DOCSLIB.ORG

10Um 10Um 10Um

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
10Um 10Um 10Um 10um MGD X1 10um TGD X3 X2 10um Pl PPC Nm 500 nm a b 80 MGD Green algal 80 TGD Green algal Natural logarithm 70 of FPKM 70 7 6 60 5 60 4 3 2 1 50 0 50 -1 %GC for 1st codon position 40 40 30 30 0 20 40 60 80 100 0 20 40 60 80 100 %GC for 3rd codon position %GC for 3rd codon position 80 c d MGD Alveolate 80 TGD Alveolate 70 70 60 60 50 50 %GC for 1st codon position 40 40 30 30 0 20 40 60 80 100 0 20 40 60 80 100 %GC for 3rd codon position %GC for 3rd codon position TGD Low %GC High %GC 1 2 3 4 5 6 LHC HemA eIF4A PetE PetF PetC (bp) 1,000 800 600 400 200 MGD Low %GC High %GC 1 2 3 4 5 6 RNA RP-S1 PFK PetE PsaD PetC helicase (bp) 1,000 800 600 400 200 a MGD b TGD %GC for 1st codon position %GC for 3rd codon position %GC for 3rd codon position Green algal house-keeping transcript % c MGD G d TGD 室蘭株C 鶴岡株 f o r 1 pos iti ons o f codon s %GC for 1st codon position %GC for 3rd codon position %GC%GC for 3 forrd pos3rd codonitions position of codons Green algal photosynthesis related transcript Large subunit ribosomal protein L21 (plastid) >MGD_42250_c0_seq1 SignalP-4.1 prediction (euk networks): MGD_42250_c0_seq1 C-score 1.0 S-score Y-score MMRSIAALISFAYIASCAEQGDAQGSMNKLADKLADRVLN 0.8 VDPCTTDLENAVVAKGPGHLSSPTIQNRAPIMQPRGALSV 0.6 QSLARPVYCRSATEAAPWDAIIEVGGSQKIVETGRYYDTN Score 0.4 RLKGDLAPGTKVAFPRVLAVKKGAGEYTIGQPWVQGAKVE 0.2 AEVLENFKGKKVIVYKMRAKKHYRKKNGHRQLLTRFLVTN 0.0 VVKP M M R S I A A L I S F A Y I A S C A E Q G D A Q G S M N K L A D K L A D R V L N V D P C T T D L E N A V V A K G P G H L S S P T I Q N R A P 0 10 20 30 40 50 60 70 Position Tocopherol O-methyltransferase >MGD_65218_c0_seq1 SignalP-4.1 prediction (euk networks): MGD_65218_c0_seq1 C-score 1.0 S-score Y-score MSSLLLMIIFVFTISWQAYTVNPQSLQGYHVGDTIDSLDT 0.8 LADRLANRLFDRVFKTKAMSPCALFSPSIKRWPHLLKKKI 0.6 PESGGNKWIVRSSRTREELNSGIAEFYDESSALWEGMWGE Score 0.4 HMHHGYYPGGKFRSDHQQAQIDMVDRVLDWAGVADVKNFL 0.2 DVGCGIGGSSRHIARRYGFPRHKISEKIARRYGLPLGVTG 0.0 QGITLSPNQAARANQLSSEQGLGEKLLFRVADALNMPFTD M S S L L L M I I F V F T I S W Q A Y T V N P Q S L Q G Y H V G D T I D S L D T L A D R L A N R L F D R V F K T K A M S P C A L F S P S I K 0 10 20 30 40 50 60 70 GQFDLVWSLESGEHMPDKSQFLDELARVTAPGGK.... Position Glucose-6-phosphate dehydrogenase >MGD_149202_c0_seq1 SignalP-4.1 prediction (euk networks): MGD_149202_c0_seq1 C-score 1.0 S-score Y-score MSTSRMCRASLNFLICCVAHGHVTNHSQAGWVGGLVDEFA 0.8 GQLVSKLFDRALDAPPLQRAELQRSMLAKPSHVAIPSHTH 0.6 VPLVPLKAHAHSFYSSGALRYQPQQGKAILAQHMRVGQTV Score 0.4 QKSLGNWARQLQSTPSRYADQLQAVDPDFLPSLYGADEDL 0.2 TLVIIGASGDLARKKVFPAIFALYAQGLLPKSTHIVGYAR 0.0 TDLSRDEFIERISEKLMCRIDWDAPDCSDDMDKFLSLTDY M S T S R M C R A S L N F L I C C V A H G H V T N H S Q A G W V G G L V D E F A G Q L V S K L F D R A L D A