DOCSLIB.ORG

Supplemental Table 1. Genes Upregulated in Tumors Containing Phosphorylated STAT3 and Phosphorylated STAT5 Compared to Tumors with Only Phosphorylated STAT3

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supplemental Table 1. Genes Upregulated in Tumors Containing Phosphorylated STAT3 and Phosphorylated STAT5 Compared to Tumors with Only Phosphorylated STAT3 Supplemental table 1. Genes upregulated in tumors containing phosphorylated STAT3 and phosphorylated STAT5 compared to tumors with only phosphorylated STAT3. gene name Gene ID fold t statistic P value change Amphiregulin (schwannoma-derived growth factor) 374 5.49 4.272 0.000631 Spectrin repeat containing, nuclear envelope 2 23224 4.35 2.148 0.045754 SMAD specific E3 ubiquitin protein ligase 1 57154 4.35 2.168 0.041519 Ras suppressor protein 1 6251 4.01 2.291 0.032122 amphiregulin (schwannoma-derived growth factor) 374 3.79 3.601 0.002142 chemokine (C-X-C motif) ligand 2 2920 3.17 2.201 0.044089 laminin, gamma 2 3918 3.11 2.623 0.020121 interferon, alpha-inducible protein (clone IFI-6-16) 2537 2.96 2.153 0.048022 transmembrane 4 L six family member 1 4071 2.9 2.396 0.025563 2'-5'-oligoadenylate synthetase 2, 69/71kDa 4939 2.78 2.143 0.047492 guanylate cyclase 1, soluble, beta 2 2974 2.72 2.469 0.021815 phorbol-12-myristate-13-acetate-induced protein 1 5366 2.64 2.494 0.022427 Mesenchymal stem cell protein DSC43 51333 2.64 2.311 0.031991 PARK2 co-regulated 135138 2.62 2.464 0.023734 myxovirus (influenza virus) resistance 1, interferon- 4599 2.61 2.172 0.046523 inducible protein p78 (mouse) /// myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse) solute carrier family 16 (monocarboxylic acid 6566 2.48 2.341 0.030719 transporters), member 1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N- 2591 2.47 2.216 0.039053 acetylgalactosaminyltransferase 3 (GalNAc-T3) deoxynucleotidyltransferase, terminal 1791 2.42 2.252 0.035746 toll-like receptor 3 7098 2.36 3.503 0.002153 glycosyltransferase 28 domain containing 1 55849 2.32 3.846 0.001546 G protein-coupled receptor, family C, group 5, member A 9052 2.27 2.129 0.048845 early growth response 3 1960 2.27 2.819 0.010601 phospholipase A2, group X 8399 2.21 2.104 0.04992 coagulation factor II (thrombin) receptor-like 1 2150 2.21 2.5 0.023593 tumor necrosis factor receptor superfamily, member 11b 4982 2.18 2.31 0.030837 (osteoprotegerin) ets variant gene 7 (TEL2 oncogene) 51513 2.18 2.849 0.009355 pannexin 1 24145 2.17 4.544 0.000188 zinc finger protein 154 (pHZ-92) 7710 2.13 2.637 0.015235 G1 to S phase transition 2 /// G1 to S phase transition 2 23708 2.13 2.408 0.025982 tripartite motif-containing 58 25893 2.12 2.449 0.022811 S100 calcium binding protein A2 6273 2.1 2.64 0.016791 hypothetical protein LOC284837 284837 2.08 2.407 0.025377 antigen p97 (melanoma associated) identified by 4241 2.08 2.196 0.040537 monoclonal antibodies 133.2 and 96.5 stomatin 2040 2.07 2.655 0.01482 Tumor necrosis factor (ligand) superfamily, member 10 /// 8743 2.06 2.342 0.029792 Tumor necrosis factor (ligand) superfamily, member 10 fibronectin leucine rich transmembrane protein 3 23767 2.02 2.297 0.032343 sterile alpha motif and leucine zipper containing kinase 51776 1.99 3.12 0.004986 AZK dual specificity phosphatase 10 11221 1.97 2.831 0.009954 sterile alpha motif domain containing 9 54809 