DOCSLIB.ORG

Platelet-Derived Growth Factor Receptor Alpha Signaling Pathways in Development and Liver Disease

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Platelet-Derived Growth Factor Receptor Alpha Signaling Pathways in Development and Liver Disease Platelet-derived growth factor receptor alpha signaling pathways in development and liver disease Brian J. Hayes A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Washington 2014 Reading Committee: Jean Campbell, Chair Daniel Bowen-Pope William Mahoney Jr. Program Authorized to Offer Degree: Pathology ©Copyright 2014 Brian J. Hayes University of Washington Abstract Platelet-derived growth factor receptor alpha signaling pathways in development and liver disease Brian J. Hayes Chair of the Supervisory Committee: Jean S. Campbell, Assistant Professor Department of Pathology Platelet derived growth factor receptor alpha (PDGFR α) signaling is critical for development and disease. Insufficient PDGFR α signal transduction results in developmental anomolies, while excessive signaling results in fibrosis and carcinogenesis. PDGFR α signal transduction is regulated at multiple levels, two of which are ligand binding and Pdgfr α expression levels. In my thesis work, I describe a Pdgfc mutant mouse, Pdgfc tm1Lex , in which only growth factor coding exons are deleted. Viability of Pdgfc tm1Lex mice, which express only the complement components C1r/C1s, sea urchin EGF, bone morphogenetic protein 1 (CUB) domain of PDGF- C, depends on the presence of both Pdgfr α alleles. Alternative splicing in Pdgfc tm1Lex mice gives rise to a truncated transcript that contains the entire coding region of the CUB domain of PDGF- C, but lacks the majority of the exons encoding the growth factor domain (GFD). Contrary to Pdgfc knockout (KO) mice, Pdgfc tm1Lex mice are viable, suggesting that the CUB domain of PDGF-C contributes to PDGFR α signal transduction. The CUB domain of PDGF-C appears to maintain PDGFR α signal transduction above the minimum level necessary for development. At the other end of the spectrum, increased PDGFR α signal transduction can contribute to disease. PDGFR α levels are elevated in human liver disease, and after acute and chronic liver injury in mice. These correlative studies indicate that PDGFR α may be important for the liver’s response to injury. Activated hepatic stellate cells (HSCs) produce collagen resulting in fibrosis, which can progress to liver cirrhosis. Cirrhosis is the 12 th leading cause of death in the United States, and increases the risk of developing liver cancer. Utilizing a chemical model of fibrosis, chronic carbon tetrachloride (CCl 4) exposure, I found that mice with decreased WT/nGFP expression of Pdgfr α (Pdgfr α ) develop less fibrosis, than wild type mice following CCl 4 exposure. These results indicate that elevated Pdgfr α expression is associated with chronic liver injury, and suggests excessive PDGFR α signal transduction is detrimental. PDGFR α signal transduction is controlled at the level of ligand binding and gene expression, and needs to be maintained at a balance that allows for proper development, but does not result in fibrotic disease. Therapies targeted to maintain the balance of PDGFR α–specific signaling pathways may provide both sufficient PDGFR α for wound healing and therapeutic benefit for patients with chronic liver disease. TABLE OF CONTENTS Page Table of contents......……...………………………………………………………....… i List of Abbreviations .……...………………………………………………………...... ii List of Figures ..……………………...………………………………………………… v List of Tables ..............…………………………………………………………...…… vii Chapter 1: Introduction 1.1 Summary……………………………………………………….…….....1 1.2 Liver disease……………………………………………………..….….1 1.3 Liver cell involvement in disease…………………………………..…2 1.4 Mouse models of chronic liver disease..…………………………....3 1.5 Platelet-derived growth factor ligands and receptors.…….…….…5 1.6 Hypothesis………………………………………………………..….…9 Chapter 2: Function of the CUB domain in PDGF-C knockout mice 2.1. Introduction ..…………………………………………………….. 13 2.2. Materials and Methods………………………………………….. 14 2.3. Results ..……………….…………………………………………. 18 2.4. Discussion ..…………………………………………………...…. 21 Chapter 3: Platelet derived growth factor receptor alpha contributes to liver fibrosis 3.1. Introduction ..…………………………………………………….. 30 3.2. Materials and Methods………………………………………….. 32 3.3. Results ..……………….…………………………………………..35 3.4. Discussion ..…………………………………………………...…. 39 Chapter 4: Conclusions and Future Directions 4.1. Major Findings ...……………………………………………..….58 i 4.2. Future Directions …………………………………………..