DOCSLIB.ORG

Effects of Antimicrobial Agents on the Survival And

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Effects of Antimicrobial Agents on the Survival And TurkJZool 26(2002)111-119 ©TÜB‹TAK ResearchArticle EffectsofAntimicrobialAgentsontheSurvivalandDevelopmentof LarvaeofPimplaturionellae L.(Hymenoptera:Ichneumonidae) RearedonanArtificialDiet KemalBÜYÜKGÜZEL DepartmentofBiology,FacultyofScience-Art,KaraelmasUniversity,67100,‹ncivez,Zonguldak-TURKEY fievkiYAZGAN DepartmentofBiology,FacultyofSciences,AnkaraUniversity,06100,Beflevler,Ankara-TURKEY Received:28.06.2000 Abstract: Theeffectsof13antimicrobialagentsthathavedifferentstructuresandmodesofaction,onthesurvivalanddevelop- mentofthehymenopterousendoparasitoid, Pimplaturionellae L.,wereinvestigatedbyrearingthelarvaeasepticallyonchemically definedsyntheticdiets.Theseeffectsvariedaccordingtotheirkindanddietarylevels.Theagentstestedexertedtheireffec tsgen- erallyduringthepost-larvaldevelopmentoftheinsect.Thepost-larvalsurvivalanddevelopmentwerenegativelyaffectedbym ost oftheagentstestedatcertainlevels.Theantimicrobialagentstestedalsoaffectedthelarvaldevelopmentbuthadnosignifi cant effectsonthelarvalsurvivaloftheinsect.Thelarvaeshowedawidetoleranceagainstboththekindanddietarylevelsoftheagents. Noneoftheagentstestedweretoxictothelarvae.Sodiumbenzoateandnystatinatlowlevelshadpositiveeffectsonthefoodcon- sumptionofthelarvae. KeyWords: Pimplaturionellae,Antimicrobialagents,Insect,Endoparasitoid Baz›AntimikrobiyalAjanlar›nSentetikBesindeYetifltirilen Pimplaturionellae L. (Hymenoptera:Ichneumonidae)Larvalar›n›nYaflamaveGeliflmesineEtkileri Özet: Endoparazitoidzarkanatl›türü, Pimplaturionellae L.,kimyasalyap›s›bilinensentetikbesinortamlar›ndaaseptikflartlarda beslenerek,farkl›yap›veetkiyesahiponüçantimikrobiyalajan›nböce¤inyaflamavegeliflmesineetkileriincelendi.Buetkiler dene- nenantimikrobiyalajan›nçeflidinevemiktar›nagörede¤iflmektedir.Denenenajanlar›netkileriço¤unluklalarvasonras›evreler de ortayaç›km›flolupbuevrelerdekiyaflamavegeliflmeolumsuzyöndeetkilenmifltir.Antimikrobiyalajanlarayn›zamandalarvalevr e- dekigeliflmeyideetkilemiflancakbuevredekiyaflamaüzerindeönemlibiretkiyapmam›flt›r.Larvalarantimikrobiyalajanlar›nhe m çeflidinehemdebesinselmiktar›nakarfl›geniflbirtoleransgöstermifltir.Denenenajanlar›nhiçbirilarvalarüzerindetoksiket kiyap- mam›flt›r.Sodyumbenzoatvenistatinindüflükmiktarlar›larvalar›nbesintüketimineolumluetkidebulunmufltur. AnahtarSözcükler: Pimplaturionellae,Antimikrobiyalajanlar,Böcek,Endoparazitoid Introduction eggtoadultinstarinlaboratoryconditions(1-9). Becauseoftheirpredatorynature,parasitic Chemicallydefineddietsthathavebeendevelopedtorear hymenopterousspeciescanbeusedaspotentialtoolsin parasiticinsectsarehighlysuitableforthedevelopment biologicalcontrolprograms.Manyattemptshavebeen ofmicroorganisms.Variousantimicrobialagentswere madetousetheseinsectsintheseprograms.Oneofthese usedininsectdietstopreventmicrobialcontamination wastocultivatetheseinsectspermanentlyinalaboratory. andpropagation(2,10-16),butaverylimitedamountof Todoso,somechemicallydefinedsyntheticdietsand workhasbeendoneontheeffectsoftheseagentson rearingtechniquesweredevelopedforsomespecies.By parasitichymenopterousspecies(17-20).Some usingthesedietsandtechniques,someparasitic hymenopterousinsects,especiallysocialones,produce hymenopterousspeciesweresuccessfullyrearedfrom somenaturalsubstanceswhichfunctionasantimicrobial 111 EffectsofAntimicrobialAgentsontheSurvivalandDevelopmentofLarvaeof Pimplaturionellae L.