1.96 3.614 0.001929 arylsulfatase D 414 1.94 2.598 0.016876 Adaptor-related protein complex 1, sigma 2 subunit 8905 1.94 2.519 0.023887 KIAA0701 protein 23074 1.93 2.391 0.026618 annexin A3 306 1.92 2.32 0.030282 chromosome 7 open reading frame 6 219285 1.91 2.95 0.008886 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, 2683 1.9 2.395 0.027939 polypeptide 1 hypothetical gene supported by BC007071 91687 1.9 2.273 0.033786 elongation factor, RNA polymerase II, 2 22936 1.9 2.85 0.011154 membrane targeting (tandem) C2 domain containing 1 123036 1.89 2.464 0.022009 follistatin 10468 1.89 2.409 0.026879 SLIT and NTRK-like family, member 2 84631 1.88 2.542 0.018604 gastrin-releasing peptide 2922 1.88 2.587 0.017343 zinc finger and BTB domain containing 1 22890 1.87 2.54 0.018734 catenin (cadherin-associated protein), alpha 3 29119 1.87 2.587 0.017231 v-jun sarcoma virus 17 oncogene homolog (avian) 3725 1.85 3.541 0.002074 Kruppel-like factor 4 (gut) 9314 1.85 3.287 0.003364 COMM domain containing 5 /// COMM domain containing 28991 1.85 3.229 0.00408 5 basic leucine zipper nuclear factor 1 (JEM-1) 8548 1.84 2.754 0.012031 zinc finger protein 554 115196 1.81 2.758 0.011728 GULP, engulfment adaptor PTB domain containing 1 51454 1.81 2.536 0.018834 zinc finger protein 639 51193 1.8 3.27 0.003526 MRE11 meiotic recombination 11 homolog A (S. 4361 1.8 2.397 0.029186 cerevisiae) Interferon-induced protein 44 10561 1.8 2.266 0.036778 dual specificity phosphatase 10 11221 1.8 2.441 0.02345 deoxyribonuclease I 1773 1.8 2.36 0.029046 solute carrier family 19 (thiamine transporter), member 2 10560 1.79 3.649 0.001417 nudix (nucleoside diphosphate linked moiety X)-type 83594 1.78 2.626 0.016353 motif 12 tetraspanin 15 23555 1.77 4.566 0.000158 hypothetical protein MGC52057 130574 1.77 2.671 0.014235 hypothetical protein FLJ20035 55601 1.77 2.844 0.012057 COBW domain containing 1 /// COBW domain containing 150472 /// 1.77 2.438 0.02557 2 /// dopamine responsive protein 220869 /// 55871 ubiquitously transcribed tetratricopeptide repeat, X 7403 1.76 2.635 0.015912 chromosome Similar to Zinc finger protein 492 388760 1.76 2.748 0.012339 claspin homolog (Xenopus laevis) 63967 1.76 2.351 0.030435 AF464140 163590 1.76 3.181 0.004502 hemochromatosis 3077 1.74 2.634 0.015552 GTPase, IMAP family member 2 26157 1.73 2.405 0.027051 coiled-coil domain containing 2 80173 1.72 2.531 0.020341 hypothetical protein MGC19764 162394 1.71 2.456 0.022875 chromosome 14 open reading frame 105 55195 1.71 2.716 0.012682 Rho GTPase activating protein 26 23092 1.7 2.631 0.016031 homer homolog 2 (Drosophila) 9455 1.7 2.482 0.02381 KIAA0701 protein 23074 1.69 3.096 0.005993 Histamine N-methyltransferase 3176 1.69 2.741 0.012914 melanocortin 4 receptor 4160 1.68 2.583 0.016986 KIAA1333 55632 1.68 3.119 0.005114 solute carrier family 4, sodium bicarbonate cotransporter, 8671 1.67 2.587 0.016897 member 4 v-jun sarcoma virus 17 oncogene homolog (avian) 3725 1.66 4.697 0.000111 retinol dehydrogenase 10 (all-trans) 157506 1.66 2.644 0.016941 mitogen-activated protein kinase associated protein 1 79109 1.65 2.565 0.020635 histamine N-methyltransferase 3176 1.65 2.83 0.009752 etoposide induced 2.4 mRNA 9538 1.64 2.646 0.015223 solute carrier family 35, member F5 80255 1.63 3.177 0.005208 chromosome 7 open reading frame 6 219285 1.63 2.567 