(GSTZ1) Rabbit Polyclonal Antibody – TA330970

Total Page：16

File Type：pdf, Size：1020Kb

(GSTZ1) Rabbit Polyclonal Antibody – TA330970

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA330970 Glutathione Transferase zeta 1 (GSTZ1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-GSTZ1 antibody: synthetic peptide directed towards the N terminal of human GSTZ1. Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Protein A purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 24 kDa Gene Name: glutathione S-transferase zeta 1 Database Link: NP_665877 Entrez Gene 2954 Human O43708 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 Glutathione Transferase zeta 1 (GSTZ1) Rabbit Polyclonal Antibody – TA330970 Background: GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia.This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. Synonyms: GSTZ1-1; MAAI; MAI Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 86%; Goat: 77% Protein Families: Druggable Genome Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Tyrosine metabolism Product images: WB Suggested Anti-GSTZ1 Antibody Titration: 2.5ug/ml; Positive Control: HepG2 cell lysate This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

Copy Link

Recommended publications

GSTZ1 Deficiency Promotes Hepatocellular Carcinoma
Li et al. Journal of Experimental & Clinical Cancer Research (2019) 38:438 https://doi.org/10.1186/s13046-019-1459-6 RESEARCH Open Access GSTZ1 deficiency promotes hepatocellular carcinoma proliferation via activation of the KEAP1/NRF2 pathway Jingjing Li1,2†, Qiujie Wang1†, Yi Yang1, Chong Lei1, Fan Yang1, Li Liang1, Chang Chen3, Jie Xia1, Kai Wang1* and Ni Tang1* Abstract Background: Glutathione S-transferase zeta 1 (GSTZ1) is the penultimate enzyme in phenylalanine/tyrosine catabolism. GSTZ1 is dysregulated in cancers; however, its role in tumorigenesis and progression of hepatocellular carcinoma (HCC) is largely unknown. We aimed to assess the role of GSTZ1 in HCC and to reveal the underlying mechanisms, which may contribute to finding a potential therapeutic strategy against HCC. Methods: We first analyzed GSTZ1 expression levels in paired human HCC and adjacent normal tissue specimens and the prognostic effect of GSTZ1 on HCC patients. Thereafter, we evaluated the role of GSTZ1 in aerobic glycolysis in HCC cells on the basis of the oxygen consumption rate (OCR) and extracellular acidification rate (ECAR). Furthermore, we assessed the effect of GSTZ1 on HCC proliferation, glutathione (GSH) concentration, levels of reactive oxygen species (ROS), and nuclear factor erythroid 2-related factor 2 (NRF2) signaling via gain- and loss- of GSTZ1 function in vitro. Moreover, we investigated the effect of GSTZ1 on diethylnitrosamine (DEN) and carbon tetrachloride (CCl4)induced hepatocarcinogenesis in a mouse model of HCC. Results: GSTZ1 was downregulated in HCC, thus indicating a poor prognosis. GSTZ1 deficiency significantly promoted hepatoma cell proliferation and aerobic glycolysis in HCC cells. Moreover, loss of GSTZ1 function depleted GSH, increased ROS levels, and enhanced lipid peroxidation, thus activating the NRF2-mediated antioxidant pathway.
