcriptional programs, 2730 activation mediates neutrophil IFN-␥ skin-infiltrating, OSM secretion by, acti- gene expression analysis to identify c-Rel production and renal I/R injury, vates keratinocytes, 4615 targets, 7097 5899 SOCS-3 exacerbates acetaminophen-in- Gi-dependent motility, CCR7 in, LN, 2973 B1a cells and, autoantibody production duced hepatotoxicity, 3777 GITR and CD25-expressing, modulate and renal disease associated with stimulation of, inhibited by PGI2 analogs, asthma risk, 1477 NZB chromosome 4, mouse, 1608 DCs, 702 gp120 binding to CXCR4 causes p38-de- BATF and AP-1 in maturation, thymus, synovial, activation by soluble costimula- pendent apoptosis, 4846 58 tory molecules, RA, letter, 4708 Graves’ disease, aberrant expression of host, prevent GVHD and allow graft TCR activation eliminates cell surface IGF-1R, 3281 antitumor activity, BMT, 6241 GluR3 via GB, 683 HPV-specific, DC HPV VLP uptake medi- IL-21 production modulates activation telomerases in, review, 6689 and cytokine production, 2827 Th2-polarized, activated DCs induce Th1 ated by Fc␥R in induction of, 7587 invariant, CD1d-independent prevention response from, 3583 human, GRAIL up-regulation and Notch- of type I diabetes and, NOD Th17 mediated suppression of, 6158 mouse, 1332 augmentation in S1P double transgenic IFN-␥ -induced CXCL10, CCL5 with Ptx 1 invariant, DC function modulated by mouse, 6806 promote entry to CNS, 8175 - - ␥ TLR ligands and, 2721 CD4CD25 Foxp3 T cells differentiate IFN- -producing, enhanced by CD40 li- novel activator of, improves diabetes into, 6725 gand mimetics, T. cruzi infection, outcomes, NOD mouse, 1415 development enhanced by S1P, 5425 6700 role in TNF-matured DC protection expressing CCR2, 7525 IgG opsonization of HIV-1 inhibits trans- from autoimmunity, EAE, 4908 IL-2 regulates Treg cells and, tumor fer to, 7840 Slamf1 mediates Nkt1 gene expression, microenvironment, 6730 ␣ high ␣high IL-6R IL-7R prememory CD8, NOD mouse, 1618 IL-6 induced by pertussis toxin pro- CL3 and CCL4 in CD4 T cell help subsets induced by C. pneumoniae and motes IL-17-producing CD4 cell in generation of, 778 C. muridarum, 1048 generation, 6123 IL-7 in Fas-mediated apoptosis, HIV infec- type I IFN-producing CD4 V␣14i, facil- polarized by CD11c DCs, murine en- tion, 5340 itate hepatocyte priming of IL-10- cephalomyelitis, 6695 IL-7R intracellular domain in development producing CD8 T cells, 2083 TLR ligands restore proliferation and pro- of, 228 V␣14i, foreign lipid activation and DC- mote autoimmune myocarditis, ILT3 inhibits responses in cancer patients, specific self-recognition, 2755 3466 7432 persistence controlled by hyperthermia via tolerant, NFAT-mediated TGF-␤1 expres-

immune function suppressed by B7-H1 c-FLIPs degradation, 3944 sion, 3067 up-regulated on myeloid DCs, PKC␪ in Fax/FasL-mediated apoptosis, tumor-specific, tolerization, prostate cancer chronic hepatitis B, 6634 312 mouse model, 1268 8284 SUBJECT INDEX ͓VOL. 178

