Hint2 (NM 026871) Mouse Tagged ORF Clone Product Data

Hint2 (NM 026871) Mouse Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MR220622 Hint2 (NM_026871) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Hint2 (NM_026871) Mouse Tagged ORF Clone Tag: Myc-DDK Symbol: Hint2 Synonyms: 1190005L05Rik Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MR220622 representing NM_026871 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGCTGCTGTGCTGCTGGCCGTGGGCTTGCGCGCTGCGCGCAGAACCCTGGCTGCCGCGGGGGCCC GGGGGGCGCAGGTCCGAGGAAACGCAGGGGTGTCCGACGGGAGTGAAGTGGCCAAGGCCCAGAAAGCAGC TCCTGGAGGAGCATCGCCAACCATCTTCTCCCGGATTTTGGACCGGAGTCTCCCAGCTGACATTCTATAT GAAGATCAGCAGTGCCTTGTGTTCCGTGACGTAGCTCCTCAGGCTCCTGTGCACTTTCTGGTCATTCCTA GGAAGCCCATTCCTCGAATTAGCCAGGCTGAAGAGGACGACCAGCAGCTTCTAGGACACTTACTCCTTGT GGCCAAGAAGATAGCACAGGCCCAGGGTCTGAAAGATGGGTATCGACTTGTGGTTAATGATGGCAAGATG GGCGCACAGTCTGTGTATCACCTGCACATTCACGTACTTGGAGGCCGACAGCTGCAGTGGCCACCTGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >MR220622 representing NM_026871 Red=Cloning site Green=Tags(s) MAAAVLLAVGLRAARRTLAAAGARGAQVRGNAGVSDGSEVAKAQKAAPGGASPTIFSRILDRSLPADILY EDQQCLVFRDVAPQAPVHFLVIPRKPIPRISQAEEDDQQLLGHLLLVAKKIAQAQGLKDGYRLVVNDGKM GAQSVYHLHIHVLGGRQLQWPPG myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mm9078_a12.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Hint2 (NM_026871) Mouse Tagged ORF Clone – MR220622 Cloning Scheme: Plasmid Map: ACCN: NM_026871 ORF Size: 489 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Hint2 (NM_026871) Mouse Tagged ORF Clone – MR220622 OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at [email protected] or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_026871.1, NP_081147.1 RefSeq Size: 636 bp RefSeq ORF: 492 bp Locus ID: 68917 UniProt ID: Q9D0S9, Q5M9J2 MW: 17.3 kDa Gene Summary: Hydrolase probably involved in steroid biosynthesis. May play a role in apoptosis. Has adenosine phosphoramidase activity (By similarity).[UniProtKB/Swiss-Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us