[Show full text]
Age-Related Changes in Mirna Expression Influence GSTZ1 and Other Drug Metabolizing Enzymes S
Supplemental material to this article can be found at: http://dmd.aspetjournals.org/content/suppl/2020/04/30/dmd.120.090639.DC1 1521-009X/48/7/563–569$35.00 https://doi.org/10.1124/dmd.120.090639 DRUG METABOLISM AND DISPOSITION Drug Metab Dispos 48:563–569, July 2020 Copyright ª 2020 by The American Society for Pharmacology and Experimental Therapeutics Age-Related Changes in miRNA Expression Influence GSTZ1 and Other Drug Metabolizing Enzymes s Stephan C. Jahn, Lauren A. Gay, Claire J. Weaver, Rolf Renne, Taimour Y. Langaee,Department of Pharmacotherapy and Translational Research. Peter W. Stacpoole, and Margaret O. James Departments of Medicinal Chemistry (S.C.J., C.J.W., M.O.J.), Pharmacotherapy and Translational Research (T.Y.L.), Medicine (P.W.S.), Biochemistry and Molecular Biology (P.W.S.), and Molecular Genetics and Microbiology (L.A.G., R.R.), University of Florida, Gainesville, Florida Received January 1, 2020; accepted April 7, 2020 ABSTRACT Previous work has shown that hepatic levels of human glutathione miR-376c-3p could downregulate GSTZ1 protein expression. Our Downloaded from transferase zeta 1 (GSTZ1) protein, involved in tyrosine catabolism findings suggest that miR-376c-3p prevents production of GSTZ1 and responsible for metabolism of the investigational drug dichlor- through inhibition of translation. These experiments further our oacetate, increase in cytosol after birth before reaching a plateau understanding of GSTZ1 regulation. Furthermore, our array results around age 7. However, the mechanism regulating this change of provide a database resource for future studies on mechanisms expression is still unknown, and previous studies showed that regulating human hepatic developmental expression.
[Show full text]
9 Glutathione S-Transferases
Enzyme Systems that Metabolise Drugs and Other Xenobiotics. Edited by Costas Ioannides Copyright # 2001 John Wiley & Sons Ltd ISBNs: 0-471-894-66-4 %Hardback); 0-470-84630-5 %Electronic) 9 Glutathione S-transferases Philip J. Sherratt and John D. Hayes University of Dundee, UK Introduction Glutathione S-transferase GST; EC 2.5.1.18) isoenzymes are ubiquitously distributed in nature, being found in organisms as diverse as microbes, insects, plants, ®sh, birds andmammals Hayes andPulford1995). The transferases possess various activities andparticipate in several differenttypes of reaction. Most of these enzymes can catalyse the conjugation of reduced glutathione GSH) with compounds that contain an electrophilic centre through the formation of a thioether bondbetween the sulphur atom of GSH and the substrate Chasseaud 1979; Mannervik 1985). In addition to conjugation reactions, a number of GST isoenzymes exhibit other GSH-dependent catalytic activities including the reduction of organic hydroperoxides Ketterer et al. 1990) andisomerisation of various unsaturatedcompoundsBenson et al. 1977; Jakoby andHabig 1980). These enzymes also have several non-catalytic functions that relate to the sequestering of carcinogens, intracellular transport of a wide spectrum of hydrophobic ligands, and modulation of signal transduction pathways Listowsky 1993; Adler et al. 1999; Cho et al. 2001). Glutathione S-transferases represent a complex grouping of proteins. Two entirely distinct superfamilies of enzyme have evolved that possess transferase activity Hayes andStrange 2000). The ®rst enzymes to be characterisedwere the cytosolic, or soluble, GSTs BoylandandChasseaud1969; Mannervik 1985). To dateat least 16 members of this superfamily have been identi®ed in humans Board et al. 1997, 2000; Hayes and Strange 2000).