tumor-specific clones, detection of, mela- Tac1 gene, hematopoiesis mediated by Thymus-and activation-activated chemokine, noma, 6789 SDGF-1␣ via substance P and, BM in Th2 cell recruitment, bronchial type B, activation and in vivo peptide pre- cells, 2075 epithelial cells, 7678 sentation, 122 TACE. see TNF-␣-converting enzyme TICAM1. see Toll-IL-1 receptor-containing UV-induced regulatory, migratory behavior Takifugu rubripes, pIgR transports tetrameric adaptor molecule altered by tissue-specific DCs, 877 IgM into skin, teleost fish, 5682 Tie-2, expression and Ang-2 responses, VACV-specific, Ag recognition different Tanshinone IIA, rescues mice from lethal monocytes, 7405 between CD4 and CD8 T cells, sepsis via HMGB1, 3856 Tight junctions, IL-1␤ increases intestinal 6814 Target of rapamycin, mammalian, regulates epithelium TJ permeability, 4641 V␦1 ␥␦, control neutrophil infiltration after T cell activation and anergy, 2163 TIM. see T cell Ig domain and mucin do- E. coli infection via IL-17, 4466 Tat. see Trans-activator of transcription main 1 T helper cells TCR:peptide-MHC complex, role in activated Tim-3. see T cell Ig domain and mucin do- CCR7-driven B-T helper cell collaboration DCs induction of Th1 response main 3 in activation of B cells, 1468 from Th2-polarized T cells, 3583 Tissue factor, induced by SAA, monocytes, CD4, DCs and, IL-4, IL-13 and IL-4R␣ in Teleost fish 1852 maturation and function, 219 pIgR transports tetrameric IgM into skin, TL1A, induced by Fc␥R, monocytes and CD4 effector, regulated by T cell TRAIL, 5682 DCs, 4033 murine lupus model, 3962 TNF superfamily diversification in, charac- TNF-␣-converting enzyme, required for nor- CD4 Th17, distribution of, PLP 139–151- terization and analysis, 7955 mal lymphocyte development, 4214 induced EAE, 1372 Telomerases TNF-like cytokine, production by IC-stimu- IL-17-secreting, STAT3 and STAT4 in activity loss and decreased Akt phosphory- lated monocytes, RA, 7325 development, 4901 lation, CD8 T cells, 7710 TNF-like weak inducer of apoptosis, interac- memory, flexibility in responses, 4080 in T lymphocytes, review, 6689 tions with CD163, 8183 memory, Schnurri-2 controls generation of, Tetraspanins, CD37, dectin-1 interaction TNF-receptor-associated factor 2, role in 4926 with, inhibits IL-6, 154 Peyer’s patch development, 2272 T-bet regulates Th1 and Th17 lympho- Th3 cells TNF-related activation-induced cytokine, LT- cytes, autoimmunity, 1341 in peripheral tolerance, Foxp3-positive T independent stromal cell expression Th/Treg cell imbalance in MUC1 trans- reg cell induction and, 179 of, cryptopatches, ILFs and Peyer’s genic mice, 2787 in peripheral tolerance, IL-2 deficient mice patches, 5659 Th1, Gadd45␣ regulates p38-dependent and autoimmunity, 172 TNF-related apoptosis-inducing ligand DC cytokine production and differ- Thiocyanate, transport, pendrin and anion B cells sensitized to, via c-FLIP by IKK entiation of, 4153 channels in, bronchial epithelial inhibition, MCL, 1923 Th1, TLR2 triggers effector functions, cells, 5144 DCs expressing MOG and, Treg cells in Thioredoxin, M. sympodialis, crystal struc- EAE-preventive effect of, 918 6715 ture of, 389 generation by helpless CD8 T cells, apo- Th1 and Tc1 responses to T-bet overex- Thrombospondin, CD47 interactions with, ptotic cell-induced tolerance via, pression, Tg mouse, contact derma- inflammation reduced by, 5930 2679 titis, 605 Thrombospondin-1, role in T cell responses hepatocytes sensitized by HBV to