0.018428 amyloid beta (A4) precursor protein (protease nexin-II, 351 1.63 2.726 0.012651 Alzheimer disease) tropomyosin 1 (alpha) 7168 1.62 2.726 0.013365 hypothetical protein LOC116068 116068 1.61 2.759 0.012049 Potassium inwardly-rectifying channel, subfamily J, 3763 1.6 2.789 0.010706 member 6 KIAA0433 protein 23262 1.6 2.766 0.013009 Decay accelerating factor for complement (CD55, 1604 1.6 2.671 0.014251 Cromer blood group system) endosulfine alpha 2029 1.58 2.814 0.010801 x 009 protein 56986 1.57 2.729 0.012411 RAB43, member RAS oncogene family 339122 1.57 2.898 0.00839 Kruppel-like factor 3 (basic) 51274 1.57 3.231 0.004905 salvador homolog 1 (Drosophila) 60485 1.56 3.072 0.006495 sterol O-acyltransferase (acyl-Coenzyme A: cholesterol 6646 1.55 2.999 0.007079 acyltransferase) 1 poly (ADP-ribose) polymerase family, member 10 84875 1.55 2.919 0.008234 chromosome 9 open reading frame 64 84267 1.55 3.236 0.003801 zinc finger protein 639 51193 1.54 2.908 0.008231 interferon induced with helicase C domain 1 64135 1.54 2.996 0.006998 CCR4-NOT transcription complex, subunit 6-like 246175 1.54 3.053 0.006269 nuclear receptor binding factor 2 29982 1.53 3.391 0.002628 DKFZP564J0863 protein 25923 1.53 2.943 0.007591 numb homolog (Drosophila) 8650 1.52 3.257 0.003616 nucleoporin 160kDa 23279 1.52 2.784 0.012851 Ku70-binding protein 3 91419 1.52 3.09 0.005398 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N- 2590 1.5 3.113 0.006841 acetylgalactosaminyltransferase 2 (GalNAc-T2) Chromosome 14 open reading frame 126 112487 1.46 3.452 0.002286 poly(A) polymerase alpha 10914 1.45 3.397 0.002947 tight junction protein 1 (zona occludens 1) 7082 1.42 3.707 0.001491 cornichon homolog (Drosophila) 10175 1.42 3.916 0.000744 dipeptidylpeptidase 8 54878 1.41 3.548 0.002131 Supplemental table 2. Genes downregulated in tumors containing phosphorylated STAT3 and phosphorylated STAT5 compared to tumors with only phosphorylated STAT3. gene name Gene ID fold t statistic P value change Hypothetical protein MGC15396 91369 -18.12 -2.692 0.01344 NADH dehydrogenase (ubiquinone) Fe-S protein 7, 374291 -5.13 -2.156 0.042457 20kDa (NADH-coenzyme Q reductase) hypothetical protein MGC34732 220047 -5.07 -2.273 0.034003 FERM, RhoGEF (ARHGEF) and pleckstrin domain 10160 -4.42 -2.141 0.043622 protein 1 (chondrocyte-derived) Hypothetical protein LOC284412 284412 -4.05 -2.115 0.047995 leucine rich repeat containing 2 79442 -3.74 -2.201 0.041801 protein kinase C binding protein 1 23613 -3.38 -2.404 0.029583 EMI domain containing 2 136227 -3.23 -2.448 0.022817 Tripartite motif-containing 5 85363 -2.42 -2.143 0.048969 enolase 2 (gamma, neuronal) 2026 -2.19 -2.599 0.02232 serine arginine-rich pre-mRNA splicing factor SR- 58506 -2.18 -3.363 0.003889 A1 regulatory factor X, 2 (influences HLA class II 5990 -2.05 -2.299 0.03555 expression) homeo box D9 3235 -2.02 -2.187 0.043673 DNA segment on chromosome X (unique) 9879 8270 -2.02 -2.45 0.033725 expressed sequence Nedd4 binding protein 1 9683 -2 -2.26 0.048235 Leucine-rich repeat LGI family, member 4 163175 -1.99 -2.239 0.044569 adaptor-related protein complex 2, alpha 1 subunit 160 -1.98 -3.236 0.004649 collagen, type XXV, alpha 1 /// collagen, type XXV, 84570 -1.96 -2.393 0.03222 alpha 1 protein kinase
Load more

Recommended publications
