Lineage-Specific Regulation of Imprinted X Inactivation In
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Identification and Characterization of TPRKB Dependency in TP53 Deficient Cancers
Identification and Characterization of TPRKB Dependency in TP53 Deficient Cancers. by Kelly Kennaley A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Molecular and Cellular Pathology) in the University of Michigan 2019 Doctoral Committee: Associate Professor Zaneta Nikolovska-Coleska, Co-Chair Adjunct Associate Professor Scott A. Tomlins, Co-Chair Associate Professor Eric R. Fearon Associate Professor Alexey I. Nesvizhskii Kelly R. Kennaley [email protected] ORCID iD: 0000-0003-2439-9020 © Kelly R. Kennaley 2019 Acknowledgements I have immeasurable gratitude for the unwavering support and guidance I received throughout my dissertation. First and foremost, I would like to thank my thesis advisor and mentor Dr. Scott Tomlins for entrusting me with a challenging, interesting, and impactful project. He taught me how to drive a project forward through set-backs, ask the important questions, and always consider the impact of my work. I’m truly appreciative for his commitment to ensuring that I would get the most from my graduate education. I am also grateful to the many members of the Tomlins lab that made it the supportive, collaborative, and educational environment that it was. I would like to give special thanks to those I’ve worked closely with on this project, particularly Dr. Moloy Goswami for his mentorship, Lei Lucy Wang, Dr. Sumin Han, and undergraduate students Bhavneet Singh, Travis Weiss, and Myles Barlow. I am also grateful for the support of my thesis committee, Dr. Eric Fearon, Dr. Alexey Nesvizhskii, and my co-mentor Dr. Zaneta Nikolovska-Coleska, who have offered guidance and critical evaluation since project inception. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
ATRX Protects Cells Against Replication-Induced Genomic Instability
ATRX Protects Cells Against Replication-Induced Genomic Instability Danton Ivanochko M.Sc. Thesis This thesis is submitted to the Faculty of Graduate and Postdoctoral Studies in partial fulfillment of the requirements for the degree of Master of Science in Biochemistry with a specialization in Human and Molecular Genetics Department of Biochemistry, Microbiology, and Immunology Faculty of Medicine University of Ottawa, Ontario, Ontario, Canada © Danton Ivanochko, Ottawa, Canada, 2016 Dedicated to my parents. ii Abstract Expansive proliferation of neural progenitor cells (NPCs) is a prerequisite to the temporal waves of neuronal differentiation that generate the six-layered cerebral cortex. NPC expansion places a heavy burden on proteins that regulate chromatin packaging and genome integrity, which is further reflected by the growing number of developmental disorders caused by mutations in chromatin regulators. Accordingly, mutations in ATRX, a chromatin remodelling protein required for heterochromatin maintenance at telomeres and simple repeats, cause the ATR-X syndrome. Here, we demonstrate that proliferating ATRX-null cells accumulate DNA damage, while also exhibiting sensitivity to hydroxyurea-induced replication fork stalling. Specifically, PARP1 hyperactivation and replication-dependent double strand DNA breakage indicated replication fork protection defects, while DNA fiber assays confirmed that ATRX was required to protect replication forks from degradation. Interestingly, inhibition of the exonuclease MRE11 by the small molecule mirin could prevent degradation. Thus, ATRX is required to limit replication stress during NPC expansion. iii Acknowledgements First and foremost, I would like to thank my supervisor, Dr. David Picketts, for his guidance and support during my undergraduate and graduate studies. Thanks to the members of my thesis advisory committee, Dr. -
Product Datasheet PBDC1 Antibody NBP1-82657
Product Datasheet PBDC1 Antibody NBP1-82657 Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NBP1-82657 Updated 6/7/2021 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/NBP1-82657 Page 1 of 4 v.20.1 Updated 6/7/2021 NBP1-82657 PBDC1 Antibody Product Information Unit Size 0.1 ml Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Clonality Polyclonal Preservative 0.02% Sodium Azide Isotype IgG Purity Immunogen affinity purified Buffer PBS (pH 7.2) and 40% Glycerol Product Description Host Rabbit Gene ID 51260 Gene Symbol PBDC1 Species Human Reactivity Notes Immunogen displays the following percentage of sequence identity for non- tested species: Mouse (83%), Rat (85%) Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EVYYKLISSVDPQFLKLTKVDDQIYSEFRKNFETLRIDVLDPEELKSESAKEKWR PFCLKFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNKAV YISVQDKEGEKGVNNGGEKRADSGEEENTKNGGEK Product Application Details Applications Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Western Blot 0.04 - 0.4 ug/ml, -