apopto- Th1 and Th2, identification of genes in to OPE cells, 6994 sis induced by, 503 early differentiation, 3648 Thymic stromal lymphopoietin T cells, regulates effector CD4 Th cells Th1 and Th2, EPC recruitment and angio- action on CD4 activated T cells, 6720 and inhibits CD8 CTLs, mouse genic switch dependent on, asthma, cytokine induction of, skin keratinocytes, lupus model, 3962 6482 3373 TNF-related apoptosis-inducing ligand gene, Th2, EGFR-dependent promotion of, E- IL-4 induction by, CD4 T cells, 1396 EC, selectively regulated by IFNs, cadherin and, bronchial epithelial Thymocytes 1122 cells, 7678 ␤-catenin regulates positive selection of, Tolerance Th2 regulation of cytokine genes by p38- 5028 1,25(OH)2D3 modulates tolerogenic prop- mediated GATA-3 phosphoryala- Bcl10/Malt1 signaling essential for TCR- erties in myeloid DCs, 145 tion, 2491 induced NF-␬B activation, 953 apoptotic cell-induced, via TRAIL genera- TLR-stimulated DC-activated CD4 T cells DN to DP transitions, Akt isoforms in, tion by helpless CD8 T cells, 2679 fail to differentiate, 1635 5443 central, medulla formation and, thymus, T lymphotropic virus type I, human, genetic Egr in differentiation and survival, 6796 829 stability of epitopes, 5966 ␥␦, developmental differences, 711 human, maternal acceptance of fetus, re- T regulatory cells PI3K class IA p85␣ subunit regulates view, 3345 Ag-specific Foxp3, enriched by RAPA- ␤-selection in development of, immune modulation and, induction by conditioned DCs, 7018 1349 RelB-silenced DCs, 5480 CD4, antibody-mediated allograft rejection proliferation blocked by E2A and HEB, induction by Ag presentation by hepato- and, 2221 5717 cytes, T cells, 6849 CD4CD25, colitis ameliorated by FTY720 SWI/SNF chromatin remodeling down- innate immune system in allograft rejec- via, 2458 regulated by TCRs, 7088 tion and tolerance, review, 7503 high CD4CD25 , deficient function in SLE, Thymopoiesis, FL expands lymphoid progen- intrinsic, in allophenic mice, Pillars of Im- 2579 itors and T cell reconstitution after munology, 4007 CD4CD45, donor, detachment from graft, BMT, 3551 issues in clinical transplantation, review, liver transplantation, 6066 Thymus 5419 CD25 Foxp3, IL-2 and TGF-␤ in conver- Aire gene controls genes for epithelial long term, to MBP, maintained by Treg sion of naive CD4CD25- T cells to, function, 7173 cells, 887 2018 Aire gene epithelial differentiation, 3007 low-dose peptide therapy, generates pDCs FOXP3, CD4CD25 T cells and, expansion CD3␥, ␤-strand and proximal stalk in de- and causes Treg cell expansion, during follicular phase of menstrual velopment, 3668 mouse lupus, 7849 cycle, 2572 CD45 in Lck regulation, 2056 MyD88 pathways in synergy, priming and, IL-2 regulates Th17 cells and, tumor mi- medulla formation and central tolerance, role of TLR agonists in, 1164 croenvironment, 6730 829 peanut allergens, CD28/CTLA-4-B7 path- IL-21 blocks suppression of CD4 T cells selective settling regulated by cytokine and way in sensitization and, 6894 by, 732 chemokine receptors, 2008 peripheral, enforced by Fc␥RIIB on DCs natural-induced and de novo-induced, role severe developmental defects in insertional via effector T cell inhibition, 6217 in tumor-specific tolerance, 2155 mutant mouse model, 5018 peripheral, induction in CD8 T cells, cog- nonintestinal CD8␣␣ TCR␣␤, EAE pre- unique fibroblast population identified by nate CD4 help and, resting DCs, vented by, 6043 MTS-15, 4956 2094 2007] SUBJECT INDEX 8285

