DOCSLIB.ORG

NIK Is a Component of the EGF/Heregulin Receptor Signaling Complexes

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
NIK Is a Component of the EGF/Heregulin Receptor Signaling Complexes Oncogene (2003) 22, 4348–4355 & 2003 Nature Publishing Group All rights reserved 0950-9232/03 $25.00 www.nature.com/onc NIK is a component of the EGF/heregulin receptor signaling complexes Danying Chen1, Liang-Guo Xu2, Lei Chen1, Lixia Li1, Zhonghe Zhai1, Hong-Bing Shun,1,2 1Department of Cell Biology and Genetics, College of Life Sciences, Peking University, Beijing 100871, China; 2Department of Immunology, National Jewish Medical and Research Center, University of Colorado Health Sciences Center, 1400 Jackson Street, k516c, Denver, CO 80206, USA Nuclear factor jB-inducing kinase (NIK) is a member of Introduction the MAP kinase kinase kinase family that was first identified as a component of the TNF-R1-induced NF-jB activation pathway (TNF, tumor necrosis factor; nuclear Nuclear factor kB-inducing kinase (NIK) is a serine/ factor kappaB, NF-jB). Gene knockout study, however, threonine protein kinase belonging to the MAP kinase suggests that NIK is dispensable for TNF-R1- but kinase kinase family, which also includes MEKK1-4, required for lymphotoxin-b receptor-induced NF-jB ASK1, and Raf, among others (Malinin et al., 1997). activation. A NIK kinase inactive mutant is a potent NIK was first identified as a TRAF2-interacting protein inhibitor of NF-jB activation triggered by various stimuli, by yeast two-hybrid screening and was shown to be suggesting that NIK is involved in a broad range of NF-jB involved in the TNF-R1-induced NF-kB activation activation pathways. To unambiguously identify signaling pathway (Malinin et al., 1997) (TNF, tumor necrosis pathways that NIK participates in, we screened antibody factor; nuclear factor kappaB, NF-kB).Subsequently, it arrays for proteins that are associated with NIK. This has been suggested that NIK interacts with various effort identified ErbB4, one of the EGF/heregulin TRAFs and can activate IKK, a kinase complex that is receptors, and Grb7, an adapter protein associated with critically involved in NF-kB activation triggered by ErbB4 (ErbB, epidermal growth factor receptor family divergent stimuli (Lin et al., 1998a, b). However, gene protein; EGF, epidermal growth factor; Grb, growth knockout experiments indicate that NIK is essential for factor receptor bound). Coimmunoprecipitation experi- lymphotoxin-b- but not TNF-R-induced NF-kB activa- ments demonstrated that NIK interacted with Grb7, as tion (Matsushima et al., 2001; Yin et al., 2001). well as Grb10 and Grb14, but not Grb2. Domain mapping Furthermore, it is suggested that NIK functions at a experiments indicated that the central GMdomain of nuclear rather than a cytoplasmic step in the lympho- Grb7 was sufficient for its interaction with NIK. toxin-b-induced NF-kB activation pathway (Yin et al., Coimmunoprecipitation experiments also indicated that 2001).Since a kinase inactive mutant of NIK can block Grb7 and NIK could be simultaneously recruited into NF-kB activation by various stimuli, such as TNF, IL1, signaling complexes of all known EGF/heregulin recep- and LPS, this suggests that NIK may be involved in a tors, including EGFR, ErbB2, ErbB3, and ErbB4. In broad range of NF-kB activation pathways. reporter gene assays, NIK could potentiate Grb7, ErbB2/ Previously, it has been shown that epidermal growth ErbB4, and EGF-induced NF-jB activation. A NIK factor (EGF) can activate NF-kB through undefined kinase inactive mutant could block ErbB2/ErbB4 and pathways (Obata et al., 1996; Sun and Carpenter, 1998; EGF-induced NF-jB activation. Moreover, EGF/here- Biswas et al., 2000; Habib et al., 2001). EGF family gulin receptors activated NF-jB in wild-type, but not members interact with receptors belonging to the EGF NIKÀ/À embryonic fibroblasts. Our findings suggest that receptor family, including epidermal growth factor NIK is a component of the EGF/heregulin receptor receptor (EGFR), epidermal growth factor receptor signaling complexes and involved in NF-jB activation family protein (ErbB)2, ErbB3, and ErbB4 (Pawson, triggered by these receptors. 