MMP-25 Metalloprotease Regulates Innate Immune Response Through NF- Κb Signaling Clara Soria-Valles, Ana Gutiérrez-Fernández, Fernando G
MMP-25 Metalloprotease Regulates Innate Immune Response through NF- κB Signaling Clara Soria-Valles, Ana Gutiérrez-Fernández, Fernando G. Osorio, Dido Carrero, Adolfo A. Ferrando, Enrique Colado, This information is current as M. Soledad Fernández-García, Elena Bonzon-Kulichenko, of September 27, 2021. Jesús Vázquez, Antonio Fueyo and Carlos López-Otín J Immunol 2016; 197:296-302; Prepublished online 3 June 2016; doi: 10.4049/jimmunol.1600094 Downloaded from http://www.jimmunol.org/content/197/1/296 Supplementary http://www.jimmunol.org/content/suppl/2016/06/01/jimmunol.160009 Material 4.DCSupplemental http://www.jimmunol.org/ References This article cites 41 articles, 15 of which you can access for free at: http://www.jimmunol.org/content/197/1/296.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 27, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology MMP-25 Metalloprotease Regulates Innate Immune Response through NF-kB Signaling Clara Soria-Valles,* Ana Gutie´rrez-Ferna´ndez,* Fernando G. -
Patient Mutations Alter ATRX Targeting to PML Nuclear Bodies
European Journal of Human Genetics (2008) 16, 192–201 & 2008 Nature Publishing Group All rights reserved 1018-4813/08 $30.00 www.nature.com/ejhg ARTICLE Patient mutations alter ATRX targeting to PML nuclear bodies Nathalie G Be´rube´1,3,4, Jasmine Healy1,4, Chantal F Medina1, Shaobo Wu1, Todd Hodgson1, Magdalena Jagla1 and David J Picketts*,2 1Molecular Medicine Program, Ottawa Health Research Institute, Ottawa, Ontario, Canada; 2Departments of Medicine and Biochemistry, Microbiology, and Immunology, University of Ottawa, Ottawa, Ontario, Canada ATRX is a SWI/SNF-like chromatin remodeling protein mutated in several X-linked mental retardation syndromes. Gene inactivation studies in mice demonstrate that ATRX is an essential protein and suggest that patient mutations likely retain partial activity. ATRX associates with the nuclear matrix, pericentromeric heterochromatin, and promyelocytic leukemia nuclear bodies (PML-NBs) in a speckled nuclear staining pattern. Here, we used GFP–ATRX fusion proteins to identify the specific domains of ATRX necessary for subnuclear targeting and the effect of patient mutations on this localization. We identified two functional nuclear localization signals (NLSs) and two domains that target ATRX to nuclear speckles. One of the latter domains is responsible for targeting ATRX to PML-NBs. Surprisingly, this domain encompassed motifs IV–VI of the SNF2 domain suggesting that in addition to chromatin remodeling, it may also have a role in subnuclear targeting. More importantly, four different patient mutations within this domain resulted in an B80% reduction in the number of transfected cells with ATRX nuclear speckles and PML colocalization. These results demonstrate that patient mutations have a dramatic effect on subnuclear targeting to PML-NBs. -
X-Linked Diseases: Susceptible Females
REVIEW ARTICLE X-linked diseases: susceptible females Barbara R. Migeon, MD 1 The role of X-inactivation is often ignored as a prime cause of sex data include reasons why women are often protected from the differences in disease. Yet, the way males and females express their deleterious variants carried on their X chromosome, and the factors X-linked genes has a major role in the dissimilar phenotypes that that render women susceptible in some instances. underlie many rare and common disorders, such as intellectual deficiency, epilepsy, congenital abnormalities, and diseases of the Genetics in Medicine (2020) 22:1156–1174; https://doi.org/10.1038/s41436- heart, blood, skin, muscle, and bones. Summarized here are many 020-0779-4 examples of the different presentations in males and females. Other INTRODUCTION SEX DIFFERENCES ARE DUE TO X-INACTIVATION Sex differences in human disease are usually attributed to The sex differences in the effect of X-linked pathologic variants sex specific life experiences, and sex hormones that is due to our method of X chromosome dosage compensation, influence the function of susceptible genes throughout the called X-inactivation;9 humans and most placental mammals – genome.1 5 Such factors do account for some dissimilarities. compensate for the sex difference in number of X chromosomes However, a major cause of sex-determined expression of (that is, XX females versus XY males) by transcribing only one disease has to do with differences in how males and females of the two female X chromosomes. X-inactivation silences all X transcribe their gene-rich human X chromosomes, which is chromosomes but one; therefore, both males and females have a often underappreciated as a cause of sex differences in single active X.10,11 disease.6 Males are the usual ones affected by X-linked For 46 XY males, that X is the only one they have; it always pathogenic variants.6 Females are biologically superior; a comes from their mother, as fathers contribute their Y female usually has no disease, or much less severe disease chromosome. -