(Hymenoptera:Ichneumonidae) RearedonanArtificialDiet agents(21-25).Forexample,hymenopterousparasitoid ofanaminoacidmixture,lipidmixture,aninorganicsalt P.turionellae larvaedischargesuchasubstanceintotheir mixture,glucose,RNAandamixtureofwater-soluble host.Thisactsasanantimicrobialagentduringthelarval vitamins.Themethodsusedinthepreparationofstock developmentoftheinsect(26).Someantimicrobial solutionsofdietaryingredients,thedietfromthese agentscanpermanentlyortemporarilychangethemode stocks,thesterilizationtechniques,theaddingof ofreproductionofthethelytokyformofsomeparasitic sterilizedvitamin-glucoseandantimicrobialagents hymenopterousinsectstothearrhenotoky,whichisa solutiontothediet,thedispensingofthedietsintotest- normalsystemofreproductioninthehymenoptera(27- tubes,theobtainingofthesterilizedlarvaeandtheir 32).Theseindicatetheimportanceofantimicrobial inoculationontodiets,andthepreparationofgelatine agentsinthedevelopmentofhymenopterousinsects. capsulesforpupationweremostlythesameasthose Thisworkisimportantinunderstandingthenutritional describedelsewhere(20). suitabilityoftheantimicrobialagentsasadietaryadditive Someoftheantimicrobialagentsusedinthiswork substanceintheartificialrearingoftheseinsects.Such suchastetracyclinehydrochloride(968µg/mg), workmightalsobeofgreatpracticalimportanceinthe chloramphenicol(980µg/mg),erythromycin(Freebase, controlofbacterialandfungalcontaminations,whichare averyseriousprobleminartificialdietsforthemass- 820µg/mg),trimethoprim(99%),cycloheximide(98%) rearingof P.turionellae andotherpupalendoparasitoid andsodiumbenzoate(99%)wereobtainedfromSigma hymenopterousinsects.Contaminationisoftenamajor ChemicalCo.Theotherswereobtainedfromdifferent factormakingtheirrearingunsatisfactoryandsometimes firmssuchaspenicillinG(potassiumsalt,1600units)and impossible.Thisproblemintheartificialrearingsystem streptomycinsulphatefromClaus&HuthLtd.,methylp- ofourinsectmostlycausestimeconsumptionand hydroxybenzoate(pure,crystalline)fromKoch-Light extravagancyofnutrientchemicals.However, Pimpla Lab.,rifampicin(-SV,95%)fromKoçakMedicineCo., larvaeovercometheproblembydischargingananal lyncomycinhydrochloride(877µg/mg)fromEczac›bafl› secretionwhichhasantibioticfunctionduringtheir MedicineCo.,andcephradinemonohydrate(942µg/mg) developmentintheirhoststoprotectthemselves(26).To andnystatin(5300units/mg)fromBristol-MyersSquibb rearhealthyadultsforbiologicalcontrol,itisnecessaryto Inc.Mostoftheantimicrobialagentstestedinthiswork controlmicrobialcontaminations.Someworkhasbeen wereselectedfromcommonlyusedonesinthelarval doneonantifungalagentsinartificialdietsbutverylittle dietsforartificialrearingofsomeentomophagousinsects dealswithantibioticsorevenwithpupalendoparasitoids (12,17-20,33,34).Inadditiontotheseagents, Theworkwhichhasbeendonedealswiththe trimethoprim,lincomycinandcephradine,whichhavenot individualeffectsofsomeantifungalagentsand beenpreviouslyusedinanyartificialrearingdiet,were antibioticsonthesurvivalanddevelopmentofthelarvae alsotested.Thus,itwasplannedtotestoneortwo ofapupalendoparasitoidhymenopterousinsect, Pimpla agentsfromeachgroupofantimicrobialagentswith turionellae,whichisapotentialbiologicalcontrolagentof differentstructuresandmodesofaction.Ourprevious manylepidopterouspestinsects.Therefore,wetriedto workshowedthatsomeantimicrobialagentstestedsuch determinethelevelsoftheseantimicrobialagentswhich aspenicillinandstreptomycinexertedtheirmaineffects haveminimalornodetrimentaleffectsontheinsect. atalevelof50mgof100mlofdiet,whereasrifampicin atthislevelwashighlyeffectiveonthepost-larvalsurvival anddevelopmentofP.turionellae (20).Therefore,inthe MaterialsandMethods presentwork,thetestedlevelsoftheantimicrobial P.turionellae adultsusedintheexperimentswere agentswereconsideredtocenterbeloworaroundalevel rearedinthelaboratoryonthepupaeofthegreaterwax of50mgof100mlofdiet.Somepreliminary moth,Galleriamellonella L.,at23±1ºC,75±5%r.h.and experimentswereconductedtodeterminetherangeof witha16hilluminationperiod.Adultswerefeddaily the13agents.Basedontheresultsoftheseexperiments, with50%honeysolutionand G.mellonellae pupae penicillinandstreptomycinatlevelsof10,20,30and40 hemolymph. mg;rifampicin,methylp-hydroxybenzoateandsodium