1995).The cytoplasmic domains of the EGF receptor Oncogene (2003) 22, 4348–4355. doi:10.1038/sj.onc.1206532 family members, except for ErbB2, have intrinsic tyrosine kinase activity.Ligand stimulation leads to Keywords: NIK; EGF; Grb7; NF-kB; signaling homo- or heterodimerization of the EGF receptor family members and their autophosphorylation.This process creates docking sites for downstream signaling molecules that contain the SH2 domain (Pawson, 1995). Interaction of these signaling molecules with the receptors initiates intracellular signaling cascades that *Correspondence: Hong-Bing Shu, Department of Immunology, lead to activation of a number of transcription factors National Jewish Medical and Research Center, University of Colorado such as AP-1 and STATS (Hill and Treisman, 1995). Health Sciences Center, 1400 Jackson Street, k516c, Denver, CO Previous studies also suggest that EGF can activate NF- 80206, USA; E-mail: [email protected] Received 3 January 2003; revised 20 February 2003; accepted 26 kB in several types of cells, including smooth muscle, February 2003 A431, fibroblasts, and EGF receptor-overexpressing NIK is a component of the EGF/heregulin D Chen et al 4349 breast cancer cells (Obata et al., 1996; Sun and proteins.The antibodies are immobilized on a nitrocel- Carpenter, 1998; Biswas et al., 2000; Habib et al., 2001). lulose membrane, each at a predetermined position, and The growth factor receptor bound (Grb)7 family they retain their capabilities of recognizing and captur- members are some of the adapter molecules that interact ing antigens as well as antigen-associated proteins.We with activated receptor tyrosine kinases, including the transfected 293 cells with an expression plasmid for EGF receptor family members.The Grb7 family Flag-NIK and the cell lysate was used to incubate with consists of Grb7, Grb10, and Grb14, which do not the antibody array membrane.Using anti-Flag anti- have intrinsic enzymatic activity and signal through body, we detected that 21 antibodies could recruit Flag- their interaction with downstream proteins (Daly, 1998; NIK, probably directly or indirectly through their Han et al., 2001). Unlike Grb2, which contains an SH2 antigens.These include antibodies against NBK, Mad- domain flanked by two SH3 domains, the Grb7 family 1, p38, CD3-e, eNOS, HSP-70, ANT, DAXX, SODD, members contain an N-terminal proline-rich (PR) thyroid receptor a1, Sp1, ErbB4, TNF-R1, B7-1, region, a central GM region that is homologous with DMBT1, GATA-1, IRF2, TRADD, BOK, caspase-2, the C. elegans protein Mig10, and a C-terminal SH2 and Grb7.Results for part of the membrane are shown domain (Daly, 1998; Han et al., 2001). The SH2 domain in Figure 1.Previously, it was shown that Grb7 is of the Grb7 family is responsible for interaction with the associated with EGF receptor family members, includ- majority of identified Grb7-interacting proteins, such as ing EGFR, ErbB2, ErbB3, and ErbB4 (Margolis et al., the EGF receptor family members, Shc, Raf, Tek/Tie2, 1992; Stein et al., 1994; Janes et al., 1997; Daly, 1998; and FAK, among others (Han et al., 2001). It has been Fiddes et al., 1998; Han et al., 2001). Thus, recruitment shown that the PR domain of Grb7 family members of NIK to two independent antibodies against ErbB4 interacts with c-Abl and Tankyrase (Frantz et al., 1997; and Grb7, respectively, suggests a high possibility that Han et al., 2001; Lyons et al., 2001). Proteins that NIK is a true component of the ErbB4/Grb7 signaling interact with the large central GM domain of the Grb7 complex. family members are not known. In addition to their roles in EGF receptor signaling, NIK interacts with Grb7, Grb10, and Grb14, but not Grb2 the Grb7 family members play divergent roles in various signaling pathways and pathophysiological processes. To determine whether NIK interacts with Grb7, we Grb7 is overexpressed in some human primary cancers transfected 293 cells with expression plasmids for HA- and tumor cell lines, suggesting a possible role in tagged NIK and Flag-tagged Grb7 and performed tumorigenesis (Stein et al., 1994). Various studies have immunoprecipitation experiments.These experiments also suggested a role for Grb7 in the regulation of cell suggest that NIK interacts with Grb7 in 293 cells migration (Tanaka et al., 1998; Han and Guan, 1999; (Figure 2).The Grb7 adapter family contains three Han et al., 2000; Lee et al., 2000; Vaysssiere et al., 2000). members, including Grb7, Grb10, and Grb14 (Daly, Grb10 has been found to be associated with mitochon- 1998; Han et al., 2001). Coimmunoprecipitation experi- dria, where it interacts with Raf1 and is likely to be ments indicate that NIK also interacts with Grb10 and involved in the regulation of apoptosis (Nantel et al., Grb14 (Figure 2).These interactions are specific because 1998, 1999).It was also reported that Grb10 is recruited Grb2, an adapter protein not belonging to the Grb7 to the c-Kit receptor in the course of SCF-mediated family, does not interact with NIK under the same activation of c-Kit and forms a complex with Akt (Jahn condition (Figure 2). et al., 2002). Grb14 was recently shown to be a specific inhibitor of insulin receptor catalytic activity (Berezia Domain mapping of interaction between Grb7 and NIK et al., 2002). To unambiguously identify the signaling pathways It has been shown that the SH2 domain of Grb7 family that NIK participates in, we searched NIK-associated members is responsible for interaction with most proteins by screening antibody arrays.This effort identified ErbB4 and Grb7 as two proteins that are associated with NIK.Our findings suggest that NIK is a component of the EGF/heregulin receptor signaling complexes and involved in NF-kB activation by these receptors. Results Identification of NIK-associated proteins by screening of antibody arrays Figure 1 Identification of NIK-associated proteins by screening of To search for potential NIK-associated proteins, we antibody arrays.The antibody array membranes were incubated with cell lysate containing Flag-NIK, probed with anti-Flag used the Signal Transduction Antibody ArrayTM antibody, and then detected by ECL.The positive signals system (Hypromatrix, Inc.).
Load more

Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • Chemoresistance in Human Ovarian Cancer: the Role of Apoptotic
    Reproductive Biology and Endocrinology BioMed Central Review Open Access Chemoresistance in human ovarian cancer: the role of apoptotic regulators Michael Fraser1, Brendan Leung1, Arezu Jahani-Asl1, Xiaojuan Yan1, Winston E Thompson2 and Benjamin K Tsang*1 Address: 1Department of Obstetrics & Gynecology and Cellular & Molecular Medicine, University of Ottawa, Ottawa Health Research Institute, Ottawa, Canada K1Y 4E9, Canada and 2Department of Obstetrics & Gynecology and Cooperative Reproductive Science Research Center, Morehouse School of Medicine, Atlanta, GA 30310, USA Email: Michael Fraser - [email protected]; Brendan Leung - [email protected]; Arezu Jahani-Asl - [email protected]; Xiaojuan Yan - [email protected]; Winston E Thompson - [email protected]; Benjamin K Tsang* - [email protected] * Corresponding author Published: 07 October 2003 Received: 26 June 2003 Accepted: 07 October 2003 Reproductive Biology and Endocrinology 2003, 1:66 This article is available from: http://www.RBEj.com/content/1/1/66 © 2003 Fraser et al; licensee BioMed Central Ltd. This is an Open Access article: verbatim copying and redistribution of this article are permitted in all media for any purpose, provided this notice is preserved along with the article's original URL. Abstract Ovarian cancer is among the most lethal of all malignancies in women. While chemotherapy is the preferred treatment modality, chemoresistance severely limits treatment success. Recent evidence suggests that deregulation of key pro- and anti-apoptotic pathways is a key factor in the onset and maintenance of chemoresistance. Furthermore, the discovery of novel interactions between these pathways suggests that chemoresistance may be multi-factorial. Ultimately, the decision of the cancer cell to live or die in response to a chemotherapeutic agent is a consequence of the overall apoptotic capacity of that cell.
