DOCSLIB.ORG

Hint2 (NM 026871) Mouse Tagged ORF Clone Product Data

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Hint2 (NM 026871) Mouse Tagged ORF Clone Product Data OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MR220622 Hint2 (NM_026871) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Hint2 (NM_026871) Mouse Tagged ORF Clone Tag: Myc-DDK Symbol: Hint2 Synonyms: 1190005L05Rik Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MR220622 representing NM_026871 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGCTGCTGTGCTGCTGGCCGTGGGCTTGCGCGCTGCGCGCAGAACCCTGGCTGCCGCGGGGGCCC GGGGGGCGCAGGTCCGAGGAAACGCAGGGGTGTCCGACGGGAGTGAAGTGGCCAAGGCCCAGAAAGCAGC TCCTGGAGGAGCATCGCCAACCATCTTCTCCCGGATTTTGGACCGGAGTCTCCCAGCTGACATTCTATAT GAAGATCAGCAGTGCCTTGTGTTCCGTGACGTAGCTCCTCAGGCTCCTGTGCACTTTCTGGTCATTCCTA GGAAGCCCATTCCTCGAATTAGCCAGGCTGAAGAGGACGACCAGCAGCTTCTAGGACACTTACTCCTTGT GGCCAAGAAGATAGCACAGGCCCAGGGTCTGAAAGATGGGTATCGACTTGTGGTTAATGATGGCAAGATG GGCGCACAGTCTGTGTATCACCTGCACATTCACGTACTTGGAGGCCGACAGCTGCAGTGGCCACCTGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >MR220622 representing NM_026871 Red=Cloning site Green=Tags(s) MAAAVLLAVGLRAARRTLAAAGARGAQVRGNAGVSDGSEVAKAQKAAPGGASPTIFSRILDRSLPADILY EDQQCLVFRDVAPQAPVHFLVIPRKPIPRISQAEEDDQQLLGHLLLVAKKIAQAQGLKDGYRLVVNDGKM GAQSVYHLHIHVLGGRQLQWPPG myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mm9078_a12.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Hint2 (NM_026871) Mouse Tagged ORF Clone – MR220622 Cloning Scheme: Plasmid Map: ACCN: NM_026871 ORF Size: 489 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Hint2 (NM_026871) Mouse Tagged ORF Clone – MR220622 OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at [email protected] or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_026871.1, NP_081147.1 RefSeq Size: 636 bp RefSeq ORF: 492 bp Locus ID: 68917 UniProt ID: Q9D0S9, Q5M9J2 MW: 17.3 kDa Gene Summary: Hydrolase probably involved in steroid biosynthesis. May play a role in apoptosis. Has adenosine phosphoramidase activity (By similarity).[UniProtKB/Swiss-Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • The Interplay Between Dysregulated Ion Transport and Mitochondrial Architecture As a Dangerous Liaison in Cancer
    International Journal of Molecular Sciences Review The Interplay between Dysregulated Ion Transport and Mitochondrial Architecture as a Dangerous Liaison in Cancer Stine F. Pedersen 1,* , Mette Flinck 1 and Luis A. Pardo 2,* 1 Department of Biology, Faculty of Science, University of Copenhagen, 2100 Copenhagen, Denmark; mette.fl[email protected] 2 Oncophysiology Group, Max Planck Institute for Experimental Medicine, 37075 Göttingen, Germany * Correspondence: [email protected] (S.F.P.); [email protected] (L.A.P.) Abstract: Transport of ions and nutrients is a core mitochondrial function, without which there would be no mitochondrial metabolism and ATP production. Both ion homeostasis and mitochondrial phenotype undergo pervasive changes during cancer development, and both play key roles in driving the malignancy. However, the link between these events has been largely ignored. This review comprehensively summarizes and critically discusses the role of the reciprocal relationship between ion transport and mitochondria in crucial cellular functions, including metabolism, signaling, and cell fate decisions. We focus on Ca2+,H+, and K+, which play essential and highly interconnected roles in mitochondrial function and are profoundly dysregulated in cancer. We describe the transport and roles of these ions in normal mitochondria, summarize the changes occurring during cancer development, and discuss how they might impact tumorigenesis. Keywords: mitochondrial fission; mitochondrial fusion; calcium; pH; potassium; membrane potential; metabolism; apoptosis; cell cycle; metastasis Citation: Pedersen, S.F.; Flinck, M.; Pardo, L.A. The Interplay between Dysregulated Ion Transport and Mitochondrial Architecture as a 1. Introduction Dangerous Liaison in Cancer. Int. J. Since the first observation of mitochondria in the 1840s, a century had to pass until it Mol.