ThesyntheticdietdescribedbyYazgan(3)wasused benzoateatlevelsof2.5,5.0,7.5,10.0mg; forrearingthelarvaeofP.turionellae.Thedietconsisted cycloheximideatlevelsof0.002,0.004,0.006,0.008 112 K.BÜYÜKGÜZEL,fi.YAZGAN mg;andtherestoftheantimicrobialagentsatlevelsof reachfifth,pupalandadultinstars)andsurvival(number 15,30,45,60mg/100mlofdietweretested.Thus, ofsurvivorsintheseinstars)ofthelarvae.Dataonthe fourlevelsofeachagentweretestedandcomparedwith rateofdevelopmentwereevaluatedbyanalysisofthe acontrol(withoutantimicrobialagents).Onlybidistilled variance(35).Todeterminesignificantdifferences waterwasusedasthediluentforalltheantimicrobial betweenmeans,Duncan’s(36)multiplerangetestwas agents.Weobtainedaquitestablesuspensionby used.DataonsurvivalwerecomparedbyX 2 test(35). vigorouslyshakingthemixtureinthepreparationof WhenFandX2 exceededtheir0.01value,thedifferences solutionsoflowsolubleagentsinwatersuchasnystatin, wereconsideredsignificant. rifampicinandmethyl p-hydroxybenzoate.Nospecial solventsorprotectivesubstanceswereusedfordilution ofsuchagentstoavoidpossiblechangesinthechemical Results andphysicalcompositionofthedietsandthustoprevent Theeffectsofthemosteffectiveantimicrobialagents theirpossiblecontributiontotheeffectsofantimicrobial onthesurvivalanddevelopmentof P.turionellae larvae agentsontheinsect. areshownintheTable. Theagentstestedwereexpressedasmg/100mlof Thelowestlevelofrifampicinhadnosignificanteffect diet.Theirdesiredamountsweredissolvedinbidistilled oneithersurvivalordevelopment,but5mgand10mg water,thensterilizedthrough0.22µmpore-sized ofitsignificantlydecreasedthepostlarvalsurvival.The membranefilterandaddedtothedietbeforegel adultdevelopmentoftheinsectwasalsosignificantly formation.Thevolumeofthedietwasestablishedby retardedbythedietwhichcontainedonly5mgof adjustingtheamountofwaterinthediet.Onenewly rifampicin.Thehighestlevelofthisantibioticalso hatchedlarvawasinoculatedintoeachtest-tube retardedthelarvaldevelopmentbyapproximatelyfour containingabout0.5mlofdietwithincreasinglevelsof days.Chloramphenicol,atalltestedlevels,didnotaffect
Load more

Recommended publications
  • Identification Key to the Subfamilies of Ichneumonidae (Hymenoptera)
    Identification key to the subfamilies of Ichneumonidae (Hymenoptera) Gavin Broad Dept. of Entomology, The Natural History Museum, Cromwell Road, London SW7 5BD, UK Notes on the key, February 2011 This key to ichneumonid subfamilies should be regarded as a test version and feedback will be much appreciated (emails to [email protected]). Many of the illustrations are provisional and more characters need to be illustrated, which is a work in progress. Many of the scanning electron micrographs were taken by Sondra Ward for Ian Gauld’s series of volumes on the Ichneumonidae of Costa Rica. Many of the line drawings are by Mike Fitton. I am grateful to Pelle Magnusson for the photographs of Brachycyrtus ornatus and for his suggestion as to where to include this subfamily in the key. Other illustrations are my own work. Morphological terminology mostly follows Fitton et al. (1988). A comprehensively illustrated list of morphological terms employed here is in development. In lateral views, the anterior (head) end of the wasp is to the left and in dorsal or ventral images, the anterior (head) end is uppermost. There are a few exceptions (indicated in figure legends) and these will rectified soon. Identifying ichneumonids Identifying ichneumonids can be a daunting process, with about 2,400 species in Britain and Ireland. These are currently classified into 32 subfamilies (there are a few more extralimitally). Rather few of these subfamilies are reconisable on the basis of simple morphological character states, rather, they tend to be reconisable on combinations of characters that occur convergently and in different permutations across various groups of ichneumonids.
