ANNUAL REPORT 2007–08 ANNUAL REPORT 2007–08 ANNUAL REPORT 2007–08 The National Gallery of Australia is a Commonwealth authority established under the National Gallery Act 1975.
The vision of the National Gallery of Australia is the cultural enrichment of all Australians through access to their national art gallery, the quality of the national collection, the exceptional displays, exhibitions and programs, and the professionalism of Gallery staff.
The Gallery’s governing body, the Council of the National Gallery of Australia, has expertise in arts administration, corporate governance, administration and financial and business management.
In 2007–08 the National Gallery of Australia received an appropriation from the Australian Government totalling $58.243 million (including an equity injection of $4 million for development of the national collection and $11.797 million for Stage 1 of the building project), raised $9.624 million, and employed 250.7 full-time equivalent staff.
© National Gallery of Australia 2008
ISSN 1323 5192
All rights reserved. No part of this publication can be reproduced or transmitted in any form or by any means, electronic or mechanical, including photocopy, recording or any information storage and retrieval system, without permission in writing from the publisher.
Produced by the Publishing Department of the National Gallery of Australia
Edited by Eric Meredith
Designed by ZOO
Printed by Blue Star Print, Canberra
National Gallery of Australia GPO Box 1150 Canberra ACT 2601 nga.gov.au/Reports
Cover: Frederick McCubbin Violet and goldd 1911 (detail) oil on canvas 87.0 x 144.5 cm National Gallery of Australia, Canberra Purchased with the generous assistance of the Hon. Mrs Ashley Dawson-Damer and John Wylie, AM, and Myriam Wylie 2008
Back cover: Tamil Nadu, India Shiva as Lord of the Dancee [Natarajaa] 11th–12th century bronze 128.5 x 106.0 x 40.0 cm National Gallery of Australia, Canberra Purchased with the assistance of the National Gallery of Australia Foundation 2008
Director’s report: The National Gallery of Australia celebrated its twenty-fifth anniversary by lighting up the building with projected images of major works in the national collection. September 2008
The Hon. Peter Garrett, AM, MP Minister for the Environment, Heritage and the Arts Parliament House CANBERRA ACT 2600
Dear Minister
On behalf of the Council of the National Gallery of Australia, I have pleasure in submitting to you, for presentation to each House of Parliament, the National Gallery of Australia’s Annual Report covering the period 1 July 2007 to 30 June 2008.
This report is submitted to you in accordance with section 9 of the Commonwealth Authorities and Companies Act 19977 and the National Gallery Act 19755. The Performance Report has been prepared in conformity with the Commonwealth Authorities and Companies (Report of Operations) Orders 2008. The financial statements have been prepared in accordance with the Finance Minister’s Orders made under the Commonwealth Authorities and Companies Act 1997.
Yours sincerely
Rupert Myer AM Chairman of Council CONTENTS
LETTER OF TRANSMITTAL 1
CHAIRMAN’S FOREWORD 5
DIRECTOR’S REPORT 9
CORPORATE OVERVIEW 12
PERFORMANCE REPORT 2007–08 17
Outcome and Outputs 18
Report against Strategic Plan 2007–10 21
GOAL 1 Build and maintain an outstanding national art collection 22
GOAL 2 Increase the audience for and engagement with the exhibitions and programs of the National Gallery of Australia 32
GOAL 3 Create a welcoming and engaging visitor experience 47
GOAL 4 Secure and strategically manage resources to support Gallery operations and activities 49
GOAL 5 Provide a safe and productive working environment for all staff appropriate to the Australian Public Sector and art museum standards 52
GOAL 6 Ensure the highest standards of corporate governance 56
GOAL 7 Build productive relationships with Government and other stakeholders 57
FINANCIAL REPORTS 59 APPENDICES 101
APPENDIX 1 Council of the National Gallery of Australia 102
APPENDIX 2 Management structure at 30 June 2008 104
APPENDIX 3 Staff of the National Gallery of Australia at 30 June 2008 105
APPENDIX 4 Acquisitions 2007–08 107
APPENDIX 5 Total acquisitions including purchases and gifts 2002–03 to 2007–08 161
APPENDIX 6 Exhibitions and new displays shown at the National Gallery of Australia 2007–08 162
APPENDIX 7 Attendances 2002–03 to 2007–08 163
APPENDIX 8 Travelling exhibitions 2007–08 164
APPENDIX 9 Outward loans to exhibitions – Australia and international 166
APPENDIX 10 Inward loans 174
APPENDIX 11 Outward loans including travelling exhibitions 2002–03 to 2007–08 182
APPENDIX 12 National Gallery of Australia sponsors 2007–08 183
APPENDIX 13 National Gallery of Australia volunteers at 30 June 2008 185
APPENDIX 14 Publications of the National Gallery of Australia 2007–08 187
APPENDIX 15 Website visitation 188
APPENDIX 16 Consultants 2007–08 190
APPENDIX 17 Compliance index and contact officers 191
