DOCSLIB.ORG

Product Datasheet: ARP61122 P050

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Product Datasheet: ARP61122 P050 Aviva Systems Biology STX7 antibody - N-terminal region (ARP61122_P050) Product Number ARP61122_P050 Product Page http://www.avivasysbio.com/stx7-antibody-n-terminal-region-arp61122-p050.html Product Name STX7 antibody - N-terminal region (ARP61122_P050) Size 100 ul Gene Symbol STX7 Alias Symbols - Protein Size (# AA) 261 amino acids Molecular Weight 30kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 8417 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Syntaxin 7 Name Description This is a rabbit polyclonal antibody against STX7. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS Description of STX7 may be involved in protein trafficking from the plasma membrane to the early Target endosome (EE) as well as in homotypic fusion of endocytic organelles. STX7 mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes. Protein Interactions STX4; ATP4A; UBL4A; UBC; SYNPO2; CHCHD4; MRPL53; SARNP; SUGP1; CDV3; SBDS; TIMM10B; RAB31; PPIF; SCO2; SNX3; SOD2; SCP2; RPS19; RBMS1; NDUFA7; SERPINH1; ELAVL1; MAPK6; NSF; VPS16; VPS11; SNAP29; VPS18; STX6; STX8; NAPA; VTI1B; VAMP8; ENTPD2; VAMP7; GTF2I; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-STX7 (ARP61122_P050) antibody is Catalog # AAP61122 (Previous Catalog # AAPP47283) Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human STX7 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Complete Anti-STX7 (ARP61122_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express STX7. Swissprot Id O15400 Protein Name Syntaxin-7 Sample Type STX7 is strongly supported by BioGPS gene expression data to be expressed in 721_B Confirmation Protein Accession NP_003560 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express STX7. Nucleotide NM_003569 Accession # Replacement Item This antibody may replace item sc-16790 from Santa Cruz Biotechnology. Conjugation ARP61122_P050-FITC Conjugated Options ARP61122_P050-HRP Conjugated ARP61122_P050-Biotin Conjugated CB Replacement sc-16790; sc-16792; sc-514017; sc-514156; sc-514157 Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish Application WB Predicted Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Homology Based Rabbit: 100%; Rat: 100%; Zebrafish: 86% on Immunogen Sequence Image 1: Human 721_B WB Suggested Anti-STX7 Antibody Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell STX7 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2.
Load more

Recommended publications
  • Vps8 Overexpression Inhibits HOPS- Dependent Trafficking Routes By
    RESEARCH ADVANCE Vps8 overexpression inhibits HOPS- dependent trafficking routes by outcompeting Vps41/Lt Pe´ ter Lo˝ rincz1,2*, Lili Anna Kene´ z1, Sarolta To´ th1, Vikto´ ria Kiss3,A´ gnes Varga1, Tama´ s Csizmadia1, Zso´ fia Simon-Vecsei1, Ga´ bor Juha´ sz1,3* 1Department of Anatomy, Cell and Developmental Biology, Eo¨ tvo¨ s Lora´nd University, Budapest, Hungary; 2Premium Postdoctoral Research Program, Hungarian Academy of Sciences, Budapest, Hungary; 3Institute of Genetics, Biological Research Centre, Hungarian Academy of Sciences, Szeged, Hungary Abstract Two related multisubunit tethering complexes promote endolysosomal trafficking in all eukaryotes: Rab5-binding CORVET that was suggested to transform into Rab7-binding HOPS. We have previously identified miniCORVET, containing Drosophila Vps8 and three shared core proteins, which are required for endosome maturation upstream of HOPS in highly endocytic cells (Lo˝rincz et al., 2016a). Here, we show that Vps8 overexpression inhibits HOPS-dependent trafficking routes including late endosome maturation, autophagosome-lysosome fusion, crinophagy and lysosome-related organelle formation. Mechanistically, Vps8 overexpression abolishes the late endosomal localization of HOPS-specific Vps41/Lt and prevents HOPS assembly. Proper ratio of Vps8 to Vps41 is thus critical because Vps8 negatively regulates HOPS by outcompeting Vps41. Endosomal recruitment of miniCORVET- or HOPS-specific subunits requires proper complex assembly, and Vps8/miniCORVET is dispensable for autophagy, crinophagy and lysosomal biogenesis. These data together indicate the recruitment of these complexes to target membranes independent of each other in Drosophila, rather than their transformation during *For correspondence: vesicle maturation. [email protected] (PL); DOI: https://doi.org/10.7554/eLife.45631.001 [email protected] (GJ) Competing interests: The authors declare that no competing interests exist.