    [Show full text]
  • Limited Variability of Genitalia in the Genus Pimpla (Hymenoptera: Ichneumonidae): Inter- Or Intraspecific Causes?
    LIMITED VARIABILITY OF GENITALIA IN THE GENUS PIMPLA (HYMENOPTERA: ICHNEUMONIDAE): INTER- OR INTRASPECIFIC CAUSES? by TIIT TEDER (Institute of Zoologyand Botany, Estonian Agricultural University,Riia 181, EE2400 Tartu, Estonia; Institute of Zoology and Hydrobiology,Tartu University,EE2400 Tartu, Estonia) ABSTRACT We studied the morphometric variability of genitalia in five species of the genus Pimpla (Hymenoptera,Ichneumonidae). This genus is characterizedby a high intraspecificvariation in body size, a simple structure of the genitalia and many closely related species. We found that genitalic characters of all studied species vary less than characters related to body size. However,there exists an overlap in genitalic charactersbetween different species. The pattern of variance and the ecology of the species studied suggests that low variance of genitalia cannot be explained by interspecificcauses (mechanicalisolation) or sperm competition.The most likely explanation for the low variance of genitalia is assuring mechanical fit between male and female during copulation. Sexual selection by female choice may be a cause of the observed pattern of variance as well, if females have active preference for males with larger genitalia. We suggest that genitalia of insects with a large variation in body size vary less than other morphologicalcharacters to ensure intraspecificmechanical fit. KEYWORDS: genitalia, body size, morphometry,Ichneumonidae, Pimpla. INTRODUCTION In various taxonomic groups of insects, both male and female genitalia are often highly species-specific in their morphology. This phenomenon, widely used in taxonomy, has been explained by proposing different inter- and intraspecific selective factors. The first class of explanations is represented by the mechanical lock and key hypothesis, proposed already in the previous century (see SHAPIRO & PORTER, 1989, for review).
    [Show full text]
  • Ichneumonid Wasps (Hymenoptera, Ichneumonidae) in the to Scale Caterpillar (Lepidoptera) [1]
    Central JSM Anatomy & Physiology Bringing Excellence in Open Access Research Article *Corresponding author Bui Tuan Viet, Institute of Ecology an Biological Resources, Vietnam Acedemy of Science and Ichneumonid Wasps Technology, 18 Hoang Quoc Viet, Cau Giay, Hanoi, Vietnam, Email: (Hymenoptera, Ichneumonidae) Submitted: 11 November 2016 Accepted: 21 February 2017 Published: 23 February 2017 Parasitizee a Pupae of the Rice Copyright © 2017 Viet Insect Pests (Lepidoptera) in OPEN ACCESS Keywords the Hanoi Area • Hymenoptera • Ichneumonidae Bui Tuan Viet* • Lepidoptera Vietnam Academy of Science and Technology, Vietnam Abstract During the years 1980-1989,The surveys of pupa of the rice insect pests (Lepidoptera) in the rice field crops from the Hanoi area identified showed that 12 species of the rice insect pests, which were separated into three different groups: I- Group (Stem bore) including Scirpophaga incertulas, Chilo suppressalis, Sesamia inferens; II-Group (Leaf-folder) including Parnara guttata, Parnara mathias, Cnaphalocrocis medinalis, Brachmia sp, Naranga aenescens; III-Group (Bite ears) including Mythimna separata, Mythimna loryei, Mythimna venalba, Spodoptera litura . From these organisms, which 15 of parasitoid species were found, those species belonging to 5 families in of the order Hymenoptera (Ichneumonidae, Chalcididae, Eulophidae, Elasmidae, Pteromalidae). Nine of these, in which there were 9 of were ichneumonid wasp species: Xanthopimpla flavolineata, Goryphus basilaris, Xanthopimpla punctata, Itoplectis naranyae, Coccygomimus nipponicus, Coccygomimus aethiops, Phaeogenes sp., Atanyjoppa akonis, Triptognatus sp. We discuss the general biology, habitat preferences, and host association of the knowledge of three of these parasitoids, (Xanthopimpla flavolineata, Phaeogenes sp., and Goryphus basilaris). Including general biology, habitat preferences and host association were indicated and discussed.