INDEX 193 National Gallery of Australia Council as at 30 June 2008: (l–r) Mrs Roslynne Bracher, AM, the Hon. Ian Callinan, AC, Dr Ron Radford, AM, the Hon. Mrs Ashley Dawson-Damer, Mrs Roslyn Packer, AO, Mr Warwick Hemsley, Mr John Calvert-Jones, AM, Mr Charles Curran, AC, Mr Rupert Myer, AM CHAIRMAN’S FOREWORD
The past year marked a significant milestone in the and its engagement with the public. During the history of the Gallery as it celebrated the twenty- year, the Gallery Council continued its focus on fifth anniversary of its opening to the public. Many implementing policies and structural changes to of the Gallery’s supporters, sponsors and benefactors achieve Director Ron Radford’s Vision for the from around Australia and abroad joined current National Gallery of Australia. and former Council members, directors, staff and volunteers during the course of the year. The Many contributions have made the Gallery a launch of the National Indigenous Art Triennial, the ‘must visit’ destination. As the year ended, due commencement of Stage 1 of the building extension, largely to the efforts of the National Gallery of the acquisition of great works of art, many Australia Foundation, our target of securing through the wonderful generosity of benefactors, $25 million in gifts, pledges, sponsorships and the continuation of our international exhibition bequests from the private sector from 2006 to program and the opening of several important new 2008 was achieved. I would like to thank the many galleries will remain as permanent reminders of this generous benefactors and sponsors that contributed momentous year. to this exceptional achievement and acknowledge the leadership of Mr Charles Curran, AC, and On the occasion of the anniversary, I spoke of our the Board of the National Gallery of Australia responsibility at the Gallery to treasure our nation’s Foundation in this endeavour. significant works of art, to share them, to study them, to add to them, to display them to the best I would also like to acknowledge the efforts of of our ability, but above all to look after them, to my colleagues on the Gallery Council for their hold them safely so that others might come to gain ongoing efforts to ensure the success of the Gallery. knowledge, to delight and to gain contentment In this year Mr Robert Champion de Crespigny, from them, and to be stimulated by them to do AC, and Ms Lee Liberman concluded their service great things. on the Council. I would like to acknowledge their significant contributions while welcoming to the This notion of the Gallery as a place of learning Council the Hon. Ian Callinan, AC. and inspiration was revisited when the Director Ron Radford and I were privileged to participate Mr Charles Curran, AC, continued as Deputy Chair in the 2020 Summit earlier this year. The Summit of the Gallery Council and Chair of the Building group looking at major galleries and institutions Committee as well as Chair of the National Gallery acknowledged the multi-dimensional roles that of Australia Foundation. Mrs Roslyn Packer, AO, they perform. In particular, the group thought continued as Chair of the Acquisitions Committee that the contribution of these organisations to the and Mr Warwick Hemsley as Chair of the Finance, education curriculum is absolutely crucial. The Risk Management and Audit Committee. I thank group’s ambition was that in 2020 there will be them and all my colleagues on the Council as well universal access for all students to the materials and as the Board of the National Gallery of Australia collections of all major cultural institutions as part Foundation for their hard work, generous support of the education process. and sincere commitment to the Gallery. Many of them provided an extraordinary level of support for The Gallery shares that aspiration. It is a key the development of the national collection and the component of our overall responsibility to National Gallery of Australia Council Exhibitions preserve, develop and promote the Gallery’s Fund during the year. collection, its outstanding reputation for excellence
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 5 I would also like to warmly thank all of the Gallery guides and the many volunteers who continue to make an outstanding contribution to the work of the Gallery.
The Council acknowledges with appreciation the ongoing support of the Australian Government through the Hon. Kevin Rudd, MP, Prime Minister of Australia, and the Hon. Peter Garrett, AM, MP, Minister for the Environment, Heritage and the Arts, and Departmental officials. The support provided by Ministers in the former government, particularly with the building project, is also acknowledged with appreciation.
I would especially like to acknowledge the extraordinary efforts of Director Ron Radford, AM, and the Gallery’s dedicated and talented staff and, on behalf of the Council, express my sincere appreciation for another year of outstanding achievement.