    [Show full text]
  • Pan-Cancer Analysis Identifies Mutations in SUGP1 That Recapitulate Mutant SF3B1 Splicing Dysregulation
    Pan-cancer analysis identifies mutations in SUGP1 that recapitulate mutant SF3B1 splicing dysregulation Zhaoqi Liua,b,c,1, Jian Zhangd,1, Yiwei Suna,c, Tomin E. Perea-Chambleea,b,c, James L. Manleyd,2, and Raul Rabadana,b,c,2 aProgram for Mathematical Genomics, Columbia University, New York, NY 10032; bDepartment of Systems Biology, Columbia University, New York, NY 10032; cDepartment of Biomedical Informatics, Columbia University, New York, NY 10032; and dDepartment of Biological Sciences, Columbia University, New York, NY 10027 Contributed by James L. Manley, March 2, 2020 (sent for review January 2, 2020; reviewed by Kristen Lynch and Gene Yeo) The gene encoding the core spliceosomal protein SF3B1 is the most also resulted in the same splicing defects observed in SF3B1 frequently mutated gene encoding a splicing factor in a variety of mutant cells (11). hematologic malignancies and solid tumors. SF3B1 mutations in- In addition to SF3B1, other SF-encoding genes have also been duce use of cryptic 3′ splice sites (3′ss), and these splicing errors found to be mutated in hematologic malignancies, e.g., U2AF1, contribute to tumorigenesis. However, it is unclear how wide- SRSF2, and ZRSR2. However, these SF gene mutations do not spread this type of cryptic 3′ss usage is in cancers and what is share common alterations in splicing (1, 3), suggesting that dif- the full spectrum of genetic mutations that cause such missplicing. ferent splicing patterns may contribute to different phenotypes To address this issue, we performed an unbiased pan-cancer anal- of cancers. Because SF3B1 is the most frequently mutated ysis to identify genetic alterations that lead to the same aberrant splicing gene, the splicing defects caused by mutant SF3B1 may SF3B1 splicing as observed with mutations.
    [Show full text]
  • Crystal Structure of Histidine Triad Nucleotide- Binding Protein from the Pathogenic Fungus Candida Albicans
    Molecules and Cells Minireview Crystal Structure of Histidine Triad Nucleotide- Binding Protein from the Pathogenic Fungus Candida albicans Ahjin Jung1,6, Ji-Sook Yun1,6, Shinae Kim1, Sang Ryong Kim2, Minsang Shin3, Dong Hyung Cho2, Kwang Shik Choi2,4,5,*, and Jeong Ho Chang1,5,* 1Department of Biology Education, 2School of Life Sciences, BK21 Plus KNU Creative BioResearch Group, 3Department of Mi- crobiology, School of Medicine, 4Research Institute for Dokdo and Ulleungdo Island, Kyungpook National University, 5Research Institute for Phylogenomics and Evolution, Kyungpook National University, Daegu 41566, Korea, 6These authors contributed equally to this work. *Correspondence: [email protected] (KSC); [email protected] (JHC) http://dx.doi.org/10.14348/molcells.2018.0377 www.molcells.org Histidine triad nucleotide-binding protein (HINT) is a member of evolution. Further studies are required to address the func- of the histidine triad (HIT) superfamily, which has hydrolase tional significance of variations in the C-terminal region. This activity owing to a histidine triad motif. The HIT superfamily structural analysis of CaHINT provided important insights into can be divided to five classes with functions in galactose me- the molecular aspects of evolution within the HIT superfamily. tabolism, DNA repair, and tumor suppression. HINTs are high- ly conserved from archaea to humans and function as tumor Keywords: Candida albicans, crystal structure, histidine triad, suppressors, translation regulators, and neuropathy inhibitors. HIT family, HINT Although the structures of HINT proteins from various species have been reported, limited structural information is available for fungal species. Here, to elucidate the structural features INTRODUCTION and functional diversity of HINTs, we determined the crystal structure of HINT from the pathogenic fungus Candida albi- Histidine triad nucleotide-binding protein (HINT), which con- cans (CaHINT) in complex with zinc ions at a resolution of 2.5 tains three highly conserved histidines as catalytic residues, is Å.