    [Show full text]
  • New Approaches to Functional Process Discovery in HPV 16-Associated Cervical Cancer Cells by Gene Ontology
    Cancer Research and Treatment 2003;35(4):304-313 New Approaches to Functional Process Discovery in HPV 16-Associated Cervical Cancer Cells by Gene Ontology Yong-Wan Kim, Ph.D.1, Min-Je Suh, M.S.1, Jin-Sik Bae, M.S.1, Su Mi Bae, M.S.1, Joo Hee Yoon, M.D.2, Soo Young Hur, M.D.2, Jae Hoon Kim, M.D.2, Duck Young Ro, M.D.2, Joon Mo Lee, M.D.2, Sung Eun Namkoong, M.D.2, Chong Kook Kim, Ph.D.3 and Woong Shick Ahn, M.D.2 1Catholic Research Institutes of Medical Science, 2Department of Obstetrics and Gynecology, College of Medicine, The Catholic University of Korea, Seoul; 3College of Pharmacy, Seoul National University, Seoul, Korea Purpose: This study utilized both mRNA differential significant genes of unknown function affected by the display and the Gene Ontology (GO) analysis to char- HPV-16-derived pathway. The GO analysis suggested that acterize the multiple interactions of a number of genes the cervical cancer cells underwent repression of the with gene expression profiles involved in the HPV-16- cancer-specific cell adhesive properties. Also, genes induced cervical carcinogenesis. belonging to DNA metabolism, such as DNA repair and Materials and Methods: mRNA differential displays, replication, were strongly down-regulated, whereas sig- with HPV-16 positive cervical cancer cell line (SiHa), and nificant increases were shown in the protein degradation normal human keratinocyte cell line (HaCaT) as a con- and synthesis. trol, were used. Each human gene has several biological Conclusion: The GO analysis can overcome the com- functions in the Gene Ontology; therefore, several func- plexity of the gene expression profile of the HPV-16- tions of each gene were chosen to establish a powerful associated pathway, identify several cancer-specific cel- cervical carcinogenesis pathway.
    [Show full text]
  • Cell-Free Fusion of Bacteria-Containing Phagosomes with Endocytic Compartments
    Cell-free fusion of bacteria-containing phagosomes with endocytic compartments Ulrike Becken, Andreas Jeschke, Katharina Veltman1, and Albert Haas2 Cell Biology Institute, University of Bonn, Ulrich-Haberland-Strasse 61a, 53121 Bonn, Germany Edited by Reinhard Jahn, Max Planck Institute for Biophysical Chemistry, Goettingen, Germany, and accepted by the Editorial Board October 4, 2010 (received for review June 2, 2010) Uptake of microorganisms by professional phagocytic cells leads to duced fusion of SCPs with lysosomes compared to phagosomes formation of a new subcellular compartment, the phagosome, containing inert particles (10–12), others did not (13). Fusogeni- which matures by sequential fusion with early and late endocytic city of SCPs with other endocytic organelles in macrophages has compartments, resulting in oxidative and nonoxidative killing of been investigated little (10). the enclosed microbe. Few tools are available to study membrane To truly understand the (dys)function of phagosome matura- fusion between phagocytic and late endocytic compartments in tion at a molecular level, the fusion of endocytic with microbe- general and with pathogen-containing phagosomes in particular. containing phagocytic organelles ought to be investigated in We have developed and applied a fluorescence microscopy assay reconstituted systems, yet most published assays used bead- to study fusion of microbe-containing phagosomes with different- containing but not microbe-containing phagosomes (3, 5) and aged endocytic compartments in vitro. This revealed that fusion were limited to fusion of early phagosomes with early endocytic of phagosomes containing nonpathogenic Escherichia coli with organelles (14, 15). Fusion of lysosomes with microbe-containing lysosomes requires Rab7 and SNARE proteins but not organelle phagosomes has been reconstituted only in permeabilized macro- acidification.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Supplementary Materials