  • The Porcine Major Histocompatibility Complex and Related Paralogous Regions: a Review Patrick Chardon, Christine Renard, Claire Gaillard, Marcel Vaiman
    The porcine Major Histocompatibility Complex and related paralogous regions: a review Patrick Chardon, Christine Renard, Claire Gaillard, Marcel Vaiman To cite this version: Patrick Chardon, Christine Renard, Claire Gaillard, Marcel Vaiman. The porcine Major Histocom- patibility Complex and related paralogous regions: a review. Genetics Selection Evolution, BioMed Central, 2000, 32 (2), pp.109-128. 10.1051/gse:2000101. hal-00894302 HAL Id: hal-00894302 https://hal.archives-ouvertes.fr/hal-00894302 Submitted on 1 Jan 2000 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Genet. Sel. Evol. 32 (2000) 109–128 109 c INRA, EDP Sciences Review The porcine Major Histocompatibility Complex and related paralogous regions: a review Patrick CHARDON, Christine RENARD, Claire ROGEL GAILLARD, Marcel VAIMAN Laboratoire de radiobiologie et d’etude du genome, Departement de genetique animale, Institut national de la recherche agronomique, Commissariat al’energie atomique, 78352, Jouy-en-Josas Cedex, France (Received 18 November 1999; accepted 17 January 2000) Abstract – The physical alignment of the entire region of the pig major histocompat- ibility complex (MHC) has been almost completed. In swine, the MHC is called the SLA (swine leukocyte antigen) and most of its class I region has been sequenced.
    [Show full text]
  • The Milk-Derived Fusion Peptide, ACFP, Suppresses The
    Zhou et al. BMC Cancer (2016) 16:246 DOI 10.1186/s12885-016-2281-6 RESEARCH ARTICLE Open Access The milk-derived fusion peptide, ACFP, suppresses the growth of primary human ovarian cancer cells by regulating apoptotic gene expression and signaling pathways Juan Zhou1†, Mengjing Zhao1†, Yigui Tang1, Jing Wang2, Cai Wei3, Fang Gu1, Ting Lei3, Zhiwu Chen4 and Yide Qin1* Abstract Background: ACFP is an anti-cancer fusion peptide derived from bovine milk protein. This study was to investigate the anti-cancer function and underlying mechanisms of ACFP in ovarian cancer. Methods: Fresh ovarian tumor tissues were collected from 53 patients who underwent initial debulking surgery, and primary cancer cells were cultured. Normal ovarian surface epithelium cells (NOSECs), isolated from 7 patients who underwent surgery for uterine fibromas, were used as normal control tissue. Anti-viabilities of ACFP were assessed by WST-1 (water-soluble tetrazolium 1), and apoptosis was measured using a flow cytometry-based assay. Gene expression profiles of ovarian cancer cells treated with ACFP were generated by cDNA microarray, and the expression of apoptotic-specific genes, such as bcl-xl, bax, akt, caspase-3, CDC25C and cyclinB1, was assessed by real time PCR and western blot analysis. Results: Treatment with ACFP inhibited the viability and promoted apoptosis of primary ovarian cancer cells but exhibited little or no cytotoxicity toward normal primary ovarian cells. Mechanistically, the anti-cancer effects of ACFP in ovarian cells were shown to occur partially via changes in gene expression and related signal pathways. Gene expression profiling highlighted that ACFP treatment in ovarian cancer cells repressed the expression of bcl-xl, akt, CDC25C and cyclinB1andpromotedtheexpressionofbax and caspase-3 in a time- and dose-dependent manner.