    [Show full text]
  • An Integrated Approach to Comprehensively Map the Molecular Context of Proteins
    bioRxiv preprint doi: https://doi.org/10.1101/264788; this version posted February 13, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Liu et al. An integrated approach to comprehensively map the molecular context of proteins Xiaonan Liu1,2, Kari Salokas1,2, Fitsum Tamene1,2,3 and Markku Varjosalo1,2,3* 1Institute of Biotechnology, University of Helsinki, Helsinki 00014, Finland 2Helsinki Institute of Life Science, University of Helsinki, Helsinki 00014, Finland 3Proteomics Unit, University of Helsinki, Helsinki 00014, Finland *Corresponding author Abstract: Protein-protein interactions underlie almost all cellular functions. The comprehensive mapping of these complex cellular networks of stable and transient associations has been made available by affi nity purifi cation mass spectrometry (AP-MS) and more recently by proximity based labelling methods such as BioID. Due the advancements in both methods and MS instrumentation, an in-depth analysis of the whole human proteome is at grasps. In order to facilitate this, we designed and optimized an integrated approach utilizing MAC-tag combining both AP-MS and BioID in a single construct. We systematically applied this approach to 18 subcellular localization markers and generated a molecular context database, which can be used to defi ne molecular locations for any protein of interest. In addition, we show that by combining the AP-MS and BioID results we can also obtain interaction distances within a complex. Taken together, our combined strategy off ers comprehensive approach for mapping physical and functional protein interactions. Introduction: Majority of proteins do not function in isolation geting the endogenous bait protein, allowing and their interactions with other proteins defi ne purifi cation of the bait protein together with the their cellular functions.
    [Show full text]
  • Protein Network Analyses of Pulmonary Endothelial Cells In
    www.nature.com/scientificreports OPEN Protein network analyses of pulmonary endothelial cells in chronic thromboembolic pulmonary hypertension Sarath Babu Nukala1,8,9*, Olga Tura‑Ceide3,4,5,9, Giancarlo Aldini1, Valérie F. E. D. Smolders2,3, Isabel Blanco3,4, Victor I. Peinado3,4, Manuel Castell6, Joan Albert Barber3,4, Alessandra Altomare1, Giovanna Baron1, Marina Carini1, Marta Cascante2,7,9 & Alfonsina D’Amato1,9* Chronic thromboembolic pulmonary hypertension (CTEPH) is a vascular disease characterized by the presence of organized thromboembolic material in pulmonary arteries leading to increased vascular resistance, heart failure and death. Dysfunction of endothelial cells is involved in CTEPH. The present study describes for the frst time the molecular processes underlying endothelial dysfunction in the development of the CTEPH. The advanced analytical approach and the protein network analyses of patient derived CTEPH endothelial cells allowed the quantitation of 3258 proteins. The 673 diferentially regulated proteins were associated with functional and disease protein network modules. The protein network analyses resulted in the characterization of dysregulated pathways associated with endothelial dysfunction, such as mitochondrial dysfunction, oxidative phosphorylation, sirtuin signaling, infammatory response, oxidative stress and fatty acid metabolism related pathways. In addition, the quantifcation of advanced oxidation protein products, total protein carbonyl content, and intracellular reactive oxygen species resulted increased
    [Show full text]
  • HINT2 Downregulation Promotes Colorectal Carcinoma Migration and Metastasis
    www.impactjournals.com/oncotarget/ Oncotarget, 2017, Vol. 8, (No. 8), pp: 13521-13531 Research Paper HINT2 downregulation promotes colorectal carcinoma migration and metastasis Weihua Li1,*, Shaoxin Cai1,*, Le Wang1, Changshun Yang1, Biaohuan Zhou1, Huan Wang1 1Department of Surgical Oncology, Fujian Provincial Clinical College, Fujian Medical University, Fuzhou 350001, China *These authors contributed equally to this work Correspondence to: Weihua Li, email: [email protected] Keywords: colorectal cancer, HINT2, epithelial–mesenchymal transition, HIF-2α, ZEB1 Received: June 30, 2016 Accepted: January 03, 2017 Published: January 10, 2017 ABSTRACT Histidine triad nucleotide-binding 2 (HINT2), a member of the histidine triad proteins family, sensitizes cells to apoptosis in hepatocellular carcinoma. Here, we showed that HINT2 expression is lower in primary colorectal cancer (CRC) and metastasis tissues than in normal colorectal tissues, and that HINT2 abundance is inversely correlated with CRC tumor stage. Treating CRC cells with 5-aza-2'- deoxycytidine, a demethylating agent, upregulated HINT2, suggesting HINT2 downregulation is caused by methylation of the gene promoter. HINT2 downregulation increased tumor migration and invasion in vitro, promoted CRC cell metastasis in vivo, and increased expression of epithelial-to-mesenchymal transition (EMT) markers. Furthermore, HINT2 downregulation depended on hypoxia inducible factor (HIF)-2α- mediated transcriptional activation of zinc finger E-box-binding homeobox 1 (ZEB1). These results suggest that HINT2 downregulation promotes HIF-2α expression, which induces EMT and enhances CRC cell migration and invasion. HINT2 may thus a useful clinical indicator of CRC progression and metastasis risk. INTRODUCTION In the past decade, the epithelial–mesenchymal transition (EMT) has been increasingly recognized as Colorectal cancer (CRC) is one of the most common promoting cancer cell invasion and metastasis [11, 12].