    1 Supplementary Materials: Supplemental Figure 1. Gene expression profiles of kidneys in the Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice. (A) A heat map of microarray data show the genes that significantly changed up to 2 fold compared between Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice (N=4 mice per group; p<0.05). Data show in log2 (sample/wild-type). 2 Supplemental Figure 2. Sting signaling is essential for immuno-phenotypes of the Fcgr2b-/-lupus mice. (A-C) Flow cytometry analysis of splenocytes isolated from wild-type, Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice at the age of 6-7 months (N= 13-14 per group). Data shown in the percentage of (A) CD4+ ICOS+ cells, (B) B220+ I-Ab+ cells and (C) CD138+ cells. Data show as mean ± SEM (*p < 0.05, **p<0.01 and ***p<0.001). 3 Supplemental Figure 3. Phenotypes of Sting activated dendritic cells. (A) Representative of western blot analysis from immunoprecipitation with Sting of Fcgr2b-/- mice (N= 4). The band was shown in STING protein of activated BMDC with DMXAA at 0, 3 and 6 hr. and phosphorylation of STING at Ser357. (B) Mass spectra of phosphorylation of STING at Ser357 of activated BMDC from Fcgr2b-/- mice after stimulated with DMXAA for 3 hour and followed by immunoprecipitation with STING. (C) Sting-activated BMDC were co-cultured with LYN inhibitor PP2 and analyzed by flow cytometry, which showed the mean fluorescence intensity (MFI) of IAb expressing DC (N = 3 mice per group). 4 Supplemental Table 1. Lists of up and down of regulated proteins Accession No.
    [Show full text]
  • UVRAG Is Required for Virus Entry Through Combinatorial Interaction with the Class C-Vps Complex and Snares
    UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs Sara Dolatshahi Pirooza, Shanshan Hea, Tian Zhanga, Xiaowei Zhanga, Zhen Zhaoa, Soohwan Oha, Douglas O’Connella, Payam Khalilzadeha, Samad Amini-Bavil-Olyaeea, Michael Farzanb, and Chengyu Lianga,1 aDepartment of Molecular Microbiology and Immunology, Keck School of Medicine, University of Southern California, Los Angeles, CA 90033; and bDepartment of Infectious Diseases, The Scripps Research Institute, Jupiter, FL 33458 Edited by Peter Palese, Icahn School of Medicine at Mount Sinai, New York, NY, and approved January 15, 2014 (received for review November 4, 2013) Enveloped viruses exploit the endomembrane system to enter host (R)-SNAREs embedded in the other (3). Specifically, syntaxin 7 cells. Through a cascade of membrane-trafficking events, virus-bearing (STX7; Qa), Vti1b (Qb), and STX8 (Qc) on the LE, when paired vesicles fuse with acidic endosomes and/or lysosomes mediated by with VAMP7 (R), mediate the LE fusion with the lysosome, but SNAREs triggering viral fusion. However, the molecular mechanisms when paired with VAMP8 (R), regulate homotypic fusion of the underlying this process remain elusive. Here, we found that UV- LEs (4). The upstream process regulating LE-associated SNARE radiation resistance-associated gene (UVRAG), an autophagic tumor pairing relies on the class C vacuolar protein sorting (Vps) complex suppressor, is required for the entry of the prototypic negative- (hereafter referred to as C-Vps), composed of Vps11, Vps16, strand RNA virus, including influenza A virus and vesicular stoma- Vps18, and Vps33 as core subunits (5, 6). A recent study indicated titis virus, by a mechanism independent of IFN and autophagy.