peripheral, induction using ECDI-fixed role in granuloma/macrophage fusion in- TLR7, role in Ab-mediated viral RNA APCs uses Ag presentation for pre- duced by mycobacterial lipoman- recognition, 3363 vention of EAE, 2212 nan, 3161 TLR7 agonists, sensitization of IFN-␤- peripheral, Th3 cells in, Foxp3-positive T role in IL-8 and IDO expression, HGF, preactivated DCs to, 6208 reg cell induction and, 179 1151 TLR9, signaling in KRV-induced autoim- peripheral, Th3 cells in, IL-2 deficient signaling inhibited by cell-permeable pep- mune diabetes, BBDR rat, 693 mice and autoimmunity, 172 tides, 2655 TLR9 determines CSR to IgG2a, B cells, peripheral CD8 T cells, transcriptional tar- TLR-2 2415 geting of B cells for induction of, survival of S. aureus in macrophages TLR9 expression and function abolished 7738 mediated by, 4917 by HPV16, 3186 T cell populations with specificity for neo- TLR activation induces hormones, chemo- TLR16, ligand specificity and species-spe- self Ag and relation to, 3544 kines and defensins, EECCs, 4296 cific interaction with TLR2, TNF in survival activation and, CD8 T TLR/CD40 stimulation regulates CD70 chicken, 7110 cells, 6735 expression by DCs, 1564 viral ligands, immunomodulatory effects transplant, promoted by RAPA-enriched TLR/NF-␬B signaling in commensal bac- dependent on IL-12 and IL-10, ex- DCs, 7018 teria-induced colitis, gnotobiotic perimental asthma, 7805 transplant, DTH suppressed by mice, 6522 Toxoplasma gondii, inhibits IFN-␥-inducible CD4CD25low adaptive Treg cells TLR1 gene expression, fibroblasts, 5154 during, 3983 human, P315L SNP impairs innate im- TRAF2. see TNF-receptor-associated factor 2 transplantation, B cells required for anti- munity to microbial components, TRAIL. see TNF-related apoptosis-inducing CD45RB-induced, 6028 6387 ligand tumor-specific, natural-induced and de no- SNP impairs trafficking, protects against TRAM. see TRIF-related adaptor molecule vo-induced Treg cells, 2155 leprosy, 7520 TRANCE. see TNF-related activation-in- tumor-specific T cells, prostate cancer TLR2 and, age-associated defects in, duced cytokine mouse model, 1268 970 Trans-activator of transcription urinary bladder epithelial Ag induces auto- TLR2 HIV, regulation of IL-10 by, involves immune response and, CD8 T cells, effect of enterotoxin type IIB A subunit CaMK-activated p38, Sp-1 and 539 on B subunit and interaction with, CREB-1, monocytes, 798 Toll-IL-1 receptor-containing adaptor mole- 4811 HIV-1, elicits mitochondrial hyperpolariza- cule, evolution of function in verte- expressed in kidneys, role in ischemic tion and respiratory deficit, cortical brates, 4517 renal injury, 6252 neurons, 869 Toll/IL-1 receptor domain-containing adaptor mediates neuroinflammation and neuro- HIV-1, CD40 ligand and, in inflammation, inducing IFN ␤ nal damage, 6476 HAD, 3226 TLR4 and TLR5 loss abolishes bacterial Transcription factors role in host response to P. aeruginosa, recognition by Langerhans cells, complexes of CD21 genes and CD23 lung, 3170 1986 genes with, MZ B cells, mouse, role in innate immune responses to E. coli TLR9 and, innate responses to Wolba- 7139 pneumonia, lung, 3153 chia bacteria in B. malayi and O. TFII-I, B cell proliferation controlled by, Toll-like receptor ligands volvulus, dependent on MyD88, 2631 DC function modulated by iNKT cells Mal and, 1068 Transendothelial migration and, 2721 triggers effector Th1 functions, 6715 IP-10-mediated, of effector memory CD4 recognition of TLR-dependent microbial TLR3 T cells, antagonized by TCRs, ligands by bronchial epithelial antiviral responses dependent on, acti- 3237 cells, 3134 vated by influenza A virus, lung mediated by CD99, neutrophils, 1136 restore T cell proliferation and promote epithelial cells, 3368 Transforming growth factor-␤ autoimmune myocarditis, 3466 essential for immunity induction to PTV CD4CD25 T cell regulation of allergic TLR2 ligands, S. aureus protein A triggers by dsRNA and poly(I:C12U), 5200 responses depends on IL-10 induc- B cell proliferation via, 2803 mediates eotaxin-1/CCL11 release from tion of, lung, 1433 TLR7 ligands inhibit CpG-A- and CpG-C- dsRNA-stimulated BSMCs, 489 DC express LAP and inhibit T cell activa- ␣ ODN-induced IFN- , pDCs, 4072 recognition of rotavirus dsRNA induces tion via, 4017 Toll-like receptors severe intestinal injury, mouse, Foxp3 induction by, T cells, 7667 agonists, MyD88-pathways in synergy, 4548 IL-2 and, in conversion of naive priming and tolerance, 1164 TLR4 CD4CD25- T cells to CD25 Foxp3 agonists to, promote terminal plasma cell cathelicidins block activation of, DCs, Treg cells, 2018 differentiation of B cell subsets, 1829 induction of Foxp3 Treg cells, role of 7779 DCs expressing, fibronectin EDA targets IL-2, 4022 anti-influenza B cell responses and, effec- antigens to, 748 inhibition of resting CD4 T cells under tor T cells, 2182 DMBT1 gene regulation via NOD2 and, steady-state conditions by, 6931 Bcl10 controls TCR- and Fc␥R-induced modulates bacterial invasion, 8203 mucosal responses of IgA2 and, grass pol- actin polymerization, 4373 ethanol and lipid rafts, mechanisms of len immunotherapy, 4658 bone marrow myeloid cell DEC205Gr-1 ethanol action, review, 1243 regulatory, immunity to T. spiralis con- subset expression of chemokines in glucocorticoid conditioning of my- trolled by IL-10, Treg cells and, and, 7833 eloid progenitors, 2517 1039 CD44 regulates LPS-TLR signaling and macrophage survival mediated by, re- suppresses IFN-␥-driven STAT1-depen- inflammation, macrophages, 2469 quires MyD88 and TNF-␣, 3731 dent gene expression, epithelial enhanced IL-10 production by TLR4- and neutrophils stimulated by, MyD88-inde- cells, 4284 TLR2-primed DCs, 6173 pendent pathway not mobilized in, tumor cells producing, evade immune sys- HMGB1-TLR4 signaling in HS-induced 7344 tem via CD4ϩCD25- T cell conver- NAD(P)H oxidase activation, 6573 potentiates Treg functions via gp96, sion to Treg cells, 2883 IL-27-induced ligation dependent on IRF3, 3219 Transforming growth factor-␤1 DCs, 7607 and Tim-3 cross-regulation determines control of CNS autoimmunity mediated lamprey, properties of, 397 sex differences in inflammatory by, role of CD26, 4632 modifies BLyS receptor expression, follic- heart disease, 6710 NFAT-mediated expression of, tolerant T ular and MZ B cells, 7531 TLR5, interaction with PKD required for cells, 3067 role in differential regulation of IL-12 re- response to flagellin, 5735 Transmembrane proteins, endosomal traffick- lease in DC and macrophage re- TLR5 in susceptibility to E. coli UTIs, ing of, MHC-class I presentation, sponse to Mtb, 5192 mouse, 4717 7932 8286 SUBJECT INDEX ͓VOL. 178