……59 4.2. Discussion……… …………………………………………….…61 References ...……………………………………………………………………...…. 67 ii Abbreviations BrdU 5-Bromo-2-deoxyuridine BDL bile duct ligation BHK baby hamster kidney cells CCl 4 carbon tetrachloride CRBP-1 cellular retinol binding protein 1 CTGF connective tissue growth factor CUB C1r/C1s sea urchin EGF bone morphogenetic protein 1 ECM exracellular matrix EGF epidermal growth factor ET-1 endothelin 1 FGF fibroblast growth factor GFAP glial fibrillary acidic protein GFD growth factor domain GFP green fluorescent protein Grb2 growth factor receptor-bound protein 2 HCC hepatocellular carcinoma HSCs hepatic stellate cells IF immunofluorescence IHC immunohistochemistry KCs Kupffer cells LSECs liver sinusoidal endothelial cells NAFLD non-alcoholic fatty liver disease NPCs non-parenchymal cells OPC oligodendrocyte progenitor cell Ph Patch mutant mouse iii Abbreviations PDGF platelet derived growth factor PDGFR α platelet derived growth factor receptor alpha PDGFR β platelet derived growth factor receptor beta PI3K phosphoinositol 3-kinase PLC γ phospholipase gamma 1 RasGAP Ras GTPase activating protein TAA thioacetamide TGF β1 transforming growth factor beta WT wild type iv List of Figures Figure Number Page 1.1 Carbon tetrachloride mouse model of liver fibrosis..…………………………………….11 1.2 PDGF-C transgenic mouse model of liver fibrosis .……………………………………..11 1.3 PDGF-C transgenic mouse Kaplan-Meyer survival curve……………………………...12 1.4 PDGFR induced intracellular kinase phosphorylation…………………………………..13 2.1 Design of targeting constructs to inactivate PDGF-C…………………………………...25 2.2 Recombination at the Pdgfc locus in the Pdgfc tm1Lex mouse……………………………26 2.3 Alternative mRNA transcribed from the Pdgfc locus in Pdgfc tm1Lex mice……………...27 2.4 Sequence of cDNA from Pdgfc tm1Lex mice………………………………………………..28 3.1 Perisinusoidal PDGFR α expression is localized to fibrotic or cirrhotic areas in tumor specimens by IHC……………………………………………………………………………….44 3.2 PDGF receptors are expressed in hepatic stellate cell lines…………………………..45 3.3 PDGFR mRNA expression increases in response to acute CCl 4 exposure……….…46 WT/nGFP 3.4 PDGFR α positive cells form fibrotic bands after chronic CCl 4 injection in Pdgfr α mice………………………………………………………………………………………………47 3.5 PDGFR α-positive cells co-localize with PDGFR β-positive cells in chronic CCl 4 injured liver……………………………………………………………………………………………….48 WT/nGFP 3.6 Compared to C57BL/6 mice, chronically CCl 4 injured Pdgfr α mice have reduced transcription of fibrotic genes………………………………………………………………….49 3.7 Chronically injured Pdgfr αWT/nGFP mice have less collagen deposition than C57BL/6 mice …………………………………………………………………………………………………...50 3.8 Expression of PDGFRs in human liver tumor and non-tumor tissue………………...51 3.9 C57BL/6 HSCs express PDGFR α…………..…………………………………………..52 4.1. Amino acid sequence of wild type PDGFC and PDGF-Cmut………………….…….69 4.2. Hypothetical model of a monomer of wild type PDGFC and PDGF-Cmut…….…...69 v List of Figures Figure Number Page 4.3. Hypothetical model of a dimer of wild type PDGF-CC and PDGF-Cmut…………..70 4.4 PDGFR α Activity has a narrow range compatible with developmental viability……71 4.5 PDGFR α as the limiting PDGF pathway component in the liver environment……..72 vi List of Tables Table Number Page 2.1 Heterozygous Pdgfc tm1Lex breeding pairs in two backgrounds produce offspring with normal Mendelian distribution…………………………………………………………………………..29 2.2 Heterozygous Pdgfctm1Lex breeding pairs with one copy of Pdgfr α do not produce Pdgfctm1Lex homozygous and hemizygous Pdgfr α offspring.………….…………………30 3.1 Antibodies used for immunohistochemistry and immunofluorescence………………53 3.2 Human and mouse hepatocyte and stellate cells used in this study…………………54 3.3 Oligonucleotide primers used for real time analysis……………………………………55 3.4 Summary of PDGFR α and PDGFR β immunoreactivity in human liver specimens…56 3.5 Immunoblot detection of PDGFR expression in macroscopically dissected human tumors and surrounding liver…………………………………………………………………..57 3.6 PDGF stimulates proliferation in stellate cell lines, but not primary hepatocytes or hepatoma cell lines……………………………………………………………………………..58 vii Chapter 1 Background and Introduction Summary This chapter provides background information on 1) the public health burden of liver disease, 2) the functions of parenchymal and non-parenchymal liver cells, 3) mouse models of liver disease, and 4) signaling pathways and molecular components involved in the response to models of hepatotoxic injury and the development of liver fibrosis. A brief synopsis of my thesis project is presented at the end of this chapter. Liver disease Chronic liver injury leads to fibrosis, which can progress to cirrhosis and hepatocellular carcinoma (HCC). HCC is the most common type of liver cancer, and develops in cirrhotic liver in 90% of cases (1). The incidence and mortality from liver cancer are both increasing at a rate of around 3% a year (2); five year survival from time of diagnosis is only 16% (2, 3). Underlying cirrhosis in HCC prevents resection, thus the limited therapeutic options for these patients are in part due to the fact