    [Show full text]
  • CRKL As a Lung Cancer Oncogene and Mediator Of
    views in The spotliGhT CRKL as a Lung Cancer Oncogene and Mediator of Acquired Resistance to eGFR inhibitors: is it All That it is Cracked Up to Be? Marc Ladanyi summary: Cheung and colleagues demonstrate that amplified CRKL can function as a driver oncogene in lung adeno- carcinoma, activating both RAS and RAP1 to induce mitogen-activated protein kinase signaling. In addition, they show that CRKL amplification may be another mechanism for primary or acquired resistance to epidermal growth factor re- ceptor kinase inhibitors. Cancer Discovery; 1(7); 560–1. ©2011 AACR. Commentary on Cheung et al., p. 608 (1). In this issue of Cancer Discovery, Cheung and colleagues (1) mutual exclusivity. Cheung and colleagues (1) report that present extensive genomic and functional data supporting focal CRKL amplification is mutually exclusive with EGFR focal amplification of the CRKL gene at 22q11.21 as a driver mutation and EGFR amplification. However, of the 6 lung oncogene in lung adenocarcinoma. The report expands on cancer cell lines found in this study to have focal gains of data previously presented by Kim and colleagues (2). CRKL CRKL, 2 contain other major driver oncogenes (KRAS G13D is a signaling adaptor protein that contains SH2 and SH3 in HCC515, BRAF G469A in H1755; refs. 7, 8). Interestingly, domains that mediate protein–protein interactions linking both cell lines demonstrated clear dependence on CRKL in tyrosine-phosphorylated upstream signaling molecules (e.g., functional assays. Perhaps CRKL amplification is more akin BCAR1, paxillin, GAB1) to downstream effectors (e.g., C3G, to PIK3CA mutations, which often, but not always, are con- SOS) (3).
    [Show full text]
  • Evidence for an Interaction Between the Insulin Receptor and Grb7. a Role for Two of Its Binding Domains, PIR and SH2
    Oncogene (2000) 19, 2052 ± 2059 ã 2000 Macmillan Publishers Ltd All rights reserved 0950 ± 9232/00 $15.00 www.nature.com/onc Evidence for an interaction between the insulin receptor and Grb7. A role for two of its binding domains, PIR and SH2 Anne Kasus-Jacobi1,2,3,Ve ronique Be re ziat1,3, Dominique Perdereau1, Jean Girard1 and Anne-FrancËoise Burnol*,1 1Endocrinologie MeÂtabolisme et DeÂveloppement, CNRS, UPR 1524, 9 rue Jules Hetzel, 92190 Meudon, France The molecular adapter Grb7 is likely to be implicated in new family of adapters has recently emerged, the Grb7 the development of certain cancer types. In this study we family of proteins, comprising Grb7, Grb10 and show that Grb7 binds the insulin receptors, when they Grb14. The members of this family were originally are activated and tyrosine phosphorylated. This interac- cloned by interaction with EGF receptor, using the tion is documented by two-hybrid experiments, GST CORT (cloning of receptor target) system (Daly et al., pull-down assays and in vivo coimmunoprecipitations. In 1996; Margolis, 1994; Ooi et al., 1995), and the use of addition, our results argue in favor of a preferential the yeast two-hybrid technology has emphasized their association between Grb7 and the insulin receptors when implication in signal transduction (Daly, 1998). These compared to other tyrosine kinase receptors like the adapters bind also other tyrosine kinase receptors, like EGF receptor, the FGF receptor and Ret. Interestingly, erbB2, Ret, Elk, PDGF receptors, insulin receptors and Grb7 is not a substrate of the insulin receptor tyrosine IGF-1 receptors (Daly et al., 1996; Dey et al., 1996; kinase activity.
    [Show full text]
  • A Network Model of Early Events in Epidermal Growth Factor Receptor Signaling That Accounts for Combinatorial Complexity Michael L
    BioSystems 83 (2006) 136–151 A network model of early events in epidermal growth factor receptor signaling that accounts for combinatorial complexity Michael L. Blinov, James R. Faeder, Byron Goldstein, William S. Hlavacek ∗ Theoretical Biology and Biophysics Group, Theoretical Division, Los Alamos National Laboratory, Los Alamos, NM 87545, USA Received 8 January 2005; received in revised form 6 May 2005; accepted 21 June 2005 Abstract We consider a model of early events in signaling by the epidermal growth factor (EGF) receptor (EGFR). The model includes EGF, EGFR, the adapter proteins Grb2 and Shc, and the guanine nucleotide exchange factor Sos, which is activated through EGF- induced formation of EGFR–Grb2–Sos and EGFR–Shc–Grb2–Sos assemblies at the plasma membrane. The protein interactions involved in signaling can potentially generate a diversity of protein complexes and phosphoforms; however, this diversity has been largely ignored in models of EGFR signaling. Here, we develop a model that accounts more fully for potential molecular diversity by specifying rules for protein interactions and then using these rules to generate a reaction network that includes all chemical species and reactions implied by the protein interactions. We obtain a model that predicts the dynamics of 356 molecular species, which are connected through 3749 unidirectional reactions. This network model is compared with a previously developed model that includes only 18 chemical species but incorporates the same scope of protein interactions. The predictions of this model are reproduced by the network model, which also yields new predictions. For example, the network model predicts distinct temporal patterns of autophosphorylation for different tyrosine residues of EGFR.