Transplantation simvastatin potentiates apoptosis induced NK cell-dependent immune surveillance ␬ A2AR activation attenuates allograft rejec- by, role of NF- B in, 2507 impaired by cigarette smoke, 936 tion, 4240 in TLR4-mediated macrophage survival, NK cells regulate tumor-specific CTLs and B cells required for anti-CD45RB-induced 3731 Ag presentation, syngeneic lym- tolerance, 6028 Tumor necrosis factors phoma model, 6140 bone marrow, host NK T cells prevent diversification in teleosts, characterization NSCLC-associated fibroblasts modulate GVHD and allow graft antitumor and analysis, 7955 tumor-associated T cell activation, activity, 6241 lethal shock induced by, mapping of resis- lung, 5552 BTLA in cell survival, GVHD, 6073 tance of DBA/2 mouse, 5069 P815, comparison of SFV, adenovirus and clinical, tolerance issues in, review, 5419 in survival activation and tolerance, CD8 ALVAC vectors in CTL responses innate immune system in allograft rejec- T cells, 6735 to, 6761 tion and tolerance, review, 7503 trafficking via endocytosis, mast cell gran- rejection after Treg cell depletion, me- liver, detachment of donor CD4CD25 Treg ules, 5701 sotheliomas, 4089 cells from graft, 6066 vaccine, protection against arthritis without rejection of, mediated by granulysin, trans- RAPA-enriched DCs promote tolerance, activating latent tuberculosis, 7450 genic mouse, 77 7018 Tumors small Rho GTPases mediate inhibition of tolerance, DTH suppressed by ␣-GalCer-loaded, induce innate-NKT and DC endocytic activity induced by, low CD4CD25 adaptive Treg cells NK cell-dependent resistance to, 7787 during, 3983 2853 SOCS regulate IFN-induced antitumor ac- Trastuzumab, engineered epitopes show anti- Ag-specific immune responses against, tivity of immune effector cells, tumor activity against HER-2/neu, mDCs synergize with pDCs in, 4832 7120 1534 solid, effect of IL-12 on signal 3 and T TREM-1. see Triggering receptor expressed antitumor effects of suicide gene therapy cell responses to, 6752 on myeloid cells-1 with MCP-1, HCC, 574 systemic IL-23 administration induces an- Trichinella spiralis, immunity to, controlled CD4 TI Treg cells limit effectiveness of titumor immunity via IL-12 and ␤ by IL-10, Treg cells and TGF- , cytokine-based immunotherapy, Th1 type response, 7571 1039 3400 T cells specific for, tolerization, prostate TRIF. see Toll/IL-1 receptor domain-contain- CD5 protects tumor Ag-specific T cells cancer mouse model, 1268 ing adaptor inducing IFN ␤ TGF-␤ producing, evade immune system from tumor-mediated AICD, 6821 ϩ - TRIF-related adaptor molecule, role in LPS CD8 T cells mediate intraocular tumor via CD4 CD25 T cell conversion ␬ to Treg cells, 2883 and LTA induced NF- B activa- rejection via TNF-␣. eye, 6115 trastuzumab, engineered epitopes show tion and cytokine production, hu- CD40 and CD40L in counteracting antitu- antitumor activity against HER-2/ man cells, 2148 mor immune responses, T cells, neu, 7120 Triggering receptor expressed on myeloid 2047 cells-1 tumor cell production of Mig essential for CD200 expression on tumor cells sup- LPS-induced, regulated by PGE , macro- T cell-mediated cutaneous tumor 2 presses antitumor immunity, 5595 phages, 1144 suppression, 2278 combinatorial protein transfer, chemotactic NTAL regulates TREM-1/DAP12-induced tumor-primed NK cells lyse NK-resistant and costimulatory molecules, anti- cytokine production, myeloid cells, tumor targets, 85 tumor responses, 3301 1991 type I interferon and antitumor responses, detection of individual melanoma tumor- Trogocytosis, of membrane components trig- NK cells, 7540 specific T cell clones, 6789 gered by B cell and T cell surface unique human Ags, immunobiology and elicitation of T cell responses to, following molecules, 3637 clinical trial use, review, 1975 Trypanosoma cruzi, CD40 ligand mimetics BORIS immunization, 566 TWEAK. see TNF-like weak inducer of apo- enhance IFN-␥-producing T cells, eosinophils in immune surveillance, 4222 ptosis 6700 Factor H down-regulation sensitizes to Tyro3, macrophages and DCs use Axl/Mertk/ Tryptophan, IDO-mediated catabolism of, complement and reduces growth of, Tyro3 receptors in apoptotic cell memory CD8 T cell suppression NSCLC, 5991 clearance, 5634 by, 4260 human mannose receptor antigenic target- Tyrosine kinase 2, host, in contraction of TSLP. see Thymic stromal lymphopoietin ing induces immunity, 6259 Ag-specific CD8 T cells, mouse, Tuberculosis human tumor immunology at molecular 4482 CNS, monocyte-astrocyte networks regu- divide, Pillars of Immunology, late MMP gene expression, 1199 2615 UL18 CXCL8, fibroblast secretion of, limits my- IL-6 in tumor exosome inhibited differen- HCMV, inhibits LIR-1ϩ and activates cobacterial survival in macro- tiation of BM DCs, 6867 LIR-1- NK cells, 4473 phages, 3767 IL-12 alters functional profile of macro- LIR-1 and, in response to CMV, 3536 latent infection characterized by IL-8, phages associated with, 1357 UL49.5, regulates CTL epitope presentation FOXP3 and IL-12␤ mRnA, 3688 IL-28 elicits antitumor responses to fibro- by Qa-1b, 657 synergistic effect of BCG and tuberculosis sarcoma, mouse, 5086 Ultraviolet light, UVB and histamine recep- subunit in cationic liposomes, 3721 ILT3 inhibits T cell responses in cancer tor function, effect on allergic re- Tubulin, as target of autoantibodies in Sy- patients, 7432 sponses to inhaled antigens, 2794 denham’s chorea, 7412 immune responses against, targeting of Unfolded protein response, MHC class I ex- Tularemia, MMP9 enhances host susceptibil- CD40 Ag induces, 4169 pression impaired by stimulation ity to pulmonary infection by F. immunotherapy with capsaicin, 3260 of, 3612 tularensis types A and B, 1013 intratumoral ␣-gal glycolipid injection in- UPR. see Unfolded protein response Tumor necrosis factor-␣ duces xenograft-like destruction, Urinary tract infections, E. coli, TLR5 in CD8 T cells mediate intraocular tumor 4676 susceptibility to, mouse, 4717 rejection via, 6115 intratumoral CD4CD25 GITR Treg cells Ursolic acid, CD46 in IL-1␤ release induced GM2 induced by, kills T cells, RCC, 6642 suppress allogeneic CD8 and CD4 by, peritoneal macrophages, 4854