Load more

Recommended publications
  • Structural and Functional Properties of Platelet-Derived Growth Factor and Stem Cell Factor Receptors
    Downloaded from http://cshperspectives.cshlp.org/ on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Structural and Functional Properties of Platelet-Derived Growth Factor and Stem Cell Factor Receptors Carl-Henrik Heldin and Johan Lennartsson Ludwig Institute for Cancer Research, Uppsala University, SE-751 24 Uppsala, Sweden Correspondence: [email protected] The receptors for platelet-derived growth factor (PDGF) and stem cell factor (SCF) are members of the type III class of PTK receptors, which are characterized by five Ig-like domains extracellularly and a split kinase domain intracellularly. The receptors are activated by ligand-induced dimerization, leading to autophosphorylation on specific tyrosine resi- dues. Thereby the kinase activities of the receptors are activated and docking sites for down- stream SH2 domain signal transduction molecules are created; activation of these pathways promotes cell growth, survival, and migration. These receptors mediate important signals during the embryonal development, and control tissue homeostasis in the adult. Their over- activity is seen in malignancies and other diseases involving excessive cell proliferation, such as atherosclerosis and fibrotic diseases. In cancer, mutations of PDGF and SCF receptors— including gene fusions, point mutations, and amplifications—drive subpopulations of cer- tain malignancies, such as gastrointestinal stromal tumors, chronic myelomonocytic leuke- mia, hypereosinophilic syndrome, glioblastoma, acute myeloid leukemia, mastocytosis, and melanoma. he type III tyrosine kinase receptor family with kinases, and a less well-conserved carboxy- Tconsists of platelet-derived growth factor terminal tail. The ligands for these receptors are (PDGF) receptor a and b, stem cell factor all dimeric molecules, and on binding they in- (SCF) receptor (Kit), colony-stimulating fac- duce receptor dimerization.
    [Show full text]
  • Identification of Novel Pathways That Promote Anoikis Through Genome-Wide Screens
    University of Massachusetts Medical School eScholarship@UMMS GSBS Dissertations and Theses Graduate School of Biomedical Sciences 2016-10-14 Identification of Novel Pathways that Promote Anoikis through Genome-wide Screens Victoria E. Pedanou University of Massachusetts Medical School Let us know how access to this document benefits ou.y Follow this and additional works at: https://escholarship.umassmed.edu/gsbs_diss Part of the Biology Commons, and the Cancer Biology Commons Repository Citation Pedanou VE. (2016). Identification of Novel Pathways that Promote Anoikis through Genome-wide Screens. GSBS Dissertations and Theses. https://doi.org/10.13028/M27G6D. Retrieved from https://escholarship.umassmed.edu/gsbs_diss/889 This material is brought to you by eScholarship@UMMS. It has been accepted for inclusion in GSBS Dissertations and Theses by an authorized administrator of eScholarship@UMMS. For more information, please contact [email protected]. i TITLE PAGE IDENTIFICATION OF NOVEL PATHWAYS THAT PROMOTE ANOIKIS THROUGH GENOME-WIDE SCREENS A Dissertation Presented By VICTORIA ELIZABETH PEDANOU Submitted to the Faculty of the University of Massachusetts Graduate School of Biomedical Sciences, Worcester in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY OCTOBER 14TH, 2016 CANCER BIOLOGY ii SIGNATURE PAGE IDENTIFICATION OF NOVEL PATHWAYS THAT PROMOTE ANOIKIS THROUGH GENOME-WIDE SCREENS A Dissertation Presented By VICTORIA ELIZABETH PEDANOU This work was undertaken in the Graduate School of Biomedical Sciences Cancer Biology The signature of the Thesis Advisor signifies validation of Dissertation content ___________________________ Michael R. Green, Thesis Advisor The signatures of the Dissertation Defense Committee signify completion and approval as to style and content of the Dissertation __________________________________ Eric H.