    [Show full text]
  • Biodiversity Profile of Afghanistan
    NEPA Biodiversity Profile of Afghanistan An Output of the National Capacity Needs Self-Assessment for Global Environment Management (NCSA) for Afghanistan June 2008 United Nations Environment Programme Post-Conflict and Disaster Management Branch First published in Kabul in 2008 by the United Nations Environment Programme. Copyright © 2008, United Nations Environment Programme. This publication may be reproduced in whole or in part and in any form for educational or non-profit purposes without special permission from the copyright holder, provided acknowledgement of the source is made. UNEP would appreciate receiving a copy of any publication that uses this publication as a source. No use of this publication may be made for resale or for any other commercial purpose whatsoever without prior permission in writing from the United Nations Environment Programme. United Nations Environment Programme Darulaman Kabul, Afghanistan Tel: +93 (0)799 382 571 E-mail: [email protected] Web: http://www.unep.org DISCLAIMER The contents of this volume do not necessarily reflect the views of UNEP, or contributory organizations. The designations employed and the presentations do not imply the expressions of any opinion whatsoever on the part of UNEP or contributory organizations concerning the legal status of any country, territory, city or area or its authority, or concerning the delimitation of its frontiers or boundaries. Unless otherwise credited, all the photos in this publication have been taken by the UNEP staff. Design and Layout: Rachel Dolores
    [Show full text]
  • Surveying for Terrestrial Arthropods (Insects and Relatives) Occurring Within the Kahului Airport Environs, Maui, Hawai‘I: Synthesis Report
    Surveying for Terrestrial Arthropods (Insects and Relatives) Occurring within the Kahului Airport Environs, Maui, Hawai‘i: Synthesis Report Prepared by Francis G. Howarth, David J. Preston, and Richard Pyle Honolulu, Hawaii January 2012 Surveying for Terrestrial Arthropods (Insects and Relatives) Occurring within the Kahului Airport Environs, Maui, Hawai‘i: Synthesis Report Francis G. Howarth, David J. Preston, and Richard Pyle Hawaii Biological Survey Bishop Museum Honolulu, Hawai‘i 96817 USA Prepared for EKNA Services Inc. 615 Pi‘ikoi Street, Suite 300 Honolulu, Hawai‘i 96814 and State of Hawaii, Department of Transportation, Airports Division Bishop Museum Technical Report 58 Honolulu, Hawaii January 2012 Bishop Museum Press 1525 Bernice Street Honolulu, Hawai‘i Copyright 2012 Bishop Museum All Rights Reserved Printed in the United States of America ISSN 1085-455X Contribution No. 2012 001 to the Hawaii Biological Survey COVER Adult male Hawaiian long-horned wood-borer, Plagithmysus kahului, on its host plant Chenopodium oahuense. This species is endemic to lowland Maui and was discovered during the arthropod surveys. Photograph by Forest and Kim Starr, Makawao, Maui. Used with permission. Hawaii Biological Report on Monitoring Arthropods within Kahului Airport Environs, Synthesis TABLE OF CONTENTS Table of Contents …………….......................................................……………...........……………..…..….i. Executive Summary …….....................................................…………………...........……………..…..….1 Introduction ..................................................................………………………...........……………..…..….4
    [Show full text]
  • The Phylogeny and Evolutionary Biology of the Pimplinae (Hymenoptera : Ichneumonidae)
    THE PHYLOGENY AND EVOLUTIONARY BIOLOGY OF THE PIMPLINAE (HYMENOPTERA : ICHNEUMONIDAE) Paul Eggleton A thesis submitted for the degree of Doctor of Philosophy of the University of London Department of Entomology Department of Pure & Applied B ritish Museum (Natural H istory) Biology, Imperial College London London May 1989 ABSTRACT £ The phylogeny and evolutionary biology of the Pimplinae are investigated using a cladistic compatibility method. Cladistic methodology is reviewed in the introduction, and the advantages of using a compatibility method explained. Unweighted and weighted compatibility techniques are outlined. The presently accepted classification of the Pimplinae is investigated by reference to the diagnostic characters used by earlier workers. The Pimplinae do not form a natural grouping using this character set. An additional 22 new characters are added to the data set for a further analysis. The results show that the Pimplinae (sensu lato) form four separate and unconnected lineages. It is recommended that the lineages each be given subfamily status. Other taxonomic changes at tribal level are suggested. The host and host microhabitat relations of the Pimplinae (sensu s tr ic to ) are placed within the evolutionary framework of the analyses of morphological characters. The importance of a primitive association with hosts in decaying wood is stressed, and the various evolutionary pathways away from this microhabitat discussed. The biology of the Rhyssinae is reviewed, especially with respect to mating behaviour and male reproductive strategies. The Rhyssinae (78 species) are analysed cladistically using 62 characters, but excluding characters thought to be connected with mating behaviour. Morphometric studies show that certain male gastral characters are associated with particular mating systems.