inhibits apoptotic cell clearance via cPLA2, T cells, follicular lymphomas, 4051 Uveoretinitis, T cell anergy predisposes to macrophages, 8117 microenvironment of, IL-2 regulates Th17 retinal autoimmunity, 4276 LPS augments production, macrophages, and Treg cells, 6730 T2D mice, 663 natural-induced and de novo-induced Treg Vaccination regulated by Cia6 and Cia4 loci, 2344 cells, role in tumor-specific toler- comparison of SFV, adenovirus and AL- ␣ ␤ regulates 1 1 integrin and Foxp3 T reg ance, 2155 VAC vectors in CTL responses to cell subsets, CD4 T cells, 201 necrotic cell death impairs immune re- P815 tumor, 6761 regulates SOCS3 mRNA via MKK6/ sponses specific to, Ag-specific oral, against pneumonic and bubonic p38MAPK/MK2, 2813 CD8 T cells, 1573 plague with Salmonella expressing 2007] SUBJECT INDEX 8287

Y. pestis F1 and V Ags protects Vascular endothelial growth factor Vitamin E, reverses age-associated decline in against, 1059 effects of Cav-1,NO and, on anergy, ECs, CD4 T cell IS formation, 1443 Vaccines 1505 Vitronectin, microglial activation induced by ␣ ␤ ␣ ␤ anti-sTNF protects against arthritis without expression regulated by SAF-1, arthritic fibronectin and, 5 1 and v 5 in- activating latent tuberculosis, 7450 joints, 1774 tegrins mediate MMP-9 expression effect of archaeosomes on expansion and Vasoactive intestinal peptide, effects on cyto- and, EAE, 8158 ␣ ␤ maintenance of memory CD8 T kines and corneal perforation, P. VLA-1. see Integrins, 1 1 ␣ ␤ cells, 2396 aeruginosa-infected cornea, 1105 VLA-2. see Integrins, 2 1 ␣ ␤ IL-15 abrogates vaccine-induced decreases Vav, CEACAM3 association with, promotes VLA-4. see Integrins, 1 4 pathogen phagocytosis, 3797 VSV. see Vesicular stomatitis virus in virus, SIVmac251-infected ma- caques, 3492 Vav1, required by CD28 to enhance TCR L. monocytogenes expressing immune signaling at SLP-76 signalosome, WASP interacting protein, podosome forma- HSV dominant peptide confers im- 1363 tion requires WASP/WIP complex, munity to HSV-1, 4731 Vesicular stomatitis virus, MyD88 in route- macrophages, 2987 mucosal, CTL avidity/compartmentaliza- dependent susceptibility to, 5173 West Nile virus, envelope domain 3 protein, tion protects against CD4 T cell VIP. see Virulence-associated immunomodu- immunization induces specific im- depletion, SHIV infection, 7211 latory protein mune responses, 2699 plasmid DNA vaccine-elicited responses Virulence-associated immunomodulatory pro- Wiskott-Aldrich syndrome protein, podosome tein, GAPDH acts as, S. agalactiae, limit Ag expression via Fas-medi- formation requires WASP/WIP 1379 ated apoptosis, 5652 complex, macrophages, 2987 Viruses synergistic effect of BCG and tuberculosis Wolbachia bacteria, in B. malayi and O. vol- bystander effects associated with, effect on subunit in cationic liposomes, 3721 vulus, innate responses dependent CD8 T cell response, 7267 WNV envelope domain 3 protein induces on TLR2, TLR9, MyD88 and Mal, LGP2 loss manifests in disparate antiviral 1068 specific immune responses, 2699 responses, 6444 Vaccinia virus memory CD8 T cells specific for, Ag not analysis of variables affecting T cell speci- required for maintenance, lung, Yersinia pestis ficity repertoire after infection by, 4721 F1 and V Ags, expressed by Salmonella, 7890 replication, IL-15 abrogates vaccine-in- oral vaccination protects against ␥ IFN- peptide mimetics therapeutic for duced decreases in virus, SIV- pneumonic and bubonic plague, lethal infection by, 4576 1059 mac251-infected macaques, 3492 replication-competent, CD4 T cell re- TLR7, role in Ab-mediated viral RNA YpkA induces apoptosis, 6426 sponse to, 6374 recognition, 3363 YpkA, Y. pestis, induces apoptosis, 6426 T cells specific for, Ag recognition differ- virus-specific memory CD8 T cell re- ent between CD4 and CD8 T cells, sponse elicited by CD4 T cells dis- Zebrafish 6814 playing viral epitopes, 5465 origin of vertebrate IFN system, 4385 Vascular endothelial cell adhesion molecule Visfatin, proinflammatory and immunomodu- TICAM1, evolution of function in verte- activation of PTP1B, 3865 lating properties, 1748 brates, 4517 SDF-1␣ triggers increases in VLA-4 affin- Vitamin D, suppression of M. tuberculosis Zinc, bacteriocidal activity of pepidoglycan ity and stabilizes lymphocyte teth- induced by, cathelicidin LL-37 pep- recognition proteins dependent on, ers on, 3903 tide in, 7190 3116 'DWDEDVH$QDO\VW&XUDWRU IMMUNOLOGY 'HSDUWPHQWRI3DWKRORJ\ OF 7KH'HSDUWPHQWRI3DWKRORJ\DW876RXWKZHVWHUQ0HGLFDO&HQWHU 'DOODV 7; LVVHHNLQJRQHRUPRUHGDWDEDVHDQDO\VWVIRUWKH1,+IXQGHG%LR+HDOWK%DVH %LRLQIRUPDWLFV 5HVRXUFH &HQWHUV IRU %LRGHIHQVH DQG (PHUJLQJ5HHPHUJLQJ ,QIHFWLRXV 'LVHDVHV %5&  SURMHFW VHH KWWSZZZELRKHDOWKEDVHRUJ IRU PRUH LQIRUPDWLRQ 7KHFDQGLGDWHPXVWKDYHDVWURQJZRUNLQJNQRZOHGJHRIELRLQIRU Need to Recruit? PDWLFV UHODWHG WR JHQRPLFV DQGRU SURWHRPLFV GDWD DQG RI SXEOLF GDWDEDVH UHVRXUFHV VXFK DV 1&%, (QWUH]*HQ%DQN  /DERUDWRU\ UHVHDUFK H[SHULHQFH LQ PLFURELRORJ\YLURORJ\LPPXQRORJ\RUUHODWHGGLVFLSOLQHVHVSHFLDOO\UHODWHGWR Recruiting through The Journal of Immunology ,QIOXHQ]DYLUXVRU0\FREDFWHULXPWXEHUFXORVLVLVSUHIHUUHG is the most economical way to reach the 7KLV LQGLYLGXDO ZLOO EH D PHPEHU RI WKH UHVHDUFK WHDP UHVSRQVLEOH IRU WKH OURNAL immunology community without wasting