    [Show full text]
  • Role and Regulation of Pdgfra Signaling in Liver Development and Regeneration
    The American Journal of Pathology, Vol. 182, No. 5, May 2013 ajp.amjpathol.org GROWTH FACTORS, CYTOKINES, AND CELL CYCLE MOLECULES Role and Regulation of PDGFRa Signaling in Liver Development and Regeneration Prince K. Awuah,* Kari N. Nejak-Bowen,* and Satdarshan P.S. Monga*y From the Division of Experimental Pathology,* Department of Pathology, and the Department of Medicine,y University of Pittsburgh, Pittsburgh, Pennsylvania Accepted for publication January 22, 2013. Aberrant platelet-derived growth factor receptor-a (PDGFRa) signaling is evident in a subset of hepato- cellular cancers (HCCs). However, its role and regulation in hepatic physiology remains elusive. In the Address correspondence to a fi Satdarshan P.S. Monga, M.D., current study, we examined PDGFR signaling in liver development and regeneration. We identi ed a a Divisions of Experimental notable PDGFR activation in hepatic morphogenesis that, when interrupted by PDGFR -blocking anti- Pathology, Pathology and body, led to decreased hepatoblast proliferation and survival in embryonic liver cultures. We also identified Medicine, University of Pitts- temporal PDGFRa overexpression, which is regulated by epidermal growth factor (EGF) and tumor necrosis burgh School of Medicine, 200 factor a, and its activation at 3 to 24 hours after partial hepatectomy. Through generation of hepatocyte- Lothrop St., S-422 BST, Pitts- specific PDGFRA knockout (KO) mice that lack an overt phenotype, we show that absent PDGFRa burgh, PA 15261. E-mail: compromises extracelluar signal-regulated kinases and AKT activation 3 hours after partial hepatectomy, [email protected]. which, however, is alleviated by temporal compensatory increases in the EGF receptor (EGFR) and the hepatocyte growth factor receptor (Met) expression and activation along with rebound activation of extracellular signal-regulated kinases and AKT at 24 hours.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Type of the Paper (Article
    Table S1. Gene expression of pro-angiogenic factors in tumor lymph nodes of Ibtk+/+Eµ-myc and Ibtk+/-Eµ-myc mice. Fold p- Symbol Gene change value 0,007 Akt1 Thymoma viral proto-oncogene 1 1,8967 061 0,929 Ang Angiogenin, ribonuclease, RNase A family, 5 1,1159 481 0,000 Angpt1 Angiopoietin 1 4,3916 117 0,461 Angpt2 Angiopoietin 2 0,7478 625 0,258 Anpep Alanyl (membrane) aminopeptidase 1,1015 737 0,000 Bai1 Brain-specific angiogenesis inhibitor 1 4,0927 202 0,001 Ccl11 Chemokine (C-C motif) ligand 11 3,1381 149 0,000 Ccl2 Chemokine (C-C motif) ligand 2 2,8407 298 0,000 Cdh5 Cadherin 5 2,5849 744 0,000 Col18a1 Collagen, type XVIII, alpha 1 3,8568 388 0,003 Col4a3 Collagen, type IV, alpha 3 2,9031 327 0,000 