P P L Q R A E L Q R S M L A K P 0 10 20 30 40 50 60 70 VSGQYDSEADFAKLDAFITQKEVERKAKASNRLF.... Position RED:Signal Peptide predicted by SignalP-4.1 BLUE:Putative mature protein region Photosystem II 13kDa protein (Psb28) >TGD_36373_c0_seq1 SignalP-4.1 prediction (euk networks): TGD_36373_c0_seq1 C-score 1.0 S-score Y-score MCCIRVAILLACIAQVSAKQTAADDAMDKLADRLVDKLAD 0.8 KLSDRLNQASSLHSADMDGTTLGKTSAIAAPQPRAVARAA 0.6 GVAPRMGMPFGMGAAGRVVQQRMPVLANAGASLQFIKGTD Score 0.4 EPDVPEVKLSKSRSSSMGQATFIFENPSVFDLEGPGKDDI 0.2 TGLYMVDDEGEMRTVDVQARFVNGKPAGIIAKYTMQNEAQ 0.0 WDRFMRFMERYAEANDLGFNKAK M C C I R V A I L L A C I A Q V S A K Q T A A D D A M D K L A D R L V D K L A D K L S D R L N Q A S S L H S A D M D G T T L G K T S A I A A 0 10 20 30 40 50 60 70 Position 4-alpha-glucanotransferase >TGD_140644_c0_seq2 SignalP-4.1 prediction (euk networks): TGD_140644_c0_seq2 C-score 1.0 S-score Y-score MLKAAYILLASVSCVDANELVVHDAAFAPAFIDTVVDRLV 0.8 DKLAKRTRSSDLGSTTLGKAVHVATRCRPGSQPCALSTSH 0.6 SMPAWPRTYHVARPMTVPRQTADFEKIFAGVSTKRSLPVV Score 0.4 QAQQAEVAKEAFKFDLKRRAGVLLPVSSLDGQGPIGNLDD 0.2 AERFVDWLAEAGMALWQILPLVPTDSAGSPYSSWSTLSGN 0.0 PDLVGLGGLVAAGLLDKEKTKLPLLTTVNYTVVAAQKRTL M L K A A Y I L L A S V S C V D A N E L V V H D A A F A P A F I D T V V D R L V D K L A K R T R S S D L G S T T L G K A V H V A T R C R P G 0 10 20 30 40 50 60 70 VLEAAQALLDRPDHPLRPALDKFVANAKWATDAA.... Position Nucleoside-diphosphate kinase >TGD_174950_c0_seq1 SignalP-4.1 prediction (euk networks): TGD_174950_c0_seq1 C-score 1.0 S-score Y-score MMSKVAAAVLFVVVAQTFAQQTAVSQYDLANKVADKLAAK 0.8 LLDRMEDANLDDTTLGALLQSSNMQLAGLSPSTQLAFSAG 0.6 PLRTPLAPSRIALNAWESDTCARRAVSAAAVAGVPRMCAA Score 0.4 KEVRALGLRKSQPTHVVQASASAERSYVMIKPDGVQRGLV 0.2 GEIISRFERKGFYLKGLKMFQTPEDLAKEHYKDLSEKPFF 0.0 GDLVEYICSGPVVCMVWEGKGVIKSARKLIGATNPLEAEP M M S K V A A A V L F V V V A Q T F A Q Q T A V S Q Y D L A N K V A D K L A A K L L D R M E D A N L D D T T L G A L L Q S S N M Q L A G L S 0 10 20 30 40 50 60 70 GTIRGDFAVETGRNVIHGSDSIENGEREIGIWF.... Position RED:Signal Peptide predicted by SignalP-4.1 BLUE:Putative mature protein region Synechococcus sp. CC9311 Cyanobacteria Prochlorococcus marinus Cyanophora paradoxa Glaucophyta 98 endosymbiont of Dinophysis norvegica Rhodomonas salina Cryptomonas paramecium Guillardia theta Aureococcus anophagefferens 94 Heterosigma akashiwo Ectocarpus siliculosus Odontella sinensis Kryptoperidinium foliaceum 99 100 98 Durinskia baltica Cyanidium caldarium & Chromera velia Cyanidioschyzon merolae Gracilaria tenuistipitata Rhodophyta Pyropia yezoensis 100 Porphyra purpurea Pavlova gyrans red alga-derived plastids Gyrodinium aureolum 100 Karenia brevis 94 Karlodinium veneficum Chrysochromulina polylepis Isochrysis sp. 98 Emiliania huxleyi Nephroselmis olivacea Monomastix sp. 86 Pyramimonas parkeae Mesostigma viride