    [Show full text]
  • Effects of Chronic Stress on Prefrontal Cortex Transcriptome in Mice Displaying Different Genetic Backgrounds
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Springer - Publisher Connector J Mol Neurosci (2013) 50:33–57 DOI 10.1007/s12031-012-9850-1 Effects of Chronic Stress on Prefrontal Cortex Transcriptome in Mice Displaying Different Genetic Backgrounds Pawel Lisowski & Marek Wieczorek & Joanna Goscik & Grzegorz R. Juszczak & Adrian M. Stankiewicz & Lech Zwierzchowski & Artur H. Swiergiel Received: 14 May 2012 /Accepted: 25 June 2012 /Published online: 27 July 2012 # The Author(s) 2012. This article is published with open access at Springerlink.com Abstract There is increasing evidence that depression signaling pathway (Clic6, Drd1a,andPpp1r1b). LA derives from the impact of environmental pressure on transcriptome affected by CMS was associated with genetically susceptible individuals. We analyzed the genes involved in behavioral response to stimulus effects of chronic mild stress (CMS) on prefrontal cor- (Fcer1g, Rasd2, S100a8, S100a9, Crhr1, Grm5,and tex transcriptome of two strains of mice bred for high Prkcc), immune effector processes (Fcer1g, Mpo,and (HA)and low (LA) swim stress-induced analgesia that Igh-VJ558), diacylglycerol binding (Rasgrp1, Dgke, differ in basal transcriptomic profiles and depression- Dgkg,andPrkcc), and long-term depression (Crhr1, like behaviors. We found that CMS affected 96 and 92 Grm5,andPrkcc) and/or coding elements of dendrites genes in HA and LA mice, respectively. Among genes (Crmp1, Cntnap4,andPrkcc) and myelin proteins with the same expression pattern in both strains after (Gpm6a, Mal,andMog). The results indicate significant CMS, we observed robust upregulation of Ttr gene contribution of genetic background to differences in coding transthyretin involved in amyloidosis, seizures, stress response gene expression in the mouse prefrontal stroke-like episodes, or dementia.
    [Show full text]
  • Role of Genomic Variants in the Response to Biologics Targeting Common Autoimmune Disorders
    Role of genomic variants in the response to biologics targeting common autoimmune disorders by Gordana Lenert, PhD The thesis submitted to the Faculty of Graduate and Postdoctoral Affairs in partial fulfillment of the requirements for the degree of Master of Science Ottawa-Carleton Joint Program in Bioinformatics Carleton University Ottawa, Canada © 2016 Gordana Lenert Abstract Autoimmune diseases (AID) are common chronic inflammatory conditions initiated by the loss of the immunological tolerance to self-antigens. Chronic immune response and uncontrolled inflammation provoke diverse clinical manifestations, causing impairment of various tissues, organs or organ systems. To avoid disability and death, AID must be managed in clinical practice over long periods with complex and closely controlled medication regimens. The anti-tumor necrosis factor biologics (aTNFs) are targeted therapeutic drugs used for AID management. However, in spite of being very successful therapeutics, aTNFs are not able to induce remission in one third of AID phenotypes. In our research, we investigated genomic variability of AID phenotypes in order to explain unpredictable lack of response to aTNFs. Our hypothesis is that key genetic factors, responsible for the aTNFs unresponsiveness, are positioned at the crossroads between aTNF therapeutic processes that generate remission and pathogenic or disease processes that lead to AID phenotypes expression. In order to find these key genetic factors at the intersection of the curative and the disease pathways, we combined genomic variation data collected from publicly available curated AID genome wide association studies (AID GWAS) for each disease. Using collected data, we performed prioritization of genes and other genomic structures, defined the key disease pathways and networks, and related the results with the known data by the bioinformatics approaches.