Csf3 Colony stimulating factor 3 (granulocyte) 4,3332 258 0,693 Ctgf Connective tissue growth factor 1,0195 88 0,000 Cxcl1 Chemokine (C-X-C motif) ligand 1 2,67 21 0,067 Cxcl2 Chemokine (C-X-C motif) ligand 2 0,7507 631 0,000 Cxcl5 Chemokine (C-X-C motif) ligand 5 3,921 328 0,000 Edn1 Endothelin 1 3,9931 042 0,001 Efna1 Ephrin A1 1,6449 601 0,002 Efnb2 Ephrin B2 2,8858 042 0,000 Egf Epidermal growth factor 1,726 51 0,000 Eng Endoglin 0,2309 467 0,000 Epas1 Endothelial PAS domain protein 1 2,8421 764 0,000 Ephb4 Eph receptor B4 3,6334 035 V-erb-b2 erythroblastic leukemia viral oncogene homolog 2, 0,000 Erbb2 3,9377 neuro/glioblastoma derived oncogene homolog (avian) 024 0,000 F2 Coagulation factor II 3,8295 239 1 0,000 F3 Coagulation factor III 4,4195 293 0,002 Fgf1 Fibroblast growth factor 1 2,8198 748 0,000 Fgf2 Fibroblast growth factor
    [Show full text]
  • Single-Cell Transcriptome Sequencing of 18,787 Human Induced Pluripotent Stem Cells Identifies Differentially Primed Subpopulations
    Single-cell transcriptome sequencing of 18,787 human induced pluripotent stem cells identifies differentially primed subpopulations Quan H. Nguyen1*, Samuel W. Lukowski1*, Han Sheng Chiu1, Anne Senabouth1, Timothy J. C. Bruxner1, Angelika N. Christ1, Nathan J. Palpant1*, Joseph E. Powell1,2* 1 Institute for Molecular Bioscience, University of Queensland, Brisbane, Australia 2 Queensland Brain Institute, University of Queensland, Brisbane, Australia * These authors contributed equally Supplementary Figures and Tables Table S1. Summary statistics for sequencing and mapping data of five samples Mean Median Total Median Percent Remaining Number Total number reads per genes genes UMIs per mapped cells post of cells of reads cell per cell detected cell reads filtering Sample 1 2,779 71,256 3,662 20,356 17,769 198,022,303 62.6 2,426 Sample 2 545 318,909 4,547 18,557 27,341 173,805,798 63.4 424 Sample 3 3,103 56,459 2,944 19,261 11,214 175,193,813 71.8 2,906 Sample 4 9,192 38,637 2,016 21,491 5,963 355,158,219 68.9 8,294 Sample 5 4,863 26,471 2,804 20,235 10,150 128,728,889 67.2 4,737 1 Table S2. Summary of the cell and gene filtering process Procedure Count Cells removed by library size (outside 3 x MAD range)a 0 Cells removed by number detected genes (outside 3 x MAD range) 77 Cells removed by reads mapped to mitochondrial genes (outside 3 x MAD range) 1,559 Cells removed by reads mapped to ribosomal genes (outside 3 x MAD range) 102 Cells removed by reads mapped to mitochondrial genes (> 20 % total reads)b 0 Cells removed by reads mapped to ribosomal genes (> 50 % total reads) 0 Genes removed by number of expressed cells (< 1 % total cells)c 16,674 Remaining cells post filtering 18,787 Remaining genes post filtering 16,064 aMAD stands for median absolute deviation.