Chlorokybus atmophyticus Chara vulgaris Staurastrum punctulatum 96 82 Nicotiana tabacum 100 Oryza sativa Pycnococcus provasolii Picocystis salinarum Oocystis solitaria 100 Chlorella vulgaris Parachlorella kessleri 100 TGD Dinophyceae MGD 99 Lepidodinium chlorophorum NIES-1868 Pedinomonas sp. UTEX1026 Pedinomonas minor Pedinophyceae (Pedinomonadales) & Pedinomonas sp. M2079/1 89 Pedinomonas tuberculata Virideplantae Resultor mikron Marsupiomonas sp. NIES-1410 Pedinophyceae (Marsupinomonadales) Marsupiomonas pelliculata 100 Oltmannsiellopsis viridis green alga-derived plastids Acutodesmus obliquus Chlamydomonas reinhardtii 99 Oedogonium cardiacum Stigeoclonium helveticum Leptosira terrestris Bigelowiella natans Tetraselmis striata Bryopsis hypnoides Prasinophyceae sp. CCMP1205 Euglena gracilis Prasinococcus capsulatus Pterosperma cristatum Pseudendoclonium akinetum 100 Ostreococcus tauri Micromonas sp. 0.2 substitutions/site 0.4 substitutions/site Perkinsus_andrewsi Chromera velia Takayama acrotrocha Karlodinium australe 99 / 0.99 Karenia papilionacea Brachidinium capitatum Adenoides eludens Ensiculifera cf. loeblichii Scrippsiella sp. Chimonodinium lomnickii - / 0.93 Pseudopfiesteria shumwayae 95 / 0.90 Cryptoperidiniopsis brodyi 88 / 0.98 Pfiesteria piscicida - / 0.95 Gyrodinium lebouriae Pernambugia tuberosa Tintinnophagus acutus Duboscquodinium collinii Calciodinellum albatrosianum Leonella granifera Peridiniopsis borgei 1 Pentapharsodinium dalei Kryptoperidinium foliaceum Durinskia baltica Gloeodinium montanum Vulcanodinium rugosum Peridinium bipes f. occultatum - / 0.99 Archaeperidinium saanichi Protoperidinium monovelum Diplopsalis lenticula Diplopsalopsis bomba Rhinodinium broomense Amphidinium semilunatum Katodinium glaucum Akashiwo sanguinea Heterocapsa niei TGD MGD Cochlodinium fulvescens Peridinella catenata Peridiniella sp. Amphidoma languida Prorocentrum lima Lingulodinium polyedrum 86 / 0.99 Amylax triacantha Gonyaulax verior Metaphalacroma skogsbergii Nematodinium sp. 96 / 0.99 Warnowia sp. Lepidodinium chlorophorum Dissodinium pseudolunula Polykrikos lebourae 93 / 0.99 Spiniferodinium galeiforme Pheopolykrikos hartmannii Gymnodinium fuscum Gymnodinium catenatum Pyrodinium bahamense var. compressum 1 Thecadinium kofoidii Apicoporus glaber Baldinia anauniensis 100 / 0.96 Woloszynskia halophila Biecheleria cincta - / 0.98 Polarella glacialis 100 / 1 Pelagodinium beii Protodinium simplex Symbiodinium microadriaticum Borghiella dodgei Sphaerodinium cracoviense Histioneis milneri 100 / 0.99 Citharistes regius 99 / 0.99 Ornithocercus magnificus Dinophysis caudata Oxyphysis oxytoxoides 87 / 0.97 Phalacroma mitra Amphisolenia bidentata Jadwigia applanata Glenodiniopsis steinii Protoceratium reticulatum 0.1 Azadinium caudatum var. margalefii .