    [Show full text]
  • Genes Between the Complement Cluster and HLA-B THOMAS SPIES*, MAUREEN BRESNAHAN, and JACK L
    Proc. Nati. Acad. Sci. USA Vol. 86, pp. 8955-8958, November 1989 Immunology Human major histocompatibility complex contains a minimum of 19 genes between the complement cluster and HLA-B THOMAS SPIES*, MAUREEN BRESNAHAN, AND JACK L. STROMINGER Department of Biochemistry and Molecular Biology, Harvard University, Cambridge, MA 02138 Contributed by Jack L. Strominger, August 15, 1989 ABSTRACT A 600-kilobase (kb) DNA segment from the meric side, the gene for 21-OHB is 350 kb distant from the human major histocompatibility complex (MHC) class HI nearest class II locus, DR. Presently, no genes have been region was isolated by extension of a previous 435-kb chromo- localized within this region. On the telomeric side, the gene some walk. The contiguous series of cloned overlapping for C2 is separated by 600 kb from the proximal class I locus, cosmids contains the entire 555-kb interval between C2 in the HLA-B. This interval includes the genes for the tumor complement gene cluster and HLA-B. This region is known to necrosis factors (TNFs) a and 83 and the major heat shock encode the tumor necrosis factors (TNFs) a and (, B144, and protein HSP70 (7, 8, 11). the major heat shock protein HSP70. Moreover, a cluster of To identify genes within the MHC class III region, a 435-kb genes, BAT1-BAT5 (HLA-B-associated transcripts) has been genomic segment centromeric to HLA-B has recently been localized in the vicinity of the genes for TNFa and TNF3. An isolated by chromosome walking with overlapping cosmids additional four genes were identified by isolation of corre- (12).
    [Show full text]
  • Genetic Analysis of Over 1 Million People Identifies 535 New Loci Associated with Blood Pressure Traits
    ARTICLES https://doi.org/10.1038/s41588-018-0205-x Genetic analysis of over 1 million people identifies 535 new loci associated with blood pressure traits High blood pressure is a highly heritable and modifiable risk factor for cardiovascular disease. We report the largest genetic association study of blood pressure traits (systolic, diastolic and pulse pressure) to date in over 1 million people of European ancestry. We identify 535 novel blood pressure loci that not only offer new biological insights into blood pressure regulation but also highlight shared genetic architecture between blood pressure and lifestyle exposures. Our findings identify new biological pathways for blood pressure regulation with potential for improved cardiovascular disease prevention in the future. igh blood pressure is a leading heritable risk factor for stroke at the locus) after excluding the HLA region (chr. 6: 25–34 MB) and and coronary artery disease, responsible for an estimated 7.8 all SNPs in LD (r2 ≥ 0.1) or ± 500 kb from any previously validated million deaths and 148 million disability life years lost world- blood pressure–associated SNPs at the 274 published loci. Our rep- H 1 −8 wide in 2015 alone . Blood pressure is determined by complex inter- lication criteria were genome-wide significance (P < 5 × 10 ) in the actions between life-course exposures and genetic background2–4. combined meta-analysis, P <​ 0.01 in the replication data, and con- Previous genetic association studies have identified and validated cordant direction of effect between discovery and replication. variants at 274 loci with modest effects on population blood pres- We also undertook a one-stage design to reduce type II error sure, explaining in aggregate ~ 3% of the trait variance5–12.