[Show full text]
Dmd.120.000143.Full.Pdf
DMD Fast Forward. Published on September 1, 2020 as DOI: 10.1124/dmd.120.000143 This article has not been copyedited and formatted. The final version may differ from this version. Drug Metabolism and Disposition Exposure of Rats to Multiple Oral Doses of Dichloroacetate Results in Upregulation of Hepatic GSTs and NQO1 Edwin J. Squirewell, Ricky Mareus, Lloyd P. Horne, Peter W. Stacpoole, and Margaret O. James Downloaded from Department of Medicinal Chemistry (E.J.S., R.M., M.O.J.), Department of Medicine (L.P.H., P.W.S.), and Department of Biochemistry and Molecular Biology (P.W.S.), University of Florida, Gainesville FL dmd.aspetjournals.org at ASPET Journals on October 1, 2021 1 DMD Fast Forward. Published on September 1, 2020 as DOI: 10.1124/dmd.120.000143 This article has not been copyedited and formatted. The final version may differ from this version. Running title: Repeated DCA dosing in Rats Increases Hepatic GSTs and NQO1 Address correspondence to: Dr. Margaret O. James, Department of Medicinal Chemistry, University of Florida College of Pharmacy, 1345 Center Drive, Gainesville, FL 32610. Tel: 352-273-7707. Email: [email protected] Downloaded from Number of text pages: 16 Number of tables: 3 Number of figures: 3 dmd.aspetjournals.org Number of references: 77 Number of words in the Abstract: 250 Number of words in Introduction: 657 at ASPET Journals on October 1, 2021 Number of words in Discussion: 1512 Abbreviations: DCA, dichloroacetate; DCPIP, 2,6-dichlorophenolindophenol; DCNB, 1,2-dichloro-4- nitrobenzene; CDNB, 1-chloro-2,4-dinitrobenzene, NQO1, NAD(P)H dehydrogenase [quinone] 1; NBD-Cl, 7-chloro-4-nitrobenzo-2-oxa-1,3-diazole; GCLC, glutamylcysteine ligase complex; GSS, glutathione synthetase; GSH, glutathione; GSTZ1, glutathione transferase zeta 1; MAAI, maleylacetoacetate isomerase; PDK, pyruvate dehydrogenase kinase; PDC, pyruvate dehydrogenase complex; ROS, reactive oxygen species; S.D., standard deviation.
[Show full text]
Disruption of GSTZ1 Gene by Large Genetic Alteration in Oryza Glaberrima
Breeding Science 54 : 67-73 (2004) Disruption of GSTZ1 Gene by Large Genetic Alteration in Oryza glaberrima Tokuji Tsuchiya and Ikuo Nakamura* Graduate School of Science and Technology, Chiba University, 648 Matsudo, Matsudo, Chiba 271-8510, Japan After the completion of the genome sequencing project Introduction of common rice (Oryza sativa L.), comparative genomic studies between rice and related species became impor- Glutathione S-transferases (GSTs; EC 2.5.1.18) are tant to reveal the function of each gene. The rice ge- ubiquitous and abundant detoxifying enzymes in all the organ- nome contains two copies of the gene encoding zeta class isms, such as bacteria, fungi, animals and plants. Recently, glutathione S-transferase (GSTZ) that is reported to be plant GSTs have been classified into four different classes, the enzyme in the catabolic pathway of tyrosine and phi, tau, theta and zeta, based on amino acid sequence simi- phenylalanine. Two GSTZ genes of O. sativa, OsGSTZ1 larity and gene structure (Dixon et al. 1998, Edward et al. and OsGSTZ2, display a tandem arrangement. Up- 2000). The phi and tau GST genes are plant-specific and com- stream OsGSTZ1 gene is constitutively expressed, pose large multi-gene families, whereas the theta and zeta whereas the downstream OsGSTZ2 gene is inducible by GST genes have a few copies. The zeta class GST (GSTZ) stresses. We analyzed the expression of the GSTZ gene genes are present as one or two copies in every plant genome in the African cultivated species O. glaberrima and wild studied, such as A. thaliana, maize, soybean, carnation and species O.