    [Show full text]
  • Pimpla Processioneae and P. Rufipes: Specialist Versus Generalist (Hymeno- Ptera: Ichneumonidae, Pimplinae)
    Pimpla processioneae and P. rufipes: specialist versus generalist (Hymeno- ptera: Ichneumonidae, Pimplinae) C.J. Zwakhals The differences between Pimpla processioneae and P. rufipes are discussed, based on reared and Dr. Dreeslaan 204 collected specimens in The Netherlands. It is ar- 4241 CM Arkel [email protected] gued that P. processioneae is a distinct species and a specialist pupal parasitoid of Thaumeto- poea proc e s s i o n e a (Linnaeus) (Lepidoptera: Noto- dontidae). Pimpla processioneae is recorded here for the first time from The Netherlands. Entomologische Berichten 65(1): 14-16 Key words: oak processionary caterpillar, Thaumetopoea processionea, parasitoid as egg. The processionary caterpillars live in colonies and Introduction rest at daytime in ‘nests’, mainly consisting of empty cater- pillar skins. At night they walk in procession over the Ratzeburg (1849) described a pimpline species that had been branches to the leaves. When they are fully grown they pu- reared from Thaumetopoea processionea (Linnaeus) (Lepido- pate together in the nest. ptera: Notodontidae) on oak: Pimpla processioneae (figure The species can be absent for long periods and then 1). In the description Ratzeburg emphasised the yellowish- within a few years develop into a plague. From 1987 on it white marked scutellum. Due to its close resemblance to the steadily increased in range and numbers until in 1997 it be- very common polyphagous pupal parasitoid P. rufipes (Mil- came a real plague in the southern provinces Noord-Brabant ler) (synonyms: P. hypochondriaca (Retzius), P. instigator and Limburg (Stigter et al. 1997). It then defoliated many (Fa b r i c i u s ) ) subsequent authors have treated this taxon in oak trees and the wind-blown urticating hairs caused se- various ways.
    [Show full text]
  • Subfamily Composition of Ichneumonidae (Hymenoptera) from Western Amazonia: Insights Into Diversity of Tropical Parasitoid Wasps
    Insect Conservation and Diversity (2012) doi: 10.1111/j.1752-4598.2012.00185.x Subfamily composition of Ichneumonidae (Hymenoptera) from western Amazonia: Insights into diversity of tropical parasitoid wasps ANU VEIJALAINEN,1 ILARI E. SA¨ A¨ KSJA¨ RVI,1 TERRY L. ERWIN,2 1 3 ISRRAEL C. GO´ MEZ and JOHN T. LONGINO 1Department of Biology, Section of Biodi- versity and Environmental Science, University of Turku, Turku, Finland, 2Department of Entomology, National Museum of Natural History, Smithsonian Institution, Washington, DC, USA and 3Department of Biology, University of Utah, Salt Lake City, UT, USA Abstract. 1. Previous studies have found the parasitoid wasp family Ichneumonidae (Hymenoptera) to have an exceptional latitudinal species richness gradient that peaks at mid-latitudes instead of the tropics; however, insufficient tropical sampling and species description may have biased the conclusions. It has been unclear which subfamilies might be species rich in tropical lowland rain forests. 2. This study reports the subfamily abundance composition of a large ichneumo- nid data set (>30 000 individuals in 20 subfamilies) collected by Malaise traps and insecticidal canopy fogging in Amazonian Ecuador and Peru and suggests which subfamilies would be important for future study. 3. Relative abundance data from one Peruvian site are compared to similar low- land samples from Costa Rica and Georgia (USA). 4. Contrary to a common assumption, a number of ichneumonid subfamilies are very abundant and presumably species rich in western Amazonia. Cryptinae and Or- thocentrinae are noticeably the two most abundant subfamilies, and a number of koinobiont lepidopteran parasitoids, which are generally thought to be scarce in the tropics, are also surprisingly abundant (e.g.