    [Show full text]
  • Xenopus in the Amphibian Ancestral Organization of the MHC Revealed
    Ancestral Organization of the MHC Revealed in the Amphibian Xenopus Yuko Ohta, Wilfried Goetz, M. Zulfiquer Hossain, Masaru Nonaka and Martin F. Flajnik This information is current as of September 26, 2021. J Immunol 2006; 176:3674-3685; ; doi: 10.4049/jimmunol.176.6.3674 http://www.jimmunol.org/content/176/6/3674 Downloaded from References This article cites 70 articles, 21 of which you can access for free at: http://www.jimmunol.org/content/176/6/3674.full#ref-list-1 Why The JI? Submit online. http://www.jimmunol.org/ • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average by guest on September 26, 2021 Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2006 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Ancestral Organization of the MHC Revealed in the Amphibian Xenopus1 Yuko Ohta,2* Wilfried Goetz,* M. Zulfiquer Hossain,* Masaru Nonaka,† and Martin F. Flajnik* With the advent of the Xenopus tropicalis genome project, we analyzed scaffolds containing MHC genes. On eight scaffolds encompassing 3.65 Mbp, 122 MHC genes were found of which 110 genes were annotated.
    [Show full text]
  • SPAG7 Is a Candidate Gene for the Periodic Fever, Aphthous Stomatitis, Pharyngitis and Adenopathy (PFAPA) Syndrome
    Genes and Immunity (2014) 15, 190–194 & 2014 Macmillan Publishers Limited All rights reserved 1466-4879/14 www.nature.com/gene SHORT COMMUNICATION SPAG7 is a candidate gene for the periodic fever, aphthous stomatitis, pharyngitis and adenopathy (PFAPA) syndrome S Bens1, T Zichner2, AM Stu¨tz2, A Caliebe1, R Wagener1, K Hoff1,3, JO Korbel2, P von Bismarck4 and R Siebert1 Periodic fever, aphthous stomatitis, pharyngitis and adenopathy (PFAPA) syndrome is an auto-inflammatory disease for which a genetic basis has been postulated. Nevertheless, in contrast to the other periodic fever syndromes, no candidate genes have yet been identified. By cloning, following long insert size paired-end sequencing, of a de novo chromosomal translocation t(10;17)(q11.2;p13) in a patient with typical PFAPA syndrome lacking mutations in genes associated with other periodic fever syndromes we identified SPAG7 as a candidate gene for PFAPA. SPAG7 protein is expressed in tissues affected by PFAPA and has been functionally linked to antiviral and inflammatory responses. Haploinsufficiency of SPAG7 due to a microdeletion at the translocation breakpoint leading to loss of exons 2–7 from one allele was associated with PFAPA in the index. Sequence analyses of SPAG7 in additional patients with PFAPA point to genetic heterogeneity or alternative mechanisms of SPAG7 deregulation, such as somatic or epigenetic changes. Genes and Immunity (2014) 15, 190–194; doi:10.1038/gene.2013.73; published online 23 January 2014 Keywords: SPAG7; PFAPA; periodic fever; chromosomal translocation INTRODUCTION of 84 (45%) patients there was a family history of recurrent fever.9 Periodic fever, aphthous stomatitis, pharyngitis and adenopathy The high frequency of a recurrent fever other than PFAPA in the (PFAPA) syndrome is an auto-inflammatory disorder first described families of the patients is in line with the observation that patients by Marshall et al.
    [Show full text]
  • BAT5 (ABHD16A) Rabbit Polyclonal Antibody – TA338460 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA338460 BAT5 (ABHD16A) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-ABHD16Aantibody: synthetic peptide directed towards the N terminal of human BAT5. Synthetic peptide located within the following region: VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 63 kDa Gene Name: abhydrolase domain containing 16A Database Link: NP_066983 Entrez Gene 7920 Human O95870 Background: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. ABHD16Ais thought to be involved in some aspects of immunity.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity. This product is to be used for laboratory only. Not for diagnostic or therapeutic use.