Rupert Myer, AM
6 NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 7 8 DIRECTOR’S REPORT
Among the many major Australian works of art on 12 October 2007. To mark the occasion we acquired was the great Clifford Possum Tjapaltjarri’s opened our first National Indigenous Art Triennial, Warlugulong 1977, purchased with the generous held a huge national art celebration and projected assistance of Roslynne Bracher and the dramatic changing displays of our masterpieces onto Paspaley Family, David and Michelle Coe, and the face of our building. Charles Curran, AC, and Eva Curran. A brilliant collection of Albert Namatjira watercolours were This momentous year saw the commencement of generously given by Gordon Darling, AC, CMG, and Stage 1 of our building extension, which includes, Marilyn Darling, long-time supporters of the Gallery. among other things, an accessible, more functional Two important works by the major Australian entrance and Australian Indigenous galleries – the Impressionist Frederick McCubbin were acquired: At first new galleries for the permanent collection since the falling of the year 1886 and Violet and goldd 1911, the gallery building was conceived in 1969. The year the latter with the assistance of Ashley Dawson- saw impressive new collection displays and a variety Damer and John Wylie, AM, and Myriam Wylie. of major exhibitions, a record number touring. The purchase of an outstanding nineteenth-century It also saw very successful fundraising, mainly for cedar settee made in Tasmania in the late 1820s important acquisitions in all collecting areas to adds to our small, high-quality colonial furniture permanently mark this silver anniversary. This collection. The Gallery acquired the comprehensive anniversary year also witnessed the highest Gallery and very important Agapitos/Wilson collection attendance in six years. of Australian Surrealism (285 oil paintings, watercolours, drawings, prints, photographs and During the year we completed the radical sculptures). The Gallery is grateful for the generosity reconfiguring of our collection spaces, which we of the late James Agapitos, OAM, and Ray Wilson, begun two years ago. The results of these changes OAM. We were given by Denis Savill the significant began with the opening of the new Indian gallery, early John Perceval painting Floating mask 1 1943, the Southeast Asian gallery, the international mixed which added to our now strong surrealist collection. media displays (Impressionism to Pop Art), and the National Australia Bank Sculpture Gallery, and The contemporary Australian collection was finished this year with the opening of the new Pacific greatly enriched by the gift of Rosalie Gascoigne’s gallery, the reconfigured early Australian galleries last masterpiece, the ten-panel work Earth 1999, and East Asian gallery. Three new large showcases in by Ben Gascoigne, AO, and the Gascoigne family. the foyer feature new displays of our Mesoamerican Through funds from the Gordon Darling Australia collection, African collection and Polynesian Pacific Print Fund, we substantially strengthened collection. (Further major collection display changes our contemporary print collection by purchasing are connected to the completion of Stage 1 of our four major contemporary print archives. These building extension.) acquisitions included the Red Hand archive, the Viridian Press archive, the Cicada archive and Our twenty-fifth anniversary celebrations the Larry Rawling archive. The Gallery took the included an appeal to raise $25 million, largely opportunity of our inaugural National Indigenous for acquisitions. I am pleased to record that by Art Triennial to buy many contemporary Australian 30 June 2008 we had exceeded our target. It has Indigenous works. Among the most significant therefore been a great year for acquisitions. was the large bronze sculpture by Dennis Nona, Ubirikubiri 2007, a gift of John Calvert-Jones, It was a spectacularly successful year for Australian AM, and Janet Calvert-Jones, and Doreen Reid acquisitions, both Indigenous and non-Indigenous. Nakamarra’s Untitled 2007, purchased with assistance from the Masterpieces for the Nation Fund.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 9 The Gallery acquired what is arguably its most There were 9931 works acquired altogether (almost impressive and significant Asian sculpture with 7000 of them Indonesian photographs) and these the acquisition of the eleventh-century bronze of are listed in Appendix 4. a dynamic Shiva Nataraja from the classic Chola period. This striking and unusually large bronze The Gallery is very pleased to record that for now dramatically commences our display in the the sixth successive year we have increased our Indian gallery. It was acquired with the assistance attendances both at the Gallery and to our travelling of many generous benefactors to mark our twenty- exhibitions with more than a million visitors. fifth anniversary. To this growing significant Indian This comprised more than half a million visitors collection we added two pichhavaii (painted temple to the Gallery itself and a further 564000 to our hangings), one of them from the eighteenth century, travelling exhibitions, which toured 88 venues Autumn moon festivall, was acquired through the around Australia and overseas. These figures do not