Load more

Recommended publications
  • Ultrastructure and Molecular Phylogenetic Position of a New Marine Sand-Dwelling Dinoflagellate from British Columbia, Canada: Pseudadenoides Polypyrenoides Sp
    European Journal of Phycology ISSN: 0967-0262 (Print) 1469-4433 (Online) Journal homepage: http://www.tandfonline.com/loi/tejp20 Ultrastructure and molecular phylogenetic position of a new marine sand-dwelling dinoflagellate from British Columbia, Canada: Pseudadenoides polypyrenoides sp. nov. (Dinophyceae) Mona Hoppenrath, Naoji Yubuki, Rowena Stern & Brian S. Leander To cite this article: Mona Hoppenrath, Naoji Yubuki, Rowena Stern & Brian S. Leander (2017) Ultrastructure and molecular phylogenetic position of a new marine sand-dwelling dinoflagellate from British Columbia, Canada: Pseudadenoides polypyrenoides sp. nov. (Dinophyceae), European Journal of Phycology, 52:2, 208-224, DOI: 10.1080/09670262.2016.1274788 To link to this article: http://dx.doi.org/10.1080/09670262.2016.1274788 View supplementary material Published online: 03 Mar 2017. Submit your article to this journal Article views: 25 View related articles View Crossmark data Full Terms & Conditions of access and use can be found at http://www.tandfonline.com/action/journalInformation?journalCode=tejp20 Download by: [The University of British Columbia] Date: 13 April 2017, At: 11:37 EUROPEAN JOURNAL OF PHYCOLOGY, 2017 VOL. 52, NO. 2, 208–224 http://dx.doi.org/10.1080/09670262.2016.1274788 Ultrastructure and molecular phylogenetic position of a new marine sand-dwelling dinoflagellate from British Columbia, Canada: Pseudadenoides polypyrenoides sp. nov. (Dinophyceae) Mona Hoppenratha,b, Naoji Yubukia,c, Rowena Sterna,d and Brian S. Leandera aDepartments of Botany and Zoology,
    [Show full text]
  • Presencia Del Género Karenia Y Nuevos Registros De Dinoflagelados (Dinoflagellata) En Aguas De Las Islas Canarias, Atlántico Centro-Oriental
    INFORME TÉCNICO nº15 INSTITUTO CANARIO DE CIENCIAS MARINAS Presencia del género Karenia y nuevos registros de dinoflagelados (Dinoflagellata) en aguas de las Islas Canarias, Atlántico Centro-Oriental - . '1 :=~:::::::::::= ~" Alicia Ojeda Créditos Edita: Instituto Canario de Ciencias Marinas Agencia Canaria de Investigación, Innovación y Sociedad de la Información Gobierno de Canarias Autora: Alicia Ojeda Rodríguez Diseño y maquetación: BlaBla Comunicación • www.blablacomunicacion.com Copyright © 2013 Alicia Ojeda Rodríguez - Instituto Canario de Ciencias Marinas (Gobierno de Canarias) Reservados todos los derechos. Queda rigurosamente prohibida la reproducción total o parcial de esta obra por cualquier medio o procedimiento, sin el permiso expreso y por escrito de los titulares de los derechos. Editado en febrero de 2013. Depósito Legal: GC 464-2013 ISSN: 1136-193X INFORME TÉCNICO nº15 INSTITUTO CANARIO DE CIENCIAS MARINAS Presencia del género Karenia y nuevos registros de dinoflagelados (Dinoflagellata) en aguas de las Islas Canarias, Atlántico Centro-Oriental Alicia Ojeda Presencia del género Karenia y nuevos registros de dinoflagelados (Dinoflagellata) en aguas de las Islas Canarias, Atlántico Centro-Oriental RESUMEN Se ilustran y describen 27 especies de dinoflagelados observados por primera vez en aguas superficiales neríticas y oceánicas de las Islas Canarias, Atlántico centro-oriental. Las especies descritas de Karenia, Ostreopsis y Prorocentrum revisten especial interés debido a su capacidad para sintetizar fuertes toxinas que durante periodos de floraciones algales pueden ocasionar importantes daños a la fauna marina y a la salud pública. Palabras clave: Dinoflagelados, Karenia, Ostreopsis, Prorocentrum, Islas Canarias, Atlántico centro-oriental. ABSTRACT 27 species of dinoflagellates from neritic and oceanic waters of the Canary Islands, Central- Eastern Atlantic Ocean are illustrated and described.