    [Show full text]
  • Chapter 2. the Effects of Compsilura Concinnata, an Introduced Generalist Tachinid, on Non-Target Species in North America: a Cautionary Tale
    ASSESSING HOST RANGES OF PARASITOIDS AND PREDATORS _________________________________ CHAPTER 2. THE EFFECTS OF COMPSILURA CONCINNATA, AN INTRODUCED GENERALIST TACHINID, ON NON-TARGET SPECIES IN NORTH AMERICA: A CAUTIONARY TALE J. S. Elkinton and G. H. Boettner Deptartment of Plant, Soil and Insect Science: Division of Entomology, University of Massachusetts, Amherst, MA 01003 USA [email protected] INTRODUCTION Classical biological control has long been a principal weapon in the worldwide effort to com- bat the devastating effects of invasive species. Classical biological control involves locating natural enemies of invasive species in their native range and releasing them in the newly invaded habi- tat. The premise of classical biological control is that invasive species out-compete native spe- cies and become major pest problems in large part because they have become isolated from the suite of natural enemies that keep them in check in their native habitat. There have been many successes worldwide in the classical biological control of both invasive weeds and invasive arthropods. The advantages of classical biological control over any other approach are obvi- ous and well known: the control exerted is typically permanent; it requires little or no further intervention; it is thus highly cost effective compared to mechanical removal or use of chemical pesticides, which must typically be applied repeatedly and are often infeasible in forests or other natural habitats. Classical biological control of invasive weeds has had a long history of evaluating the host range of candidates for introduction. The obvious reason is that herbivorous natural enemies might become important pests of agricultural crops or other beneficial plants.
    [Show full text]
  • Changes in Lymantria Dispar Protocerebral Neurosecretory Neurons After Exposure to Cadmium
    Arch. Biol. Sci., Belgrade, 63 (4), 1287-1292, 2011 DOI:10.2298/ABS1104287I CHANGES IN LYMANTRIA DISPAR PROTOCEREBRAL NEUROSECRETORY NEURONS AFTER EXPOSURE TO CADMIUM LARISA ILIJIN*, MILENA VLAHOVIĆ, MARIJA MRDAKOVIĆ, DRAGANA MATIĆ, JELICA LAZAREVIĆ, DAJANA TODOROVIĆ and VESNA PERIĆ-MATARUGA Department of Insect Physiology and Biochemistry, Institute for Biological Research „Siniša Stanković”, University of Belgrade, 11060 Belgrade, Serbia Abstract - Gypsy moth 4th instar caterpillars were fed for 3 days with an artificial diet supplemented with increasing cad- mium (Cd) concentrations (0, 10, 30, 100 and 250 µg⁄g of dry food weight). Changes in the morphometric characteristics of A1’ dorso-medial and L2 dorso-lateral neurosecretory neurons (nsn) were analyzed. In the A1’ nsn, Cd supplements led to an enhanced nuclear size, except in the group treated with 250 µg Cd⁄g in the form of dry food. The size of L2 type nsn was increased in the groups provided with 30 and 100 µg Cd⁄g, while no differences in the size of nuclei was detected in L2 neurons among the experimental groups. Key words: Cadmium, Lymantria dispar, protocerebral neurosecretory neurons UDC 595.78:591:54 INTRODUCTION pid metabolism as well as digestive enzyme amounts and activities (Ivanović and Janković-Hladni, 1991; Lymantria dispar is a polyphagous herbivorous insect Mrdaković et al., 2008). pest with a host range estimated at more than 500 plant species (Lance, 1983). Cadmium accumulation Our previous investigations revealed that acute in plants causes changes in the dynamics of animal exposure of gypsy moth caterpillars to a Cd sup- populations, including L. dispar and other phytopha- plemented diet induced changes in the activity of gous insects (Williams and Liebhold, 1995).