[Show full text]
A Thesis Entitled Identification and Characterization of a Zebrafish
A Thesis Entitled Identification and Characterization of A Zebrafish Glutathione S-Transferase Pi By Maryam S Abunnaja Submitted to the Graduate Faculty as a Partial Fulfillment of the Requirement for the Master of Science Degree in Pharmacology and Toxicology Dr. Ming-Cheh Liu, Committee Chair Dr. Ezdihar Hassoun, Committee Member Dr. Zahoor Shah, Committee Member Dr. Patricia Komuniecki, Dean College Graduate Studies The University of Toledo May 2013 Copyright 2013, Maryam S Abunnaja This document is copyrighted material. Under copyright law, no parts of this document may be reproduced without the expressed permission of the author. An Abstract of Identification and Characterization of A Zebrafish Glutathione S-Transferase Pi By Maryam S Abunnaja Submitted to the Graduate Faculty as a Partial Fulfillment of the Requirement for the Master of Science Degree in Pharmacology and Toxicology May 2013 Glutathione S-transferases (GSTs) are a major group of Phase II enzymes involved in the detoxification of certain endogenous compounds such as reactive oxygen species (ROS) generated during metabolism, as well as in the detoxification of xenobiotics including drugs. In recent years, the zebrafish has increasingly been used as a promising animal model for biomedical research. This study is part of an effort to establish the zebrafish as a model for studying GST-mediated glutathione conjugation of xenobiotics. By searching the GenBank database, we have identified sequences encoding fifteen zebrafish GSTs. Using a computer algorithm available at the Genebee website, a dendrogram of the fifteen zebrafish GSTs was generated. A zebrafish GST Pi was subsequently cloned, expressed, and purified. An enzymatic assay for purified GST Pi was established using 1- chloro-2, 4-dinitrobenzene (CDNB) as a substrate.
[Show full text]
Anti-GSTZ1 (GW22033F)
3050 Spruce Street, Saint Louis, MO 63103 USA Tel: (800) 521-8956 (314) 771-5765 Fax: (800) 325-5052 (314) 771-5757 email: [email protected] Product Information Anti-GSTZ1 antibody produced in chicken, affinity isolated antibody Catalog Number GW22033F Formerly listed as GenWay Catalog Number 15-288-22033F, Maleylacetoacetate isomerase Antibody. – Storage Temperature Store at 20 °C The product is a clear, colorless solution in phosphate buffered saline, pH 7.2, containing 0.02% sodium azide. Synonyms: Glutathione transferase zeta 1 (maleylacetoace- tate isomerase); glutathione transferase Zeta 1, EC 5.2.1.2; Species Reactivity: Human MAAI; Glutathione S-transferase zeta 1; EC 2.5.1.18; GSTZ1-1 Tested Applications: WB Product Description Recommended Dilutions: Recommended starting dilution Bifunctional enzyme showing minimal glutathione-conju- for Western blot analysis is 1:500, for tissue or cell staining gating activity with ethacrynic acid and 7-chloro-4-nitro- 1:200. benz-2-oxa-1.3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T- Note: Optimal concentrations and conditions for each butyl and cumene hydroperoxides. Is able to catalyze the application should be determined by the user. glutathione dependent oxygenation of dichloroacetic acid Precautions and Disclaimer to glyoxylic acid. This product is for R&D use only, not for drug, household, or NCBI Accession number: NP_001504.1 other uses. Due to the sodium azide content a material Swiss Prot Accession number: O43708 safety data sheet (MSDS) for this product has been sent to the attention of the safety officer of your institution. Please Gene Information: Human .
[Show full text]
GSTZ1 Sensitizes Hepatocellular Carcinoma Cells to Sorafenib-Induced
bioRxiv preprint doi: https://doi.org/10.1101/2020.12.14.422655; this version posted December 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 GSTZ1 sensitizes hepatocellular carcinoma cells to sorafenib-induced 2 ferroptosis via inhibition of NRF2/GPX4 axis 3 Running title: GSTZ1 sensitizes HCC to sorafenib-induced ferroptosis 4 Qiujie Wang1,*, Bin Cheng1,*, Qiang Xue2,*, Qingzhu Gao1, Ailong Huang1,#, 5 Kai Wang1,#, Ni Tang1,# 6 1Key Laboratory of Molecular Biology for Infectious Diseases (Ministry of 7 Education), Institute for Viral Hepatitis, Department of Infectious Diseases, The 8 Second Affiliated Hospital, Chongqing Medical University, Chongqing, China 9 2Department of Hepatobiliary Surgery, The Second Affiliated Hospital of 10 Chongqing Medical University, Chongqing, China 11 *These authors contributed equally to this work. 12 #Correspondence: Ailong Huang, Kai Wang, Ni Tang, Key Laboratory of 13 Molecular Biology for Infectious Diseases (Ministry of Education), Institute for 14 Viral Hepatitis, Department of Infectious Diseases, The Second Affiliated 15 Hospital, Chongqing Medical University, Chongqing, China. Phone: 16 86-23-68486780, Fax: 86-23-68486780, E-mail: [email protected] (N.T.), 17 [email protected] (A.L.H.), [email protected] (K.W.) 18 19 Conflict of interest 20 The authors declare no conflict of interest. 21 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.12.14.422655; this version posted December 14, 2020.