PDLQWHQDQFHDQGH[WHQVLRQRIWKH%LR+HDOWK%DVH%5&7KHFDQGLGDWHZLOOVSHQG J money. Why pay more to reach geologists and a HIIRUW LQWHUDFWLQJ ZLWK WKH V\VWHP XVHU FRPPXQLW\ LQ RUGHU WR FDSWXUH THE V\VWHPUHTXLUHPHQWVDQGWRDVVHVVGDWDEDVHQHHGVWKHUHIRUHVWURQJLQWHUSHUVRQDO physicists when you are seeking immunologists? DQGFRPPXQLFDWLRQVNLOOVDUHUHTXLUHG7KHRWKHUHIIRUWZLOOEHVSHQWRQWKH IROORZLQJ ‡ ,GHQWLI\LQJSXEOLFVRXUFHVRIUHOHYDQWGDWD A quarter-page advertisement costs $815. ‡ 0DQXDOFXUDWLRQRIWKHVFLHQWLILFOLWHUDWXUH ‡ &RQFHSWXDOGHVLJQRIWKHGDWDEDVHPRGHO ‡ &RQYH\LQJXVHUUHTXLUHPHQWVDQGGHVLJQFRQFHSWVWRDWHDPRIVRIWZDUH HQJLQHHUVLQRUGHUWRIDFLOLWDWHV\VWHPGHYHORSPHQWDFWLYLWLHV For further information, contact: ‡ 6\VWHPWHVWLQJ Steve West ‡ 3HUIRUPLQJFRPSOH[GDWDDQDO\VLVUHODWHGWRFRPSDUDWLYHJHQRPLFV ELRORJLFDOQHWZRUNVWUXFWXUHJHQHH[SUHVVLRQVWXGLHVDQGSK\ORJHQHWLF Professional Media Group (PMG) HYROXWLRQ 856-795-5777 [email protected] 7RDSSO\SOHDVHVHQGDFXUUHQW&9UHVXPHDQGWKUHHUHIHUHQFHOHWWHUVWR 'U5LFKDUG+6FKHXHUPDQQ YLFWRULDKXQW#XWVRXWKZHVWHUQHGX  $OVRSOHDVHDSSO\RQOLQHDWZZZXWVRXWKZHVWHUQHGXFDUHHUV $Q(TXDO2SSRUWXQLW\(PSOR\HU THE AMERICAN ASSOCIATION OF IMMUNOLOGISTS 9650 ROCKVILLE PIKE ● BETHESDA, MD 20814-3994 TEL: (301) 634-7195 ● FAX: (301) 634-7733 FEDERAL TAX ID NO: 52-2317193 E-mail Address: [email protected] ● Website Address: http://www.aai.org