    [Show full text]
  • HER2 Stabilizes EGFR and Itself by Altering Autophosphorylation Patterns in a Manner That Overcomes Regulatory Mechanisms and Pr
    Oncogene (2013) 32, 4169–4180 & 2013 Macmillan Publishers Limited All rights reserved 0950-9232/13 www.nature.com/onc ORIGINAL ARTICLE HER2 stabilizes EGFR and itself by altering autophosphorylation patterns in a manner that overcomes regulatory mechanisms and promotes proliferative and transformation signaling Z Hartman1, H Zhao1 and YM Agazie1,2 One of the causes of breast cancer is overexpression of the human epidermal growth factor receptor 2 (HER2). Enhanced receptor autophosphorylation and resistance to activation-induced downregulation have been suggested as mechanisms for HER2-induced sustained signaling and cell transformation. However, the molecular mechanisms underlying these possibilities remain incompletely understood. In the current report, we present evidence that show that HER2 overexpression does not lead to receptor hyper-autophosphorylation, but alters patterns in a manner that favors receptor stability and sustained signaling. Specifically, HER2 overexpression blocks epidermal growth factor receptor (EGFR) tyrosine phosphorylation on Y1045 and Y1068, the known docking sites of c-Cbl and Grb2, respectively, whereas promoting phosphorylation on Y1173, the known docking site of the Gab adaptor proteins and phospholipase C gamma. Under these conditions, HER2 itself is phosphorylated on Y1221/1222, with no known role, and on Y1248 that corresponds to Y1173 of EGFR. Interestingly, suppressed EGFR autophosphorylation on the Grb2 and c-Cbl-binding sites correlated with receptor stability and sustained signaling, suggesting that HER2 accomplishes these tasks by altering autophosphorylation patterns. In conformity with these findings, mutation of the Grb2-binding site on EGFR (Y1068F–EGFR) conferred resistance to ligand-induced degradation, which in turn induced sustained signaling, and increased cell proliferation and transformation.
    [Show full text]
  • Stimulation of Endogenous GH and Interleukin-6 Receptors Selectively Activates Different Jaks and Stats, with a Stat5 Specific Synergistic Effect of Dexamethasone
    301 Stimulation of endogenous GH and interleukin-6 receptors selectively activates different Jaks and Stats, with a Stat5 specific synergistic effect of dexamethasone S von Laue1, J Finidori3, M Maamra1, X-Y Shen1, S Justice1, P R M Dobson2 and R J M Ross1 1Division of Clinical Sciences, University of Sheffield, UK 2Institute for Cancer Studies, University of Sheffield, UK 3INSERM, Unité 344, Faculté de Médecine Necker, Paris, France (Requests for offprints should be addressed to S von Laue, INSERM U344, Laboratoire d’Endocrinologie Moléculaire, Faculté de Médecine Necker-Enfants Malades, 156, rue de Vaugirard, 75 730 Paris cedex 15, France; Email: [email protected]) Abstract The interaction of GH, interleukin (IL)-6 and glucocorti- Stat3 activation. In contrast, the reporter gene containing coids is likely to be important in regulating the GH- the Stat3 responsive element (SIE) was IL-6 specific. The insulin-like growth factor (IGF)-I axis. The signalling levels of gene induction by GH and IL-6 were not altered cascades activated by GH and IL-6 appear to be very by the co-stimulation with GH and IL-6, suggesting that similar, as demonstrated by studies using overexpression of there is little cross-talk at the Jak–Stat activation level the receptor and other components of the Jak-Stat and between the two cytokines. Neither GH nor IL-6 acti- mitogen-activated protein (MAP) kinase pathways. Here vated the MAP-kinase responsive serum response element we show that the human embryonic kidney cell line 293 (SRE), unless GH receptors or gp130 were overexpressed. (HEK293) expresses GH and IL-6 receptors endogenously.