    [Show full text]
  • PDGF-C and PDGF-D Signaling in Vascular Diseases and Animal Models
    Molecular Aspects of Medicine 62 (2018) 1e11 Contents lists available at ScienceDirect Molecular Aspects of Medicine journal homepage: www.elsevier.com/locate/mam PDGF-C and PDGF-D signaling in vascular diseases and animal models * Erika Folestad a, Anne Kunath b, Dick Wågsater€ b, a Division of Vascular Biology, Department of Medical Biochemistry and Biophysics, Karolinska Institutet, Stockholm, Sweden b Division of Drug Research, Department of Medical and Health Sciences, Linkoping€ University, Linkoping,€ Sweden article info abstract Article history: Members of the platelet-derived growth factor (PDGF) family are well known to be involved in different Received 31 August 2017 pathological conditions. The cellular and molecular mechanisms induced by the PDGF signaling have Received in revised form been well studied. Nevertheless, there is much more to discover about their functions and some 14 November 2017 important questions to be answered. This review summarizes the known roles of two of the PDGFs, Accepted 22 January 2018 PDGF-C and PDGF-D, in vascular diseases. There are clear implications for these growth factors in several Available online 14 February 2018 vascular diseases, such as atherosclerosis and stroke. The PDGF receptors are broadly expressed in the cardiovascular system in cells such as fibroblasts, smooth muscle cells and pericytes. Altered expression Keywords: Aneurysm of the receptors and the ligands have been found in various cardiovascular diseases and current studies fi Atherosclerosis have shown important implications of PDGF-C and PDGF-D signaling in brosis, neovascularization, Growth factor atherosclerosis and restenosis. Myocardial infarction © 2018 The Authors. Published by Elsevier Ltd. This is an open access article under the CC BY-NC-ND Smooth muscle cells license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
    [Show full text]
  • PDGFRA in Vascular Adventitial Mscs Promotes Neointima Formation in Arteriovenous Fistula in Chronic Kidney Disease
    RESEARCH ARTICLE PDGFRA in vascular adventitial MSCs promotes neointima formation in arteriovenous fistula in chronic kidney disease Ke Song,1,2 Ying Qing,2 Qunying Guo,2 Eric K. Peden,3 Changyi Chen,4 William E. Mitch,2 Luan Truong,5 and Jizhong Cheng2 1Department of Stomatology, Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan, China. 2Selzman Institute for Kidney Health, Section of Nephrology, Department of Medicine, Baylor College of Medicine, Houston, Texas, USA. 3Department of Vascular Surgery, DeBakey Heart and Vascular Institute, Houston Methodist Hospital, Houston, Texas, USA. 4Michael E. DeBakey Department of Surgery, Baylor College of Medicine, Houston, Texas, USA. 5Department of Pathology and Genomic Medicine, Houston Methodist Hospital, Houston, Texas, USA. Chronic kidney disease (CKD) induces the failure of arteriovenous fistulas (AVFs) and promotes the differentiation of vascular adventitial GLI1-positive mesenchymal stem cells (GMCs). However, the roles of GMCs in forming neointima in AVFs remain unknown. GMCs isolated from CKD mice showed increased potential capacity of differentiation into myofibroblast-like cells. Increased activation of expression of PDGFRA and hedgehog (HH) signaling were detected in adventitial cells of AVFs from patients with end-stage kidney disease and CKD mice. PDGFRA was translocated and accumulated in early endosome when sonic hedgehog was overexpressed. In endosome, PDGFRA-mediated activation of TGFB1/SMAD signaling promoted the differentiation of GMCs into myofibroblasts, extracellular matrix deposition, and vascular fibrosis. These responses resulted in neointima formation and AVF failure. KO of Pdgfra or inhibition of HH signaling in GMCs suppressed the differentiation of GMCs into myofibroblasts. In vivo, specific KO of Pdgfra inhibited GMC activation and vascular fibrosis, resulting in suppression of neointima formation and improvement of AVF patency despite CKD.
    [Show full text]
  • Ep 3217179 A1
    (19) TZZ¥ ___T (11) EP 3 217 179 A1 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 13.09.2017 Bulletin 2017/37 G01N 33/68 (2006.01) (21) Application number: 17167637.2 (22) Date of filing: 02.10.2013 (84) Designated Contracting States: • LIU, Xinjun AL AT BE BG CH CY CZ DE DK EE ES FI FR GB San Diego, CA 92130 (US) GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO • HAUENSTEIN, Scott PL PT RO RS SE SI SK SM TR San Diego, CA 92130 (US) • KIRKLAND, Richard (30) Priority: 05.10.2012 US 201261710491 P San Diego, CA 92111 (US) 17.05.2013 US 201361824959 P (74) Representative: Krishnan, Sri (62) Document number(s) of the earlier application(s) in Nestec S.A. accordance with Art. 76 EPC: Centre de Recherche Nestlé 13779638.9 / 2 904 405 Vers-chez-les-Blanc Case Postale 44 (71) Applicant: Nestec S.A. 1000 Lausanne 26 (CH) 1800 Vevey (CH) Remarks: (72) Inventors: This application was filed on 21-04-2017 as a • SINGH, Sharat divisional application to the application mentioned Rancho Santa Fe, CA 92127 (US) under INID code 62. (54) METHODS FOR PREDICTING AND MONITORING MUCOSAL HEALING (57) The present invention provides methods for pre- an individual with a disease such as IBD. Information on dicting the likelihood of mucosal healing in an individual mucosal healing status derived from the use of the with a disease such as inflammatory bowel disease present invention can also aid in optimizing therapy (IBD).