[Show full text]
Age-Related Changes in Expression and Activity of Human Hepatic Mitochondrial Glutathione Transferase Zeta1 S
Supplemental material to this article can be found at: http://dmd.aspetjournals.org/content/suppl/2018/05/31/dmd.118.081810.DC1 1521-009X/46/8/1118–1128$35.00 https://doi.org/10.1124/dmd.118.081810 DRUG METABOLISM AND DISPOSITION Drug Metab Dispos 46:1118–1128, August 2018 Copyright ª 2018 by The American Society for Pharmacology and Experimental Therapeutics Age-Related Changes in Expression and Activity of Human Hepatic Mitochondrial Glutathione Transferase Zeta1 s Guo Zhong, Margaret O. James, Marci G. Smeltz, Stephan C. Jahn, Taimour Langaee, Pippa Simpson, and Peter W. Stacpoole Department of Medicinal Chemistry (G.Z., M.O.J., M.G.S., S.C.J.), Department of Pharmacotherapy and Translational Research (T.L.), Center for Pharmacogenomics (T.L.), and Departments of Medicine and Biochemistry and Molecular Biology (P.W.S.), University of Florida, Gainesville, Florida; and Department of Pediatrics, Medical College of Wisconsin, Milwaukee, Wisconsin (P.S.) Received April 2, 2018; accepted May 29, 2018 ABSTRACT Glutathione transferase zeta1 (GSTZ1) catalyzes glutathione (GSH)- samples from livers with the GSTZ1C variant, apparent enzyme Downloaded from dependent dechlorination of dichloroacetate (DCA), an investiga- kinetic constants for DCA and GSH were similar for mitochondria tional drug with therapeutic potential in metabolic disorders and and cytosol after correcting for the loss of GSH observed in cancer. GSTZ1 is expressed in both hepatic cytosol and mitochon- mitochondrial incubations. In the presence of 38 mM chloride, dria. Here, we examined the ontogeny and characterized the mitochondrial GSTZ1 exhibited shorter half-lives of inactivation properties of human mitochondrial GSTZ1. GSTZ1 expression and compared with the cytosolic enzyme (P = 0.017).
[Show full text]
Reduced Function of the Glutathione S-Transferase S1 Suppresses Behavioral
bioRxiv preprint doi: https://doi.org/10.1101/2020.01.21.906156; this version posted January 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Reduced function of the glutathione S-transferase S1 suppresses behavioral 2 hyperexcitability in Drosophila expressing a mutant voltage-gated sodium channel 3 Hung-Lin Chen*,1, Junko Kasuya†, Patrick Lansdon*,2, Garrett Kaas*,3, Hanxi Tang‡, Maggie 4 Sodders†, and Toshihiro Kitamoto*,† 5 *Interdisciplinary Graduate Program in Genetics, †Department of Anesthesia, Carver College 6 of Medicine, ‡Iowa Center for Research by Undergraduates, University of Iowa, IA 52242 7 1Current affiliation: Department of Medical Research, Tungs’ Taichung MetroHarbor Hospital, 8 Taichung City, Taiwan 43503, ROC 9 2Current affiliation: Department of Molecular Biosciences, College of Liberal Arts and 10 Sciences, University of Kansas, KS 66045, USA 11 3Current affiliation: Department of Pharmacology, Vanderbilt University School of Medicine, 12 Nashville, TN 37232, USA 13 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.01.21.906156; this version posted January 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 14 Running title 15 Genetic suppression of fly seizures 16 17 Key words 18 Forward genetic screen, genetic modifiers, epilepsy, RNA-sequencing analysis 19 20 Corresponding author 21 Toshihiro Kitamoto, Ph.D.
