Aviva Systems Biology STX7 antibody - N-terminal region (ARP61122_P050) Product Number ARP61122_P050 Product Page http://www.avivasysbio.com/stx7-antibody-n-terminal-region-arp61122-p050.html Product Name STX7 antibody - N-terminal region (ARP61122_P050) Size 100 ul Gene Symbol STX7 Alias Symbols - Protein Size (# AA) 261 amino acids Molecular Weight 30kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 8417 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Syntaxin 7 Name Description This is a rabbit polyclonal antibody against STX7. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS Description of STX7 may be involved in protein trafficking from the plasma membrane to the early Target endosome (EE) as well as in homotypic fusion of endocytic organelles. STX7 mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes. Protein Interactions STX4; ATP4A; UBL4A; UBC; SYNPO2; CHCHD4; MRPL53; SARNP; SUGP1; CDV3; SBDS; TIMM10B; RAB31; PPIF; SCO2; SNX3; SOD2; SCP2; RPS19; RBMS1; NDUFA7; SERPINH1; ELAVL1; MAPK6; NSF; VPS16; VPS11; SNAP29; VPS18; STX6; STX8; NAPA; VTI1B; VAMP8; ENTPD2; VAMP7; GTF2I; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-STX7 (ARP61122_P050) antibody is Catalog # AAP61122 (Previous Catalog # AAPP47283) Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human STX7 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Complete Anti-STX7 (ARP61122_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express STX7. Swissprot Id O15400 Protein Name Syntaxin-7 Sample Type STX7 is strongly supported by BioGPS gene expression data to be expressed in 721_B Confirmation Protein Accession NP_003560 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express STX7. Nucleotide NM_003569 Accession # Replacement Item This antibody may replace item sc-16790 from Santa Cruz Biotechnology. Conjugation ARP61122_P050-FITC Conjugated Options ARP61122_P050-HRP Conjugated ARP61122_P050-Biotin Conjugated CB Replacement sc-16790; sc-16792; sc-514017; sc-514156; sc-514157 Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish Application WB Predicted Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Homology Based Rabbit: 100%; Rat: 100%; Zebrafish: 86% on Immunogen Sequence Image 1: Human 721_B WB Suggested Anti-STX7 Antibody Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell STX7 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-