    [Show full text]
  • Mitochondrial Calcium Regulation of Redox Signaling in Cancer
    cells Review Mitochondrial Calcium Regulation of Redox Signaling in Cancer 1, 2, 3 2 Céline Delierneux y , Sana Kouba y, Santhanam Shanmughapriya , Marie Potier-Cartereau , Mohamed Trebak 1 and Nadine Hempel 1,4,* 1 Department of Cellular and Molecular Physiology, The Pennsylvania State University College of Medicine, 500 University Dr., Hershey, PA 17033, USA; [email protected] (C.D.); [email protected] (M.T.) 2 Inserm U1069 Nutrition, Croissance et Cancer, Université de Tours, 10 Boulevard Tonnellé, 37032 Tours, France; [email protected] (S.K.); [email protected] (M.P.-C.) 3 Department of Medicine, The Pennsylvania State University College of Medicine, 500 University Dr., Hershey, PA 17033, USA; [email protected] 4 Department of Pharmacology, and Obstetrics and Gynecology, The Pennsylvania State University College of Medicine, 500 University Dr., Hershey, PA 17033, USA * Correspondence: [email protected]; Tel.: +717-531-4037 These authors contributed equally to this work. y Received: 8 January 2020; Accepted: 10 February 2020; Published: 12 February 2020 Abstract: Calcium (Ca2+) uptake into the mitochondria shapes cellular Ca2+ signals and acts as a key effector for ATP generation. In addition, mitochondria-derived reactive oxygen species (mROS), produced as a consequence of ATP synthesis at the electron transport chain (ETC), modulate cellular signaling pathways that contribute to many cellular processes. Cancer cells modulate mitochondrial Ca2+ ([Ca2+]m) homeostasis by altering the expression and function of mitochondrial Ca2+ channels and transporters required for the uptake and extrusion of mitochondrial Ca2+. Regulated elevations in [Ca2+]m are required for the activity of several mitochondrial enzymes, and this in turn regulates metabolic flux, mitochondrial ETC function and mROS generation.