    [Show full text]
  • Supplementary Table 4
    Li et al. mir-30d in human cancer Table S4. The probe list down-regulated in MDA-MB-231 cells by mir-30d mimic transfection Gene Probe Gene symbol Description Row set 27758 8119801 ABCC10 ATP-binding cassette, sub-family C (CFTR/MRP), member 10 15497 8101675 ABCG2 ATP-binding cassette, sub-family G (WHITE), member 2 18536 8158725 ABL1 c-abl oncogene 1, receptor tyrosine kinase 21232 8058591 ACADL acyl-Coenzyme A dehydrogenase, long chain 12466 7936028 ACTR1A ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) 18102 8056005 ACVR1 activin A receptor, type I 20790 8115490 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 15688 7979904 ADAM21 ADAM metallopeptidase domain 21 14937 8054254 AFF3 AF4/FMR2 family, member 3 23560 8121277 AIM1 absent in melanoma 1 20209 7921434 AIM2 absent in melanoma 2 19272 8136336 AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) 18013 7954777 ALG10 asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) 30049 7954789 ALG10B asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog B (yeast) 28807 7962579 AMIGO2 adhesion molecule with Ig-like domain 2 5576 8112596 ANKRA2 ankyrin repeat, family A (RFXANK-like), 2 23414 7922121 ANKRD36BL1 ankyrin repeat domain 36B-like 1 (pseudogene) 29782 8098246 ANXA10 annexin A10 22609 8030470 AP2A1 adaptor-related protein complex 2, alpha 1 subunit 14426 8107421 AP3S1 adaptor-related protein complex 3, sigma 1 subunit 12042 8099760 ARAP2 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 30227 8059854 ARL4C ADP-ribosylation factor-like 4C 32785 8143766 ARP11 actin-related Arp11 6497 8052125 ASB3 ankyrin repeat and SOCS box-containing 3 24269 8128592 ATG5 ATG5 autophagy related 5 homolog (S.
    [Show full text]
  • Diversification of CORVET Tethers Facilitates Transport Complexity in Tetrahymena Thermophila Daniela Sparvoli1,*, Martin Zoltner2,3, Chao-Yin Cheng1, Mark C
    © 2020. Published by The Company of Biologists Ltd | Journal of Cell Science (2020) 133, jcs238659. doi:10.1242/jcs.238659 RESEARCH ARTICLE Diversification of CORVET tethers facilitates transport complexity in Tetrahymena thermophila Daniela Sparvoli1,*, Martin Zoltner2,3, Chao-Yin Cheng1, Mark C. Field2 and Aaron P. Turkewitz1,‡ ABSTRACT Key determinants for ensuring productive membrane interactions In endolysosomal networks, two hetero-hexameric tethers called are SNARE proteins, with distinct paralogs present at each HOPS and CORVET are found widely throughout eukaryotes. The compartment (Gerst, 1999). SNARE complex assembly drives unicellular ciliate Tetrahymena thermophila possesses elaborate formation of a fusion pore, together with complexes called tethers endolysosomal structures, but curiously both it and related protozoa that act upstream of SNAREs (Baker and Hughson, 2016). The lack the HOPS tether and several other trafficking proteins, while homotypic-fusion-and-protein-sorting (HOPS) and class-C-core- retaining the related CORVET complex. Here, we show that vacuole/endosome-tethering (CORVET) complexes are cytoplasmic Tetrahymena encodes multiple paralogs of most CORVET hetero-hexamers that bridge compartments by binding Rab GTPases at subunits, which assemble into six distinct complexes. Each two membranes, and subsequently chaperoning SNARE assembly complex has a unique subunit composition and, significantly, shows (Baker and Hughson, 2016; Horazdovsky et al., 1996; Nickerson unique localization, indicating participation
    [Show full text]
  • Variation in Protein Coding Genes Identifies Information
    bioRxiv preprint doi: https://doi.org/10.1101/679456; this version posted June 21, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Animal complexity and information flow 1 1 2 3 4 5 Variation in protein coding genes identifies information flow as a contributor to 6 animal complexity 7 8 Jack Dean, Daniela Lopes Cardoso and Colin Sharpe* 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 Institute of Biological and Biomedical Sciences 25 School of Biological Science 26 University of Portsmouth, 27 Portsmouth, UK 28 PO16 7YH 29 30 * Author for correspondence 31 [email protected] 32 33 Orcid numbers: 34 DLC: 0000-0003-2683-1745 35 CS: 0000-0002-5022-0840 36 37 38 39 40 41 42 43 44 45 46 47 48 49 Abstract bioRxiv preprint doi: https://doi.org/10.1101/679456; this version posted June 21, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Animal complexity and information flow 2 1 Across the metazoans there is a trend towards greater organismal complexity. How 2 complexity is generated, however, is uncertain. Since C.elegans and humans have 3 approximately the same number of genes, the explanation will depend on how genes are 4 used, rather than their absolute number.