    [Show full text]
  • Simultaneous Percussion by the Larvae of a Stem-Nesting Solitary
    JHR 81: 143–164 (2021) doi: 10.3897/jhr.81.61067 RESEARCH ARTICLE https://jhr.pensoft.net Simultaneous percussion by the larvae of a stem- nesting solitary bee – a collaborative defence strategy against parasitoid wasps? Andreas Müller1, Martin K. Obrist2 1 ETH Zurich, Institute of Agricultural Sciences, Biocommunication and Entomology, Schmelzbergstrasse 9/ LFO, 8092 Zurich, Switzerland 2 Swiss Federal Research Institute WSL, Biodiversity and Conservation Biol- ogy, 8903 Birmensdorf, Switzerland Corresponding author: Andreas Müller ([email protected]) Academic editor: Michael Ohl | Received 23 November 2020 | Accepted 7 February 2021 | Published 25 February 2021 http://zoobank.org/D10742E1-E988-40C1-ADF6-7F8EC24D6FC4 Citation: Müller A, Obrist MK (2021) Simultaneous percussion by the larvae of a stem-nesting solitary bee – a collaborative defence strategy against parasitoid wasps? Journal of Hymenoptera Research 81: 143–164. https://doi. org/10.3897/jhr.81.61067 Abstract Disturbance sounds to deter antagonists are widespread among insects but have never been recorded for the larvae of bees. Here, we report on the production of disturbance sounds by the postdefecating larva (“prepupa”) of the Palaearctic osmiine bee Hoplitis (Alcidamea) tridentata, which constructs linear series of brood cells in excavated burrows in pithy plant stems. Upon disturbance, the prepupa produces two types of sounds, one of which can be heard up to a distance of 2–3 m (“stroking sounds”), whereas the other is scarcely audible by bare ear (“tapping sounds”). To produce the stroking sounds, the prepupa rapidly pulls a horseshoe-shaped callosity around the anus one to five times in quick succession over the cocoon wall before it starts to produce tapping sounds by knocking a triangularly shaped callosity on the clypeus against the cocoon wall in long uninterrupted series of one to four knocks per second.
    [Show full text]
  • British Ichneumonid Wasps ID Guide
    Beginner’s guide to identifying British ichneumonids By Nicola Prehn and Chris Raper 1 Contents Introduction Mainly black-bodied species with orange legs – often with long ovipositors What are ichneumonids? Lissonota lineolaris Body parts Ephialtes manifestator Tromatobia lineatoria (females only) Taking good photos of them Perithous scurra (females only) Do I have an ichneumonid? Apechthis compunctor (females only) Pimpla rufipes (black slip wasp. females only) Which type of ichneumonid do I have? Rhyssa persuasoria (sabre wasp) Large and/or colourful species Possible confusions - Lissonata setosa Amblyjoppa fuscipennis Nocturnal, orange-bodied species – sickle wasps Amblyjoppa proteus Enicospilus ramidulus Achaius oratorius Ophion obscuratus Amblyteles armatorius Opheltes glaucopterus Ichneumon sarcitorius Netelia tarsata Ichneumon xanthorius Possible confusions - Ophion luteus Ichneumon stramentor Wing comparison Callajoppa cirrogaster and Callajoppa exaltatoria Others Possible confusions - Ichneumon suspiciosus Alomya debellator Acknowledgements Further reading 2 Introduction Ichneumonids, species of the family Ichneumonidae, are difficult to identify because so many look similar. Identifications are usually made using tiny features only visible under a microscope, which Subfamily Species makes the challenge even harder. This guide attempts to allow beginners to name 22 of the most Alomyinae Alomya debellator identifiable or most frequently encountered species from eight of the 32 subfamilies in Britain. It is Banchinae Lissonota lineolaris not a comprehensive guide but intended as an introduction, using characters that are often visible in Lissonata setosa photos or in the field. Ctenopelmatinae Opheltes glaucopterus For a more detailed guide, Gavin Broad’s Identification Key to the Subfamilies of Ichneumonidae is a Ichneumoninae Amblyjoppa fuscipennis good introduction for people who have a microscope or very good hand lens.
    [Show full text]