    [Show full text]
  • The Intra-Mitochondrial O-Glcnacylation System Acutely Regulates OXPHOS Capacity and ROS Dynamics in the Heart
    The intra-mitochondrial O-GlcNAcylation system acutely regulates OXPHOS capacity and ROS dynamics in the heart Justine Dontaine Asma Bouali Frederic Daussin Laurent Bultot https://orcid.org/0000-0002-5088-0101 Didier Vertommen Manon Martin Rahulan Rathagirishnan Alexanne Cuillerier University of Ottawa Sandrine Horman Christophe Beauloye Université catholique de Louvain, Institut de Recherche Expérimentale et Clinique Laurent Gatto UCLouvain https://orcid.org/0000-0002-1520-2268 Benjamin Lauzier Luc Bertrand https://orcid.org/0000-0003-0655-7099 Yan Burelle ( [email protected] ) University of Ottawa https://orcid.org/0000-0001-9379-146X Article Keywords: O-GlcNAcylation, OXPHOS capacity, cellular regulatory mechanism Posted Date: July 19th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-690671/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License 1 THE INTRA-MITOCHONDRIAL O-GLCNACYLATION SYSTEM ACUTELY 2 REGULATES OXPHOS CAPACITY AND ROS DYNAMICS IN THE HEART. 3 4 Justine Dontaine1, A. Bouali2, F. Daussin3, L. Bultot1, D. Vertommen4, M. Martin5, R. 5 Rathagirishnan2, A. Cuillerier6, S. Horman1, C. Beauloye1,7, L. Gatto5, B. Lauzier8, L. Bertrand1,9*, 6 Y. Burelle2,6* 7 1Pole of cardiovascular research (CARD), Institute of Experimental and Clinical Research (IREC), UCLouvain, 8 Brussels, Belgium 9 2Interdisciplinary School of Health Sciences, Faculty of Health Sciences, University of Ottawa, Ottawa, ON, Canada 10 3Univ. Lille, Univ. Artois, Univ. Littoral Côte d’Opale, ULR 7369
    [Show full text]
  • Hint2 (P-13): Sc-107224
    SAN TA C RUZ BI OTEC HNOL OG Y, INC . Hint2 (P-13): sc-107224 BACKGROUND CHROMOSOMAL LOCATION Hint2 (histidine triad nucleotide binding protein 2), also known as HIT-17, is a Genetic locus: HINT2 (human) mapping to 9p13.3; Hint2 (mouse) mapping to 163 amino acid secreted protein that contains one HIT domain, a histidine 4 B1. triad that has catalytic activity toward the α-phosphate of ribonucleotides. Via its HIT domain, Hint2 is thought to function as a hydrolase that is encoded SOURCE by a gene which maps to chromosome 9. Chromosome 9 contains 145 million Hint2 (P-13) is an affinity purified goat polyclonal antibody raised against a base pairs and comprises 4% of the human genome, encoding nearly 900 peptide mapping within an internal region of Hint2 of mouse origin. genes. Hereditary hemorrhagic telangiectasia and familial dysautonomia are both associated with chromosome 9. Notably, chromosome 9 encompasses PRODUCT the largest interferon family gene cluster. Chromosome 9 is partnered with chromosome 22 in translocations that lead to the aberrant production of a Each vial contains 200 µg IgG in 1.0 ml of PBS with < 0.1% sodium azide Bcr-Abl fusion protein often found in leukemias. and 0.1% gelatin. Blocking peptide available for competition studies, sc-107224 P, (100 µg REFERENCES pep tide in 0.5 ml PBS containing < 0.1% sodium azide and 0.2% BSA). 1. Brenner, C. 2002. Hint, Fhit, and GALT: function, structure, evolution, and mechanism of three branches of the histidine triad superfamily of nucleo- APPLICATIONS tide hydrolases and transferases.
    [Show full text]
  • Human HINT2 Antibody Catalog Number: ATGA0378
    Human HINT2 antibody Catalog Number: ATGA0378 PRODUCT INPORMATION Catalog number ATGA0378 Clone No. AT5B10 Product type Monoclonal Antibody UnitProt No. Q9BX68 NCBI Accession No. NP_115982 Alternative Names Histidine triad nucleotide-binding protein 2, HIT-17 PRODUCT SPECIFICATION Antibody Host Mouse Reacts With Human Concentration 1mg/ml (determined by BCA assay) Formulation Liquid in. Phosphate-Buffered Saline (pH 7.4) with 0.02% Sodium Azide, 10% glycerol Immunogen Recombinant human HINT2 (18-163aa) purified from E. coli Isotype IgG1 kappa Purification Note By protein-A affinity chromatography Application ELISA,WB Usage The antibody has been tested by ELISA, Western blot analysis and Flow cytometry to assure specificity and reactivity. Since application varies, however, each investigation should be titrated by the reagent to obtain optimal results. 1 Human HINT2 antibody Catalog Number: ATGA0378 Storage Can be stored at +2C to +8C for 1 week. For long term storage, aliquot and store at -20C to -80C. Avoid repeated freezing and thawing cycles. BACKGROUND Description Histidine triad nucleotide binding protein 2 (HINT2) is a mitochondrial protein. This protein is an AMP-lysine hydrolase and phosphoamidase and may contribute to tumor suppression. This protein is a member of the HIT superfamily and Hint subfamily, which are characterized as nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides. HINT2 regulates steroidogenesis through calcium-dependent and calcium-independent signalling pathways that may serve to maintain a favorable mitochondrial potential. Its role in calcium homeostasis may also contribute to its proapoptotic function in hepatocytes and other non- steroidogenic cells, though the exact mechanism remains unclear.