    [Show full text]
  • Brachidiniales, Dinophyceae) in the Open Mediterranean Sea
    Color profile: Disabled Composite 150 lpi at 45 degrees Acta Bot. Croat. 70 (2), 209–214, 2011 CODEN: ABCRA25 ISSN 0365-0588 eISSN 1847-8476 DOI: 10.2478/v10184-010-0019-0 Diversity and distribution of the dinoflagellates Brachidinium, Asterodinium and Microceratium (Brachidiniales, Dinophyceae) in the open Mediterranean Sea FERNANDO GÓMEZ* Instituto Cavanilles de Biodiversidad y Biología Evolutiva, Universidad de Valencia, PO Box 22085, 46071 Valencia, Spain Abstract – Brachidiniacean dinoflagellates have been investigated in the open waters of the Mediterranean Sea, along a transect from the south of France to the south of Cyprus (20 June–18 July 2008). Brachidinium and Karenia papilionacea often co-occurred, B. capitatum predominating in the surface waters. The highest abundance of Brachidinium were found in the upper 25 m in the western Mediterranean with a maximum (24 cells L–1) atadepthof5mintheBalearic Sea. Asterodinium (up to 4 cells L–1) was recorded below of deep chlorophyll maxima. The genus Microceratium, only known from the tropical Indo-Pacific region, is reported for the first time in the Mediterranean Sea. Microceratium was found below 100 m in the eastern Mediterranean Sea, with the highest abundance of 8 cells L–1 at 125 m depth, in the Levantine Basin. This study also illustrates for the first time specimens under the division of Brachidinium and Microceratium. This first occur- rence of Microceratium in the Mediterranean Sea should be considered an indicator of cli- mate warming. However, it should not be considered a non-indigenous taxon. Micro- ceratium is the 'tropical morphotype', the adaptation of a local species (a life stage of Karenia – Brachidinium – Asterodinium) to the tropical environmental conditions that prevail in summer in the open Mediterranean Sea.
    [Show full text]
  • Morphological Studies of the Dinoflagellate Karenia Papilionacea in Culture
    MORPHOLOGICAL STUDIES OF THE DINOFLAGELLATE KARENIA PAPILIONACEA IN CULTURE Michelle R. Stuart A Thesis Submitted to the University of North Carolina Wilmington in Partial Fulfillment of the Requirements for the Degree of Master of Science Department of Biology and Marine Biology University of North Carolina Wilmington 2011 Approved by Advisory Committee Alison R. Taylor Richard M. Dillaman Carmelo R. Tomas Chair Accepted by __________________________ Dean, Graduate School This thesis has been prepared in the style and format consistent with the journal Journal of Phycology ii TABLE OF CONTENTS ABSTRACT ................................................................................................................................... iv ACKNOWLEDGMENTS .............................................................................................................. v DEDICATION ............................................................................................................................... vi LIST OF TABLES ........................................................................................................................ vii LIST OF FIGURES ..................................................................................................................... viii INTRODUCTION .......................................................................................................................... 1 MATERIALS AND METHODS .................................................................................................... 5 RESULTS
    [Show full text]
  • Self-Study 2008-2015 Oceanography, College of Geosciences Texas A&M University Self-Study 2008-2015
    Self-Study 2008-2015 Oceanography, College of Geosciences Texas A&M University Self-Study 2008-2015 Executive Summary Welcome from the Department Chapter 1. Introduction to TAMU and TAMU Oceanography Chapter 2. The Mission and Goals of TAMU Oceanography Chapter 3. Evolution of the Department of Oceanography Since 2008 Chapter 4. Departmental Structure and Personnel Chapter 5. Department Resources Chapter 6. Contributions to University Research and Educational Excellence Chapter 7. Academic Programs and Curricula Chapter 8. Student Profile and Contributions Chapter 9. Concluding Observations Appendices Appendix 1: May 2014 Strategic Plan Appendix 2: Faculty Curriculum Vitae Appendix 3: Grants Awarded to the Ad-loc Faculty Appendix 4: Publications listed by year for the Ad-loc Faculty Appendix 5: Oceanography Courses Executive Summary The Department of Oceanography at Texas A&M University, founded in 1949 as the first oceanographic department established at an academic institution, is deeply committed to the unique mission of an AAU member institution with Land-, Sea-, and Space- grant status. With strengthened ties to other marine related units at the College Station and Galveston campuses, and significant investments from the University, we are poised to realize our strategic vision to join the nation’s top rank of institutions for oceanographic research and education at public universities. As part of our 2014 strategic planning effort, we have restructured our departmental educational, research and engagement activities into four interdisciplinary areas of strength: Ocean Observing Science and Technology, Marine Ecosystems Science and Health, Ocean Climate, and Ocean Energy. Observations, in a very broad sense, form the baseline for all of our strategic interdisciplinary themes, and are at the core of our vision to transform STEM education through a focus on big data competency.