Structure of the SWI2/SNF2 Chromatin-Remodeling Domain of Eukaryotic Rad54
ARTICLES Structure of the SWI2/SNF2 chromatin-remodeling domain of eukaryotic Rad54 Nicolas H Thomä1, Bryan K Czyzewski1,2, Andrei A Alexeev3, Alexander V Mazin4, Stephen C Kowalczykowski3 & Nikola P Pavletich1,2 SWI2/SNF2 chromatin-remodeling proteins mediate the mobilization of nucleosomes and other DNA-associated proteins. SWI2/SNF2 proteins contain sequence motifs characteristic of SF2 helicases but do not have helicase activity. Instead, they couple ATP hydrolysis with the generation of superhelical torsion in DNA. The structure of the nucleosome-remodeling domain of zebrafish Rad54, a protein http://www.nature.com/nsmb involved in Rad51-mediated homologous recombination, reveals that the core of the SWI2/SNF2 enzymes consist of two ␣/-lobes similar to SF2 helicases. The Rad54 helicase lobes contain insertions that form two helical domains, one within each lobe. These insertions contain SWI2/SNF2-specific sequence motifs likely to be central to SWI2/SNF2 function. A broad cleft formed by the two lobes and flanked by the helical insertions contains residues conserved in SWI2/SNF2 proteins and motifs implicated in DNA-binding by SF2 helicases. The Rad54 structure suggests that SWI2/SNF2 proteins use a mechanism analogous to helicases to translocate on dsDNA. Cellular processes such as transcription, replication, DNA repair and breaks by Rad51-mediated homologous recombination15–20. Like other recombination require direct access to DNA. This process is facilitated SWI2/SNF2 remodeling enzymes, Rad54 can translocate on DNA, gen- by the SWI2/SNF2 family of ATPases, which detach DNA from histones erate superhelical torsion and enhance the accessibility to nucleosomal and other bound proteins1,2. The SWI2/SNF2 chromatin remodeling DNA18,19,21. -
Product Datasheet Cxorf26 Recombinant Protein Antigen NBP1
Product Datasheet CXorf26 Recombinant Protein Antigen NBP1-82657PEP Unit Size: 0.1 ml Store at -20C. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NBP1-82657PEP Updated 11/3/2016 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/NBP1-82657PEP Page 1 of 2 v.20.1 Updated 11/3/2016 NBP1-82657PEP CXorf26 Recombinant Protein Antigen Product Information Unit Size 0.1 ml Concentration Please see the vial label for concentration. If unlisted please contact technical services. Storage Store at -20C. Avoid freeze-thaw cycles. Preservative No Preservative Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Target Molecular Weight 34 kDa Product Description Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PBDC1. Source: E.coli Amino Acid Sequence: EVYYKLISSVDPQFLKLTKVDDQIYSEFRKNFETLRIDVLDPEELKSESAKEKWR PFCLKFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNKAV YISVQDKEGEKGVNNGGEKRADSGEEENTKNGGEK Gene ID 51260 Gene Symbol PBDC1 Species Human Product Application Details Applications Antibody Competition Recommended Dilutions Antibody Competition 10 - 100 molar excess Application Notes This peptide is useful as a blocking peptide for NBP1-82657.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated -
ATRX-Mutant Cancers to WEE1 Inhibition Junbo Liang1, Hong Zhao2,3, Bill H
Published OnlineFirst September 24, 2019; DOI: 10.1158/0008-5472.CAN-18-3374 CANCER RESEARCH | TRANSLATIONAL SCIENCE Genome-Wide CRISPR-Cas9 Screen Reveals Selective Vulnerability of ATRX-Mutant Cancers to WEE1 Inhibition Junbo Liang1, Hong Zhao2,3, Bill H. Diplas4, Song Liu5, Jianmei Liu2,3, Dingding Wang1, Yan Lu1, Qing Zhu6, Jiayu Wu1, Wenjia Wang1, Hai Yan4, Yi-Xin Zeng6, Xiaoyue Wang1, and Yuchen Jiao2,7 ABSTRACT ◥ The tumor suppressor gene ATRX is frequently mutated in a induced apoptosis. AZD1775 also selectively inhibited the prolif- variety of tumors including gliomas and liver cancers, which are eration of patient-derived primary cell lines from gliomas with highly unresponsive to current therapies. Here, we performed a naturally occurring ATRX mutations, indicating that the