QUALIFICATIONS AND APPLICATION FOR REGULAR MEMBERSHIP 2007 MEMBERSHIP YEAR

The American Association of Immunologists (AAI) is a professional organization whose members have a strong interest in, and have made substantial contributions to, the science of immunology. AAI is a member of the Federation of American Societies for Experimental Biology (FASEB) and is responsible for the publication of The Journal of Immunology. To be eligible for election to membership in the AAI, a candidate must meet one of the following criteria:

1. Possess a Ph.D., (or equivalent graduate degree, e.g., D.Sc.) in immunology or related disciplines, or an M.D. (or equivalent medical degree, e.g., D.D.S.) and be the first author of one significant original publication on an immunological topic in a reputable, English language refereed journal. Manuscripts "in press" are acceptable when accompanied by a letter from the publisher or Editor-In-Chief of the journal affirming its acceptance and imminent publication. Abstracts and unpublished papers will not be considered in evaluating whether a candidate meets the publications requirement for membership. *

2. Be an established scientist with substantial achievement in a related discipline and have at least one collaborative paper on an immunological topic in a reputable, English language refereed journal.

* These requirements may be waived under exceptional circumstances if a candidate shows evidence of other appropriate training and/or substantial research accomplishment.

THIS APPLICATION PACKAGE MUST INCLUDE:

1. A current copy of your curriculum vitae including bibliography. 2. A copy of the title page of a first author publication that meets the criteria. 3. The name and signature of an active AAI member as your reference.

NAME: ______DEGREE (YEAR) & INSTITUTION: ______PUBLICATION: ______CURRENT TITLE/ POSITION: ______ADDRESS: ______STREET: ______CITY: STATE: ZIP CODE: COUNTRY: ______E-MAIL ADDRESS: ______PHONE NO: ______FAX NO: ______RESEARCH SPECIALTY:

REFERENCE:

NAME OF AAI MEMBER (please print clearly): ______SIGNATURE OF AAI MEMBER: ______

Applications should be mailed to the AAI office and marked to the attention of the AAI Membership Department. Please DO NOT send payment with your application. You will be invoiced upon approval.

Application Review Deadlines:

Applications are to be received in the AAI office by the first day of each month.

2007 Dues Rates: January 1 - December 31: U.S. - $260.00 Canadian - $267.50 ( GST incl. ) International - $260.00

8289

THE AMERICAN ASSOCIATION OF IMMUNOLOGISTS

9650 ROCKVILLE PIKE Ɣ BETHESDA, MD 20814-3994 TEL: (301) 634-7195 Ɣ FAX: (301) 634-7733 FEDERAL TAX ID NO: 52-2317193 E-mail Address: [email protected] Ɣ Website Address: http://www.aai.org

2007 TRAINEE MEMBERSHIP APPLICATION FORM

Name: E-mail Address: ______

Address: ______

City: State: Zip Code: ______

Phone Number: Fax Number: ______

Qualified applicants must complete the information below and return this form with the required payment. Trainee members will receive a subscription to The Journal of Immunology and the AAI Newsletter. Trainee members will also have the privilege of attending and participating (without vote) in the AAI Annual Business Meeting. In addition, they will receive all AAI announcements and correspondence. Checks are to be made payable to AAI. All checks must be in U.S. dollars drawn on a U.S. bank and International money orders are accepted.

Individuals may remain Trainee members for a maximum of eight (8) years. Certification must be renewed annually.

SECTION 1 -- APPLICANT INFORMATION

I am a Pre-doctoral Trainee -- I expect to receive the ______(advanced degree) in ______(mo/yr) I am a Post-doctoral Trainee -- I hold the following advanced degree(s) (please indicate all advanced degrees held and the month and year conferred): ______

SECTION 2 -- CERTIFICATION OF APPLICANT'S TRAINEE STATUS (to be completed by current AAI member)

As a current member of the AAI, I hereby certify that the applicant identified above is either a regularly matriculated pre- doctoral student or a post-doctoral trainee and, as such, is eligible to remain a Trainee Member of the AAI.

Current AAI Member's Name (First, MI, Last): ______Signature: ______Title (Dean, Dept. Chair, or Professor in Charge): ______AAI Member Number: Date: ______

SECTION 3 -- APPLICANT PLEDGE AND PAYMENT

I , pledge that any print copies of The Journal of Immunology purchased by me at the special subscription rate to Trainee Members are for my personal use. They will not be placed in a library for general use, sold, or replace a subscription currently purchased by an institution. I also agree that my on-line access to The JI will not be shared with others.

JANUARY 1 - DECEMBER 31, 2007 U.S. Member Canadian Member International Member $64.00 $65.86 (online subscription; GST incl.) $64.00 (online subscription) Please select: Online Print and Online $165.86 (print, online, GST & airmail incl.) $164.00 (print, online & airmail incl.)

CHECK ENCLOSED VISA MASTERCARD AMERICAN EXPRESS

CARD NUMBER:______EXPIRATION DATE:______

SIGNATURE:______

8290