    [Show full text]
  • To View Asset
    Marine Biotoxin Management Plan Victorian Shellfish Quality Assurance Program January 2004 Fisheries Victoria Management Report Series No.11 Marine Biotoxin Management Plan © The State of Victoria, Department of Primary This publication was prepared for Fisheries Industries, 2004 Victoria by WATER ECOscience Pty Ltd. This publication is copyright. No part may be Authorised by the Victorian Government, produced by any process except in accordance 6/232 Victoria Parade, East Melbourne with the provisions of the Copyright Act 1968. Published by the Department of Primary Reproduction and the making available of this Industries. material for personal, in‐house, or non‐ Fisheries Victoria commercial purposes is authorised on the PO Box 500 condition that: East Melbourne Victoria 3002. • The copyright is acknowledged as the owner; Copies are available from the website: • No official connection is claimed; www.dpi.vic.gov.au/fishing • The material is made available without charge Follow the links Managing Fisheries, or cost; and Management Plans and Strategies • The material is not subject to inaccurate, Disclaimer: This publication may be of assistance misleading or derogatory comment. to you, but the State of Victoria and its employees Requests to reproduce or communicate this do not guarantee that the publication is without material in any way not permitted by this licence flaw or is wholly appropriate for your particular (or by the fair dealing provisions of the Copyright purposes and therefore disclaims all liability for Act 1968) should be directed to the Copyright an error, loss or other consequence which may Officer, 6/320 Victoria Parade, East Melbourne, arise from you relying on any information in this 3002.
    [Show full text]
  • Is Karenia a Synonym of Asterodinium-Brachidinium (Gymnodiniales, Dinophyceae)?
    Acta Bot. Croat. 64 (2), 263–274, 2005 CODEN: ABCRA25 ISSN 0365–0588 Is Karenia a synonym of Asterodinium-Brachidinium (Gymnodiniales, Dinophyceae)? FERNANDO GÓMEZ1*, YUKIO NAGAHAMA2,HARUYOSHI TAKAYAMA3,KEN FURUYA2 1 Station Marine de Wimereux, Université des Sciences et Technologies de Lille, CNRS UMR 8013 ELICO, 28 avenue Foch, BP 80, F-62930 Wimereux, France. 2 Department of Aquatic Biosciences, University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo 113-8657, Japan. 3 Hiroshima Prefectural Fisheries and Marine Technology Center, Hatami 6-1-21, Ondo-cho, Kure Hiroshima 737-1205, Japan From material collected in open waters of the NW and Equatorial Pacific Ocean the de- tailed morphology of brachidiniaceans based on two specimens of Asterodinium gracile is reported for the first time. SEM observations showed that the straight apical groove, the morphological characters and orientation of the cell body were similar to those described for species of Karenia. Brachidinium and Asterodinium showed high morphological vari- ability in the length of the extensions and intermediate specimens with Karenia. Karenia-like cells that strongly resemble Brachidinium and Asterodinium but lacking the extensions co-occurred with the typical specimens. The life cycle and morphology of Karenia papilionacea should be investigated under natural conditions because of the strong simi- larity with the brachidiniaceans. Key words: Phytoplankton, Asterodinium, Brachidinium, Brachydinium, Gymnodinium, Karenia, Dinophyta, apical groove, SEM, Pacific Ocean. Introduction Fixatives, such as formaline or Lugol, do not sufficiently preserve unarmoured dino- flagellates to allow species identification. Body shape and morphology often change dur- ing the process of fixation so that even differentiating between the genera Gymnodinium Stein and Gyrodinium Kofoid et Swezy is difficult (ELBRÄCHTER 1979).