    [Show full text]
  • Supporting Information
    Supporting Information Poulogiannis et al. 10.1073/pnas.1009941107 SI Materials and Methods Loss of Heterozygosity (LOH) Analysis of PARK2. Seven microsatellite Bioinformatic Analysis of Genome and Transcriptome Data. The markers (D6S1550, D6S253, D6S305, D6S955, D6S980, D6S1599, aCGH package in R was used to identify significant DNA copy and D6S396) were amplified for LOH analysis within the PARK2 number (DCN) changes in our collection of 100 sporadic CRCs locus using primers that were previously described (8). (1) (Gene Expression Omnibus, accession no. GSE12520). The MSP of the PARK2 Promoter. CpG sites within the PARK2 promoter aCGH analysis of cell lines and liver metastases was derived region were detected using the Methprimer software (http://www. from published data (2, 3). Chromosome 6 tiling-path array- urogene.org/methprimer/index.html). Methylation-specificand CGH was used to identify the smallest and most frequently al- control primers were designed using the Primo MSP software tered regions of DNA copy number change on chromosome 6. (http://www.changbioscience.com/primo/primom.html); bisulfite An integrative approach was used to correlate expression pro- modification of genomic DNA was performed as described pre- files with genomic copy number data from a SNP array from the viously (9). All tumor DNA samples from primary CRC tumors same tumors (n = 48) (4) (GSE16125), using Pearson’s corre- (n = 100) and CRC lines (n = 5), as well as those from the leukemia lation coefficient analysis to identify the relationships between cell lines KG-1a (acute myeloid leukemia, AML), U937 (acute DNA copy number changes and gene expression of those genes lymphoblastic leukemia, ALL), and Raji (Burkitt lymphoma, BL) SssI located within the small frequently altered regions of DCN were screened as part of this analysis.
    [Show full text]
  • De Novo Transcriptome Analysis and Glucosinolate Profiling in Watercress (Nasturtium Officinale R
    Jeon et al. BMC Genomics (2017) 18:401 DOI 10.1186/s12864-017-3792-5 RESEARCH ARTICLE Open Access De novo transcriptome analysis and glucosinolate profiling in watercress (Nasturtium officinale R. Br.) Jin Jeon1†, Sun Ju Bong1†, Jong Seok Park2, Young-Kyu Park3, Mariadhas Valan Arasu4, Naif Abdullah Al-Dhabi4 and Sang Un Park1* Abstract Background: Watercress (Nasturtium officinale R. Br.) is an aquatic herb species that is a rich source of secondary metabolites such as glucosinolates. Among these glucosinolates, watercress contains high amounts of gluconasturtiin (2-phenethyl glucosinolate) and its hydrolysis product, 2-phennethyl isothiocyanate, which plays a role in suppressing tumor growth. However, the use of N. officinale as a source of herbal medicines is currently limited due to insufficient genomic and physiological information. Results: To acquire precise information on glucosinolate biosynthesis in N. officinale, we performed a comprehensive analysis of the transcriptome and metabolome of different organs of N. officinale. Transcriptome analysis of N. officinale seedlings yielded 69,570,892 raw reads. These reads were assembled into 69,635 transcripts, 64,876 of which were annotated to transcripts in public databases. On the basis of the functional annotation of N. officinale, we identified 33 candidate genes encoding enzymes related to glucosinolate biosynthetic pathways and analyzed the expression of these genes in the leaves, stems, roots, flowers, and seeds of N. officinale. The expression of NoMYB28 and NoMYB29, the main regulators of aliphatic glucosinolate biosynthesis, was highest in the stems, whereas the key regulators of indolic glucosinolate biosynthesis, such as NoDof1.1, NoMYB34, NoMYB51, and NoMYB122, were strongly expressed in the roots.
    [Show full text]
  • Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses By
    Downloaded from http://www.jimmunol.org/ by guest on September 23, 2021 Inducing is online at: average * The Journal of Immunology , 11 of which you can access for free at: 2013; 191:2956-2966; Prepublished online 16 from submission to initial decision 4 weeks from acceptance to publication August 2013; doi: 10.4049/jimmunol.1300376 http://www.jimmunol.org/content/191/6/2956 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol cites 49 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 This article http://www.jimmunol.org/content/191/6/2956.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 23, 2021. The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN.
    [Show full text]