synthetic genome-wide synthetic lethal screen, using CRISPR-Cas9 genome lethal relationship between WEE1 and ATRX could be exploited in a editing, to identify potential therapeutic targets specific for ATRX- broader spectrum of human tumors. As WEE1 inhibitors have been mutated cancers. In isogenic hepatocellular carcinoma (HCC) cell investigated in several phase II clinical trials, our discovery provides lines engineered for ATRX loss, we identified 58 genes, including the the basis for an easily clinically testable therapeutic strategy specific checkpoint kinase WEE1, uniquely required for the cell growth of for cancers deficient in ATRX. ATRX null cells. Treatment with the WEE1 inhibitor AZD1775 robustly inhibited the growth of several ATRX-deficient HCC cell Significance: ATRX-mutant cancer cells depend on WEE1, lines in vitro, as well as xenografts in vivo. The increased sensitivity which provides a basis for therapeutically targeting WEE1 in to the WEE1 inhibitor was caused by accumulated DNA damage– ATRX-deficient cancers. -
ATRX and RECQ5 Define Distinct Homologous Recombination Subpathways
ATRX and RECQ5 define distinct homologous recombination subpathways Amira Elbakrya, Szilvia Juhásza,1, Ki Choi Chana, and Markus Löbricha,2 aRadiation Biology and DNA Repair, Technical University of Darmstadt, 64287 Darmstadt, Germany Edited by Stephen C. West, The Francis Crick Institute, London, United Kingdom, and approved December 10, 2020 (received for review May 25, 2020) Homologous recombination (HR) is an important DNA double- or by the resolvase GEN1 which induce asymmetrical or sym- strand break (DSB) repair pathway that copies sequence informa- metrical incisions in the two strands at each HJ, giving rise to tion lost at the break site from an undamaged homologous tem- both crossover (CO) and non-CO products (6–8). Additionally, plate. This involves the formation of a recombination structure dHJs can be dissolved by the BLM/TOPOIIIα/RMI1/2 (BTR) that is processed to restore the original sequence but also harbors complex, where the two HJs migrate toward each other and the potential for crossover (CO) formation between the participat- merge to form a hemicatenane that is then decatenated by top- ing molecules. Synthesis-dependent strand annealing (SDSA) is an oisomerases, thus separating the two molecules without ex- HR subpathway that prevents CO formation and is thought to change of genetic material (9–11). Under specific circumstances, predominate in mammalian cells. The chromatin remodeler ATRX a third subpathway termed break-induced replication (BIR) can promotes an alternative HR subpathway that has the potential to mediate conservative DNA synthesis initiated by the D-loop to form COs. Here, we show that ATRX-dependent HR outcompetes copy the entire chromosome arm (12, 13). -
The Chromatin Remodeller ATRX: a Repeat Offender in Human Disease
Review The chromatin remodeller ATRX: a repeat offender in human disease David Clynes, Douglas R. Higgs, and Richard J. Gibbons MRC Molecular Haematology Unit, Weatherall Institute of Molecular Medicine, University of Oxford, John Radcliffe Hospital, Oxford OX3 9DS, UK The regulation of chromatin structure is of paramount collaboration with its interaction partner death-associated importance for a variety of fundamental nuclear process- protein 6 (DAXX), functions as a histone chaperone complex es, including gene expression, DNA repair, replication, for the deposition of the histone variant H3.3 into peri- and recombination. The ATP-dependent chromatin- centric, telomeric, and ribosomal repeat sequences [7–10]. remodelling factor ATRX (a thalassaemia/mental retar- ATR-X syndrome is characterised by a variety of clini- dation X-linked) has emerged as a key player in each of cal features that include mental retardation, facial, skel- these processes. Exciting recent developments suggest etal, and urogenital abnormalities, as well as mild a- that ATRX plays a variety of key roles at tandem repeat thalassaemia (a blood disorder characterised by an im- sequences within the genome, including the deposition balance of globin chain synthesis and anaemia) [11,12]. of a histone variant, prevention of replication fork stal- The latter is attributable to reduced expression of the a ling, and the suppression of a homologous recombina- globin genes located on chromosome 16. ATRX was hence tion-based pathway of telomere maintenance. Here, we considered to be an X-chromosome-encoded trans-acting provide a mechanistic overview of the role of ATRX in factor that facilitates the expression of a select repertoire each of these processes, and propose how they may be of disparate genes.