    [Show full text]
  • Guide Pour L'évaluation Des Risques D'introduction D'espèces Non
    Guide pour l’évaluation des risques d’introduction d’espèces non indigènes par les eaux de ballast Contacts : Océane RIGNAULT & Damien CHEVALLIER Ministère de l’Écologie, du Développement durable et de l’Énergie Direction générale des Infrastructures, des Transports et de la Mer Direction des Affaires maritimes/Sous-direction de la sécurité maritime Téléphone : 01 40 81 21 22 © Credit photo (couverture) : photo de fond : Blue-green algae at beach, Toxic algae bloom on Lake Erie in 2011 Tom Archer, handout Les quatres petites photos : Scanning electron microscope image of Vibrio cholerae bacteria, which infect the digestive system.Zeiss DSM 962 SEM ; Mnemiopsis leidyi (in the central Baltic Sea in January 2008), Jan-Erik Bruun, FIMR (Finnish Institute of Marine Research) ; Cyanobacteria, Josef Reischig / CC BY-SA 3.0 ; Lake-bottom-blanketing zebra mussel, Maria Antónia Sampayo. Remerciements aux contributeurs : Perrine Prigent, Chargée de missions à la Direction des affaires maritimes, Laurent Guérin pour le Muséum national d’histoire naturelle, Daniel Masson pour l’IFREMER, Frédéric Quemmerais pour l’Agence des aires marines protégées, la Direction de l’eau et de la biodiversité, la Direction des services de transports. Ministère de l’Écologie, du Développement durable et de l’Énergie Direction générale des Infrastructures, des Transports et de la Mer Direction des affaires maritimes Tour Séquoia - 92055 La Défense cedex Tél. : 01 40 81 21 22 européen écolabel certifié papier du sur Imprimé SG/SPSSI/ATL2. : Impression - Cudelou SG/SPSSI/ATL2/Benoît
    [Show full text]
  • (DOP) in the Dinoflagellate Peridinium Bipes by Physiological And
    Yang et al. Environ Sci Eur (2020) 32:38 https://doi.org/10.1186/s12302-020-00317-6 RESEARCH Open Access Unveiling the impact of glycerol phosphate (DOP) in the dinofagellate Peridinium bipes by physiological and transcriptomic analysis Yanjun Yang1, Junqiong Shi1, Yunlu Jia2, Fang Bai2, Songqi Yang1, Wenmei Mi1, Shuhan He1 and Zhongxing Wu1* Abstract Background: The ability to use dissolved organic phosphorus (DOP) is important for survival and competition when phytoplankton are faced with scarcity of dissolved inorganic phosphorus (DIP). However, phosphorus availability to the freshwater dinofagellate Peridinium bipes has received relatively little attention, the efciency of glycerol phos- phate use by phytoplankton has rarely been investigated, and the regulatory molecular mechanisms remain unclear. Result: In the present study, cultures of the freshwater dinofagellate Peridinium bipes were set up in 119 medium ( DIP), DIP-depleted 119 medium (P-free), and β-glycerol phosphate-replacing-DIP medium ( DOP). Gene expres- sion+ was analyzed using transcriptomic sequencing. The growth rate of cells in DOP treatment+ group was similar to that in DIP group, but chlorophyll a fuorescence parameters RC/CS0, ABS/CS0, TR0/CS0, ET0/CS0 and RE0/CS0 markedly decreased in the DOP group. Transcriptomic analysis revealed that genes involved in photosynthesis, including psbA, psbB, psbC, psbD, psaA and psaB, were downregulated in the DOP group relative to the DIP group. Glycerol-3-phos- phate dehydrogenase and glyceraldehyde-3-phosphate dehydrogenase, rather than alkaline phosphatase, were responsible for β-glycerol phosphate use. Intercellular gluconeogenesis metabolism was markedly changed in the DOP group. In addition, genes involved in ATP synthases, the TCA cycle, oxidative phosphorylation, fatty acid metabo- lism and amino acid metabolism in P.
    [Show full text]
  • Non-Native Marine Species in the Channel Islands: a Review and Assessment
    Non-native Marine Species in the Channel Islands - A Review and Assessment - Department of the Environment - 2017 - Non-native Marine Species in the Channel Islands: A Review and Assessment Copyright (C) 2017 States of Jersey Copyright (C) 2017 images and illustrations as credited All rights reserved. No part of this report may be reproduced, stored in a retrieval system, or transmitted, in any form or by any means, without the prior permission of the States of Jersey. A printed paperback copy of this report has been commercially published by the Société Jersiaise (ISBN 978 0 901897 13 8). To obtain a copy contact the Société Jersiaise or order via high street and online bookshops. Contents Preface 7 1 - Background 1.1 - Non-native Species: A Definition 11 1.2 - Methods of Introduction 12 1.4 - Threats Posed by Non-Native Species 17 1.5 - Management and Legislation 19 2 – Survey Area and Methodology 2.1 - Survey Area 23 2.2 - Information Sources: Channel Islands 26 2.3 - Information Sources: Regional 28 2.4 –Threat Assessment 29 3 - Results and Discussion 3.1 - Taxonomic Diversity 33 3.2 - Habitat Preference 36 3.3 – Date of First Observation 40 3.4 – Region of Origin 42 3.5 – Transport Vectors 44 3.6 - Threat Scores and Horizon Scanning 46 4 - Marine Non-native Animal Species 51 5 - Marine Non-native Plant Species 146 3 6 - Summary and Recommendations 6.1 - Hotspots and Hubs 199 6.2 - Data Coordination and Dissemination 201 6.3 - Monitoring and Reporting 202 6.4 - Economic, Social and Environmental Impact 204 6.5 - Conclusion 206 7 -
    [Show full text]
  • Brevetoxin-Producing Spherical Cells Present in Karenia Brevis Bloom: Evidence of Morphological Plasticity?