Masterpieces for the Nation Fund. The Gallery’s take into account that a further 5.16 million people Asian collection was expanded with a number of have seen over 1500 works lent by the Gallery to wooden animist sculptures from our geographic other exhibitions around Australia and the world. region, above all the fourteenth-century funerary In addition, we have had 1.18 million visits to our figure (hampatongg) from Kalimantan, Indonesia. website accessing 3.8 million pages. We continued to add to our large Asian textile collection. Most importantly we acquired the very The major blockbuster exhibition for the year significant collection of almost 7000 Indonesian was the popular Turner to Monet: the triumph of photographs dating from the 1860s to 1940s from landscape, which explored the rise of landscape the Leo Haks collection in Amsterdam. Adding painting in Western art in the nineteenth century, greatly to our fast-growing Asia–Pacific photography including in Europe, America, Australia and collections, this is now the largest collection of early elsewhere. Landscapes were borrowed from Indonesian photography outside the Netherlands. 40 collections around the world and the exhibition was attended by the outstanding number of more Our generous Orde Poynton Bequest Fund than 180000 visitors of whom 42 per cent were first- enabled the Gallery to purchase a number of time visitors to the Gallery. major nineteenth- and early twentieth-century European prints. These included Edgar Degas’ Other major exhibitions included the first etching La sortie du bain [Leaving the bathh] c.1882, comprehensive retrospective of the work of Paul Gauguin’s lithograph Manao Tupapaou George W Lambert (1873–1930), and the (Elle pense au revenant)) [Watched by the Spirits of retrospective of local dynamic artist Richard Larter the Deadd] 1984, Max Beckmann’s etching Frauenbad (b. 1929). Our inaugural National Indigenous Art [Women’s bathhouse] and two colour lithographs Triennial, Culture Warriorss, which opened on our by Wassily Kandinsky. Tony and Carol Berg also twenty-fifth anniversary day, is touring the state generously gave us two Kandinsky lithographs from galleries and then travelling to Washington, DC. the same Kleine Weltenn series of 1922. We purchased It has been generously sponsored by BHP Billiton. at auction a hand-painted courtier’s hat designed by Highlights of the newly acquired Agapitos/Wilson Matisse as part of the Ballets Russes production of collection of Australian Surrealism were shown Chant du rossignol first performed in 1920. in the Gallery for the first time and this proved a very popular exhibition. A rare nineteenth-century Our revived Pacific Arts collection acquired a Japanese exhibition, Black robe white mist: art of number of very notable works. Outstanding was the Japanese Buddhist nun Rengetsu, was assembled a Maori cloak of a rare design dating from the by the Gallery and shown in the restored East early nineteenth century, an eighteenth-century Asian gallery before touring. The Gallery also carved war club from the Marquesas Islands, and a showed for the first time its extensive collection Solomon Island spirit figure, adaroo, carved in the of Robert Rauschenberg and VIP: very important 1930s by the artist known as Tigoana. photographs 1840s–1940ss, an exhibition of some of our finest early European, American and Australian
10 I thank all the numerous Gallery volunteers who at the Gallery and a complete list appears in worked for the Gallery throughout the year. I Appendix 6. would also like to thank my hard-working staff for this twenty-fifth anniversary year of considerable A record number of 14 travelling exhibitions marked achievements. I especially would like to thank my the twenty-fifth anniversary year around Australia. assistant directors Shanthini Naidoo, Simon Elliott There are too many to single out here but some and Adam Worrall and the Deputy Director of the exhibitions mentioned above toured. All Alan Froud. I also appreciate the great support travelling exhibitions are listed in Appendix 8. One and generosity of the Gallery Council, particularly of the outstanding touring exhibitions is Ocean to Chairman Rupert Myer, AM. Outback: Australian landscape painting 1850–1950, especially curated for regional Australia. Already 70000 visitors have seen this large Australian landscape show drawn from our collection to celebrate our twenty-fifth anniversary and it continues to tour Australia. It was sponsored by R M Williams, the National Gallery of Australia Council Exhibitions Fund and Visions of Australia. Ron Radford, AM Our major overseas exhibition Andy to Ozz explored the inspiration of Andy Warhol on Australian art. The exhibition was shown at the Andy Warhol Museum in Pittsburgh in the United States of America. This was also sponsored by the National Gallery of Australia Council Exhibitions Fund.
Towards the end of the year the National Safety Council of Australia undertook an audit of the Gallery’s overall performance in occupational health and safety. While the Gallery’s rating was not known at the end of the year under review, in the exit briefing of senior managers the auditor noted our strong continuing positive work on, and commitment to, occupational health and safety and highlighted a number of very positive improvements.