[Show full text]
The NRF2, Thioredoxin, and Glutathione System in Tumorigenesis and Anticancer Therapies
antioxidants Review The NRF2, Thioredoxin, and Glutathione System in Tumorigenesis and Anticancer Therapies Morana Jaganjac y , Lidija Milkovic y , Suzana Borovic Sunjic and Neven Zarkovic * Laboratory for Oxidative Stress, Division of Molecular Medicine, Rudjer Boskovic Institute, Bijenicka 54, 10000 Zagreb, Croatia; [email protected] (M.J.); [email protected] (L.M.); [email protected] (S.B.S.) * Correspondence: [email protected]; Tel.: +385-1-457-1234 These authors contributed equally to this work. y Received: 27 October 2020; Accepted: 17 November 2020; Published: 19 November 2020 Abstract: Cancer remains an elusive, highly complex disease and a global burden. Constant change by acquired mutations and metabolic reprogramming contribute to the high inter- and intratumor heterogeneity of malignant cells, their selective growth advantage, and their resistance to anticancer therapies. In the modern era of integrative biomedicine, realizing that a personalized approach could benefit therapy treatments and patients’ prognosis, we should focus on cancer-driving advantageous modifications. Namely, reactive oxygen species (ROS), known to act as regulators of cellular metabolism and growth, exhibit both negative and positive activities, as do antioxidants with potential anticancer effects. Such complexity of oxidative homeostasis is sometimes overseen in the case of studies evaluating the effects of potential anticancer antioxidants. While cancer cells often produce more ROS due to their increased growth-favoring demands, numerous conventional anticancer therapies exploit this feature to ensure selective cancer cell death triggered by excessive ROS levels, also causing serious side effects. The activation of the cellular NRF2 (nuclear factor erythroid 2 like 2) pathway and induction of cytoprotective genes accompanies an increase in ROS levels.
[Show full text]
GSTZ1 Genotype and Cognitive Ability
Starr_edit.qxp 16/2/09 3:20 pm Page 15 Age-related Neurodegenerative Disease GSTZ1 Genotype and Cognitive Ability John M Starr1 and Catherine Quinn2 1. Professor of Health and Ageing, MRC Centre for Cognitive Epidemiology and Cognitive Ageing, University of Edinburgh, Royal Victoria Hospital, Edinburgh; 2. Specialist Registrar, NES South East Scotland, Royal Victoria Hospital, Edinburgh DOI:10.17925/ENR.2008.03.02.15 The Functions of GSTZ1 is involved in regulating the supply of substrate for dopamine production Glutathione S-transferases (GSTs) catalyse the nucleophilic conjugation of and in the disposal of some of its neurotoxic products. glutathione with a range of electrophilic substances, which represents a major detoxification mechanism in mammals.1 GST zeta (GSTZ1) catalyses Dopamine and Cognitive Ability the glutathione-dependent isomerisation of maleylacetoacetate to Dopamine is a major neurotransmitter widely distributed within the fumarylacetoacetate in the tyrosine catabolic pathway (see Figure 1). It brain.6 Dopaminergic neurotransmission in the pre-frontal cortex (PFC) also catalyses the oxygenation of dichloroacetic acid (DCA) to glyoxylic contributes to individual cognitive differences in animals and humans.7 acid. DCA does not occur naturally but is present in chlorinated water Dopamine is also implicated in cognitive deficits seen in schizophrenia and Parkinson’s disease. Much attention has focused on a functional variation in the human COMT gene that occurs at a single nucleotide polymorphism (SNP) (472G>A), resulting in a valine (Val) to methionine GSTZ1 is involved in regulating the (Met) amino acid substitution (Val158Met). This variant may reduce the supply of substrate for dopamine thermostability and activity of the enzyme to one-quarter of that encoded by the Val allele,8 although data from human post mortem material production and in disposal of some suggest that the effect may not be so substantial.9 Reduced enzyme of its neurotoxic products.
[Show full text]