    [Show full text]
  • Regulation of PDGFC Signalling and Extracellular Matrix Composition by FREM1 in Mice
    RESEARCH ARTICLE Disease Models & Mechanisms 6, 1426-1433 (2013) doi:10.1242/dmm.013748 Regulation of PDGFC signalling and extracellular matrix composition by FREM1 in mice Fenny Wiradjaja1, Denny L. Cottle1, Lynelle Jones1 and Ian Smyth1,2,* SUMMARY Fras1-related extracellular matrix protein 1 (FREM1) is required for epidermal adhesion during embryogenesis, and mice lacking the gene develop fetal skin blisters and a range of other developmental defects. Mutations in members of the FRAS/FREM gene family cause diseases of the Fraser syndrome spectrum. Embryonic epidermal blistering is also observed in mice lacking PdgfC and its receptor, PDGFRα. In this article, we show that FREM1 binds to PDGFC and that this interaction regulates signalling downstream of PDGFRα. Fibroblasts from Frem1-mutant mice respond to PDGFC stimulation, but with a shorter duration and amplitude than do wild-type cells. Significantly, PDGFC-stimulated expression of the metalloproteinase inhibitor Timp1 is reduced in cells with Frem1 mutations, leading to reduced basement membrane collagen I deposition. These results show that the physical interaction of FREM1 with PDGFC can regulate remodelling of the extracellular matrix downstream of PDGFRα. We propose that loss of FREM1 function promotes epidermal blistering in Fraser syndrome as a consequence of reduced PDGFC activity, in addition to its stabilising role in the basement membrane. DMM INTRODUCTION The FRAS/FREM family of proteins share characteristic The FRAS/FREM extracellular matrix (ECM) proteins (FRAS1, chondroitin sulphate proteoglycan (CSPG) core repeats similar FREM1 and FREM2) mediate adhesion between the epidermal to those found in the NG2 proteoglycan (Stallcup, 2002). In this basement membrane and the underlying dermis during embryonic protein, they directly bind platelet-derived growth factor A development (reviewed in Short et al., 2007; Petrou et al., 2008).
    [Show full text]
  • PDGFC (Human) Recombinant Protein
    PDGFC (Human) Recombinant pH 3.0. protein Storage Instruction: Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 Catalog Number: P6130 mg/mL. Do not vortex. Regulation Status: For research use only (RUO) For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% Product Description: Human PDGFC (Q9NRA1) partial BSA) and store in working aliquots at -20°C to -80°C. recombinant protein expressed in Escherichia coli. Entrez GeneID: 56034 Sequence: MVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFW Gene Symbol: PDGFC PGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHE Gene Alias: FALLOTEIN, SCDGF VLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTG G Gene Summary: The protein encoded by this gene is a member of the platelet-derived growth factor family. The Host: Escherichia coli four members of this family are mitogenic factors for Theoretical MW (kDa): 25.0 cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears Reactivity: Human to form only homodimers. It differs from the platelet-derived growth factor alpha and beta Applications: Func, SDS-PAGE polypeptides in having an unusual N-terminal domain, (See our web site product page for detailed applications the CUB domain. [provided by RefSeq] information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Lyophilized Preparation Method: Escherichia coli expression system Purity: 98% Endotoxin Level: Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug). Activity: Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The expected The ED50 for this effect is 15-20 ng/mL.
    [Show full text]
  • WO 2014/054013 Al 10 April 2014 (10.04.2014) P O P C T
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2014/054013 Al 10 April 2014 (10.04.2014) P O P C T (51) International Patent Classification: (81) Designated States (unless otherwise indicated, for every G01N 33/68 (2006.01) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, (21) International Application Number: BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, PCT/IB2013/059077 DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, (22) International Filing Date: HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KN, KP, KR, 2 October 2013 (02. 10.2013) KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, (25) Filing Language: English OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, (26) Publication Language: English SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, (30) Priority Data: ZW. 61/710,491 5 October 2012 (05. 10.2012) 61/824,959 17 May 2013 (17.05.2013) (84) Designated States (unless otherwise indicated, for every kind of regional protection available): ARIPO (BW, GH, (71) Applicant: NESTEC S.A. [CH/CH]; Ave. Nestle 55, CH- GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, SZ, TZ, 1800 Vevey (CH).
    [Show full text]