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • ST Brochure LR
    ST•STX SERIES The most intelligent sound reinforcement system Working together, there’s no problem we can’t solve, no schedule we can’t meet, no project on the planet. we can’t take to a higher level of excellence, from the White House to the Olympic SuperDome, from corner churches to major metropolitan concert halls. Much as we love technology, our greatest satisfaction comes through helping people communicate through music, dance, theater, or the power of a new idea brilliantly expressed. When we make those kinds of connections, there’s nothing more exciting – or more powerful. Here are some of the unique technologies we use to help people communicate: Patented CoEntrant Topology integrates System Specific Electronics integrate pre- midrange and high frequency drivers into configured signal processing and protection wideband point sources. with high performance amplifiers. Complex Conic Topology, the first new The R-Control Remote System Supervision approach to horn design in decades, has Network is based on Echelon’s LonWorks® proven its superior performance worldwide. protocol (ANSI/EIA 709.1). TRAP (TRue Array Principle) design PowerNet Series loudspeakers incorporate aligns acoustic centers so loudspeaker System Specific Electronics and can be clusters produce coherent output. upgraded for R-Control remote operation. Reference Point Array engineering optimizes EASE, EASE JR and EARS are the industry the entire signal chain from line level to standard modeling programs for acoustic listener for unprecedented performance. environments and sound system performance. CobraNet routes 64 channels of 20-bit digital audio over CAT 5 copper or UTP optical fiber using Ethernet protocols For more information on the latest integrated sound reinforcement innovations from R-H Engineering, visit us on our website.
    [Show full text]
  • CORVET, CHEVI and HOPS – Multisubunit Tethers of the Endo
    © 2019. Published by The Company of Biologists Ltd | Journal of Cell Science (2019) 132, jcs189134. doi:10.1242/jcs.189134 REVIEW SUBJECT COLLECTION: CELL BIOLOGY AND DISEASE CORVET, CHEVI and HOPS – multisubunit tethers of the endo-lysosomal system in health and disease Jan van der Beek‡, Caspar Jonker*,‡, Reini van der Welle, Nalan Liv and Judith Klumperman§ ABSTRACT contact between two opposing membranes and pull them close Multisubunit tethering complexes (MTCs) are multitasking hubs that together to allow interactions between SNARE proteins (Murray form a link between membrane fusion, organelle motility and signaling. et al., 2016). SNARE assembly then provides additional fusion CORVET, CHEVI and HOPS are MTCs of the endo-lysosomal system. specificity and drives the actual fusion process (Ohya et al., 2009; They regulate the major membrane flows required for endocytosis, Stroupe et al., 2009). In this Review, we focus on the role of tethering lysosome biogenesis, autophagy and phagocytosis. In addition, proteins in endo-lysosomal fusion events. individual subunits control complex-independent transport of specific Tethering proteins can be divided into two main groups: long cargoes and exert functions beyond tethering, such as attachment to coiled-coil proteins (Gillingham and Munro, 2003) and microtubules and SNARE activation. Mutations in CHEVI subunits multisubunit tethering complexes (MTCs). MTCs form a lead to arthrogryposis, renal dysfunction and cholestasis (ARC) heterogenic group of protein complexes that consist of up to ten ∼ syndrome, while defects in CORVET and, particularly, HOPS are subunits resulting in a general length of 50 nm (Brocker et al., associated with neurodegeneration, pigmentation disorders, liver 2012; Chou et al., 2016; Hsu et al., 1998; Lürick et al., 2018; Ren malfunction and various forms of cancer.
    [Show full text]