    [Show full text]
  • M6a Modification Suppresses Ocular Melanoma Through Modulating
    Jia et al. Molecular Cancer (2019) 18:161 https://doi.org/10.1186/s12943-019-1088-x RESEARCH Open Access m6A modification suppresses ocular melanoma through modulating HINT2 mRNA translation Ruobing Jia1,3†, Peiwei Chai1,3†, Shanzheng Wang2,4†, Baofa Sun2,4,5, Yangfan Xu1,3, Ying Yang2,4,5 , Shengfang Ge1,3, Renbing Jia1,3*, Yun-Gui Yang2,4,5* and Xianqun Fan1,3* Abstract Background: Dynamic N6-methyladenosine (m6A) RNA modification generated and erased by N6- methyltransferases and demethylases regulates gene expression, alternative splicing and cell fate. Ocular melanoma, comprising uveal melanoma (UM) and conjunctival melanoma (CM), is the most common primary eye tumor in adults and the 2nd most common melanoma. However, the functional role of m6A modification in ocular melanoma remains unclear. Methods: m6A assays and survival analysis were used to explore decreased global m6Alevels,indicatinga late stage of ocular melanoma and a poor prognosis. Multiomic analysis of miCLIP-seq, RNA-seq and Label- free MS data revealed that m6A RNA modification posttranscriptionally promoted HINT2 expression. RNA immunoprecipitation (RIP)-qPCR and dual luciferase assays revealed that HINT2 mRNA specifically interacted with YTHDF1. Furthermore, polysome profiling analysis indicated a greater amount of HINT2 mRNA in the translation pool in ocular melanoma cells with higher m6Amethylation. Results: Here, we show that RNA methylation significantly inhibits the progression of UM and CM. Ocular melanoma samples showed decreased m6A levels, indicating a poor prognosis. Changes in global m6A modification were highly associated with tumor progression in vitro and in vivo. Mechanistically, YTHDF1 promoted the translation of methylated HINT2 mRNA, a tumor suppressor in ocular melanoma.
    [Show full text]
  • Optimal Microdomain Crosstalk Between Endoplasmic Reticulum
    OPEN Optimal microdomain crosstalk between SUBJECT AREAS: endoplasmic reticulum and mitochondria COMPUTATIONAL 21 BIOPHYSICS for Ca oscillations CALCIUM SIGNALLING Hong Qi1, Linxi Li1 & Jianwei Shuai1,2,3 Received 1Department of Physics, Xiamen University, Xiamen 361005, China, 2State Key Laboratory of Cellular Stress Biology, Innovation 29 July 2014 Center for Cell Biology, Xiamen University, Xiamen 361005, China, 3Fujian Provincial Key Laboratory of Theoretical and Accepted Computational Chemistry, Xiamen University, Xiamen 361005, China. 24 December 2014 1 1 Published ACa2 signaling model is proposed to consider the crosstalk of Ca2 ions between endoplasmic reticulum 23 January 2015 (ER) and mitochondria within microdomains around inositol 1, 4, 5-trisphosphate receptors (IP3R) and the 21 mitochondrial Ca uniporter (MCU). Our model predicts that there is a critical IP3R-MCU distance at which 50% of the ER-released Ca21 is taken up by mitochondria and that mitochondria modulate Ca21 signals differently when outside of this critical distance. This study highlights the importance of the 21 Correspondence and IP3R-MCU distance on Ca signaling dynamics. The model predicts that when MCU are too closely 21 21 requests for materials associated with IP3Rs, the enhanced mitochondrial Ca uptake will produce an increase of cytosolic Ca should be addressed to spike amplitude. Notably, the model demonstrates the existence of an optimal IP3R-MCU distance (30– 85 nm) for effective Ca21 transfer and the successful generation of Ca21 signals in healthy cells. We suggest J.S. (jianweishuai@ that the space between the inner and outer mitochondria membranes provides a defense mechanism against xmu.edu.cn) 21 occurrences of high [Ca ]Cyt.
    [Show full text]