    [Show full text]
  • Increased in Vivo Phosphorylation of Ret Tyrosine 1062 Is a Potential Pathogenetic Mechanism of Multiple Endocrine Neoplasia Type 2B1
    [CANCER RESEARCH 61, 1426–1431, February 15, 2001] Increased in Vivo Phosphorylation of Ret Tyrosine 1062 Is a Potential Pathogenetic Mechanism of Multiple Endocrine Neoplasia Type 2B1 Domenico Salvatore, Rosa Marina Melillo, Carmen Monaco, Roberta Visconti, Gianfranco Fenzi, Giancarlo Vecchio, Alfredo Fusco, and Massimo Santoro2 Centro di Endocrinologia ed Oncologia Sperimentale del CNR, c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare [D. S., R. M. M., C. M., R. V., G. V., M. S.], and Dipartimento di Endocrinologia ed Oncologia Molecolare e Clinica, Facolta` di Medicina e Chirurgia [G. F.], Universita` di Napoli “Federico II,” Naples, Italy; and Dipartimento di Medicina Sperimentale e Clinica, Facolta`di Medicina e Chirurgia di Catanzaro, Universita`di Catanzaro, Catanzaro [A. F], Italy ABSTRACT are responsible for the inheritance of MEN2A and MEN2B and FMTC. Each disease has a distinct phenotype: MEN2A is associated Mutations of the Ret receptor tyrosine kinase are responsible for with MTC, pheochromocytoma, and parathyroid hyperplasia. The inheritance of multiple endocrine neoplasia (MEN2A and MEN2B) and MEN2B phenotype is more severe, being characterized by an earlier familial medullary thyroid carcinoma syndromes. Although several famil- ial medullary thyroid carcinoma and most MEN2A mutations involve occurrence of more aggressive MTC. Unlike MEN2A patients, substitutions of extracellular cysteine residues, in most MEN2B cases MEN2B patients develop multiple mucosal neuromas and several there is a methionine-to-threonine substitution at position 918 (M918T) of skeletal abnormalities. Finally, FMTC consists only of an inherited the Ret kinase domain. The mechanism by which the MEN2B mutation predisposition to MTC (3). Involvement of different tissues corre- converts Ret into a potent oncogene is poorly understood.
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • And Sepsis-Induced Lung Inflammation and Mediates Myd88
    The Journal of Immunology Caveolin-1 Tyr14 Phosphorylation Induces Interaction with TLR4 in Endothelial Cells and Mediates MyD88-Dependent Signaling and Sepsis-Induced Lung Inflammation Hao Jiao,*,†,1 Yang Zhang,*,†,1 Zhibo Yan,* Zhen-Guo Wang,* Gongjian Liu,† Richard D. Minshall,*,‡ Asrar B. Malik,‡ and Guochang Hu*,‡ Activation of TLR4 by the endotoxin LPS is a critical event in the pathogenesis of Gram-negative sepsis. Caveolin-1, the signaling protein associated with caveolae, is implicated in regulating the lung inflammatory response to LPS; however, the mechanism is not understood. In this study, we investigated the role of caveolin-1 in regulating TLR4 signaling in endothelial cells. We observed that LPS interaction with CD14 in endothelial cells induced Src-dependent caveolin-1 phosphorylation at Tyr14. Using a TLR4-MD2- CD14–transfected HEK-293 cell line and caveolin-1–deficient (cav-12/2) mouse lung microvascular endothelial cells, we demon- strated that caveolin-1 phosphorylation at Tyr14 following LPS exposure induced caveolin-1 and TLR4 interaction and, thereby, TLR4 activation of MyD88, leading to NF-kB activation and generation of proinflammatory cytokines. Exogenous expression of phosphorylation-deficient Y14F caveolin-1 mutant in cav-12/2 mouse pulmonary vasculature rendered the mice resistant to LPS compared with reintroduction of wild-type caveolin-1. Thus, caveolin-1 Y14 phosphorylation was required for the interaction with TLR4 and activation of TLR4-MyD88 signaling and sepsis-induced lung inflammation. Inhibiting caveolin-1 Tyr14 phosphoryla- tion and resultant inactivation of TLR4 signaling in pulmonary vascular endothelial cells represent a novel strategy for preventing sepsis-induced lung inflammation and injury.