    Journal of Marine Science and Engineering Communication Brevetoxin-Producing Spherical Cells Present in Karenia brevis Bloom: Evidence of Morphological Plasticity? Lucie Novoveská *,† and Alison Robertson Department of Marine Sciences, University of South Alabama and Dauphin Island Sea Lab, 102 Bienville Blvd, Dauphin Island, AL 36528, USA; [email protected] * Correspondence: [email protected]; Tel: +44-752-124-8436 † Current address: Industrial Phycology, Unit 2 Axis, Hawkfield Business Park, Bristol BS14 0BY, UK. Received: 21 December 2018; Accepted: 18 January 2019; Published: 23 January 2019 Abstract: Spherical cells were detected in low salinity waters during a bloom of Karenia brevis in Alabama coastal waters. These balls resembled K. brevis in size and organelle appearance, contained similar concentration of brevetoxin, and occurred during ongoing K. brevis bloom. Based on the environmental conditions in which these cells were observed, we speculate that a rapid drop in salinity triggered the sphere formation in K. brevis. Brevetoxin concentrations were comparable between surface water samples containing typical and atypical cells ranging from 1 to 10 ng/mL brevetoxin-3 equivalents. Accurate identification and quantification of cell abundance in the water column is essential for routine monitoring of coastal waters, so misidentification of these spherical cells may result in significant underestimation of cell densities, and consequently, brevetoxin level. These potential discrepancies may negatively impact the quality of regulatory decisions and their impact on shellfish harvest area closures. We demonstrate that traditional monitoring based on microscopy alone is not sufficient for brevetoxin detection, and supporting toxin data is necessary to evaluate potential risk. Keywords: Karenia brevis; morphology; plasticity; sphere-shape cell; salinity; cryptic species; regulatory monitoring; shellfish harvest area Karenia brevis is a marine dinoflagellate which naturally produces a suite of neurotoxins known as brevetoxins.
    [Show full text]
  • Redalyc.Especies De Dinoflagelados Atecados (Dinophyta) De La Costa
    Revista de Biología Marina y Oceanografía ISSN: 0717-3326 [email protected] Universidad de Valparaíso Chile Maciel-Baltazar, Ebodio; Hernández-Becerril, David U. Especies de dinoflagelados atecados (Dinophyta) de la costa de Chiapas, sur del Pacífico mexicano Revista de Biología Marina y Oceanografía, vol. 48, núm. 2, agosto-, 2013, pp. 245-259 Universidad de Valparaíso Viña del Mar, Chile Disponible en: http://www.redalyc.org/articulo.oa?id=47928716005 Cómo citar el artículo Número completo Sistema de Información Científica Más información del artículo Red de Revistas Científicas de América Latina, el Caribe, España y Portugal Página de la revista en redalyc.org Proyecto académico sin fines de lucro, desarrollado bajo la iniciativa de acceso abierto Revista de Biología Marina y Oceanografía Vol. 48, Nº2: 245-259, agosto 2013 Artículo Especies de dinoflagelados atecados (Dinophyta) de la costa de Chiapas, sur del Pacífico mexicano Species of athecate dinoflagellates (Dinophyta) from coasts of Chiapas, southern Mexican Pacific Ebodio Maciel-Baltazar1 y David U. Hernández-Becerril2 1Laboratorio Estatal de Salud Pública, Instituto de Salud del Estado de Chiapas, Blvd. Salomón Gonzales Blanco 3452, Tuxtla Gutiérrez, 29040, Chiapas, México 2Instituto de Ciencias del Mar y Limnología, Universidad Nacional Autónoma de México, Apdo. postal 70-305, Ciudad Universitaria, Coyoacán, 04510, México, D.F., México. [email protected] Abstract.- Athecate dinoflagellates have been poorly studied in the plankton of Mexican marine waters, mainly because of their fragility, as they may become deformed using nets and strong fixatives. However, their biodiversity and ecological role might be important in the planktonic realm. As part of routine phytoplankton monitoring in the Chiapas coasts, Mexico, in the southern Mexican Pacific, samples were obtained during 2009 by net (20 μm mesh) in vertical hauls (up to 15 m), fixed with Lugol’s solution and studied by light microscope (bright field and phase contrast).
    [Show full text]