    [Show full text]
  • ITRAQ-Based Quantitative Proteomic Analysis of Processed Euphorbia Lathyris L
    Zhang et al. Proteome Science (2018) 16:8 https://doi.org/10.1186/s12953-018-0136-6 RESEARCH Open Access ITRAQ-based quantitative proteomic analysis of processed Euphorbia lathyris L. for reducing the intestinal toxicity Yu Zhang1, Yingzi Wang1*, Shaojing Li2*, Xiuting Zhang1, Wenhua Li1, Shengxiu Luo1, Zhenyang Sun1 and Ruijie Nie1 Abstract Background: Euphorbia lathyris L., a Traditional Chinese medicine (TCM), is commonly used for the treatment of hydropsy, ascites, constipation, amenorrhea, and scabies. Semen Euphorbiae Pulveratum, which is another type of Euphorbia lathyris that is commonly used in TCM practice and is obtained by removing the oil from the seed that is called paozhi, has been known to ease diarrhea. Whereas, the mechanisms of reducing intestinal toxicity have not been clearly investigated yet. Methods: In this study, the isobaric tags for relative and absolute quantitation (iTRAQ) in combination with the liquid chromatography-tandem mass spectrometry (LC-MS/MS) proteomic method was applied to investigate the effects of Euphorbia lathyris L. on the protein expression involved in intestinal metabolism, in order to illustrate the potential attenuated mechanism of Euphorbia lathyris L. processing. Differentially expressed proteins (DEPs) in the intestine after treated with Semen Euphorbiae (SE), Semen Euphorbiae Pulveratum (SEP) and Euphorbiae Factor 1 (EFL1) were identified. The bioinformatics analysis including GO analysis, pathway analysis, and network analysis were done to analyze the key metabolic pathways underlying the attenuation mechanism through protein network in diarrhea. Western blot were performed to validate selected protein and the related pathways. Results: A number of differentially expressed proteins that may be associated with intestinal inflammation were identified.
    [Show full text]
  • Paxillin: a Crossroad in Pathological Cell Migration Ana María López-Colomé*, Irene Lee-Rivera, Regina Benavides-Hidalgo and Edith López
    López-Colomé et al. Journal of Hematology & Oncology (2017) 10:50 DOI 10.1186/s13045-017-0418-y REVIEW Open Access Paxillin: a crossroad in pathological cell migration Ana María López-Colomé*, Irene Lee-Rivera, Regina Benavides-Hidalgo and Edith López Abstract Paxilllin is a multifunctional and multidomain focal adhesion adapter protein which serves an important scaffolding role at focal adhesions by recruiting structural and signaling molecules involved in cell movement and migration, when phosphorylated on specific Tyr and Ser residues. Upon integrin engagement with extracellular matrix, paxillin is phosphorylated at Tyr31, Tyr118, Ser188, and Ser190, activating numerous signaling cascades which promote cell migration, indicating that the regulation of adhesion dynamics is under the control of a complex display of signaling mechanisms. Among them, paxillin disassembly from focal adhesions induced by extracellular regulated kinase (ERK)- mediated phosphorylation of serines 106, 231, and 290 as well as the binding of the phosphatase PEST to paxillin have been shown to play a key role in cell migration. Paxillin also coordinates the spatiotemporal activation of signaling molecules, including Cdc42, Rac1, and RhoA GTPases, by recruiting GEFs, GAPs, and GITs to focal adhesions. As a major participant in the regulation of cell movement, paxillin plays distinct roles in specific tissues and developmental stages and is involved in immune response, epithelial morphogenesis, and embryonic development. Importantly, paxillin is also an essential player in pathological conditions including oxidative stress, inflammation, endothelial cell barrier dysfunction, and cancer development and metastasis. Keywords: Cancer, Focal adhesions, Cell migration, Signal transduction Background gene transcription, thus acting as a direct link from the Paxillin is a main component of focal adhesions (FAs) and plasma membrane and the cytoskeleton to the nucleus [5].
    [Show full text]