During the year over 4700 works received conservation treatment and 10245 condition checks were undertaken. The Australian painting reframing program continued for the third year with a further 80 works reframed to ensure that paintings are presented in appropriate period-style frames similar to artists’ original intentions. Furthermore this year, we initiated a framing project for historical photographs and 380 works were framed in different period frames for the forthcoming exhibition Picture paradise: Asia–Pacific photography 1840–19400. This is the first time an institution has shown nineteenth-century photographs in appropriate period frames.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 11 CORPORATE OVERVIEW
ENABLING LEGISLATION s ISSUE DIRECTIONS REGARDING EMPLOYMENT OF STAFF AND terms and conditions of employment of staff at the The National Gallery of Australia, which opened to the public in October 1982, is a Commonwealth National Gallery of Australia authority established by the National Gallery Act s ISSUE DIRECTIONS REGARDING THE FORM AND TIMING OF 19755. The Gallery forms part of the Environment, submission of budget estimates of the National Water, Heritage and the Arts portfolio. Gallery of Australia each financial year.
RESPONSIBLE MINISTER EXERCISE OF MINISTER’S POWERS The Ministers responsible for the National Gallery During 2007–08 the Minister signed one standing of Australia during the year were Senator the Hon. instrument appointing an individual to temporarily George Brandis, SC, Minister for the Arts and Sport act in the position of Director during the Director’s (until 3 December 2007) and the Hon. Peter Garrett, absence. A person acted temporarily in the position AM, MP, Minister for the Environment, Heritage of Director on three occasions. The Minister also and the Arts (from 3 December 2007). approved indemnity for one exhibition in which the National Gallery of Australia was involved and The National Gallery Act 19755 and the approved of the Gallery entering into six contracts Commonwealth Authorities and Companies Act for the provision of services for the Stage 1 building 19977 empower the Minister to: project where expenditure exceeded $1 million. s MAKE AVAILABLE #OMMONWEALTH LAND AND BUILDINGS for National Gallery of Australia purposes EFFECTS OF MINISTERIAL s APPROVE THE ACQUISITION OF WORKS OF ART VALUED IN DIRECTIONS excess of a prescribed limit ($10 million) The Gallery received no new ministerial directions s APPROVE THE DISPOSAL OF WORKSOF ART from the Minister apart from Council appointment s APPROVE THE ACQUISITION OR DISPOSAL OFANY PROPERTY notifications, and received one ministerial direction right or privilege, other than a work of art, in excess from the Minister for Finance and Deregulation of a prescribed limit ($1 million) requiring the Gallery to provide a compliance report s APPROVE OR REVOKE THE APPOINTMENT OF DEPUTIES FOR during 2007–08. part-time National Gallery of Australia Council members Ministerial directions from previous financial years that the Gallery fully complied with in 2007–08 s CONVENE A MEETING OF THE .ATIONAL 'ALLERY OF were: Australia Council s .ATIONAL #ODE OF0RACTICE FOR THE #ONSTRUCTION s GRANT THE $IRECTOR OF THE .ATIONAL 'ALLERY OF Industry Australia leave of absence other than recreation leave s 'UIDELINES FOR THE -ANAGEMENT OF &OREIGN s APPOINT A PERSON TO ACT TEMPORARILY IN THE POSITION OF Exchange Risk Director of the National Gallery of Australia and s #OMMONWEALTH 0ROCUREMENT 'UIDELINES determine the terms and conditions of that appointment s TERMINATE TEMPORARY APPOINTMENTS AS $IRECTOR OF THE National Gallery of Australia
12 NATIONAL GALLERY OF AUSTRALIA’S POWERS AND Director, are appointed by the Governor-General usually for three year terms, having regard to their FUNCTIONS knowledge and experience of the visual arts and The powers of the National Gallery of Australia as other areas of knowledge relevant to the affairs of prescribed in the National Gallery Act 19755 are, the Gallery. subject to that Act, to do all things necessary or convenient to be done for, or in connection with, the Mr Rupert Myer, AM, continued as Chairman of the performance of its functions. The Gallery’s functions Council and Mr Charles Curran, AC, continued as as provided in the Act are to: Deputy Chairman throughout the year. The terms s DEVELOP AND MAINTAIN A NATIONAL COLLECTION OF WORKS of appointment for Mrs Roslynne Bracher, AM, of art Mrs Roslyn Packer, AO, and the Hon. Mrs Ashley Dawson-Damer concluded during the year but all s EXHIBIT OR MAKE AVAILABLE FOR EXHIBITION BYOTHERS three members were reappointed for further three- works of art from the national collection, or works of year terms. Mr Robert Champion de Crespigny, AC, art that are otherwise in the possession of the Gallery resigned from the Council on 11 July 2007 s USE EVERY ENDEAVOUR TO MAKE THE MOST ADVANTAGEOUS and Ms Lee Liberman resigned from the Council on use of the national collection in the national interest. 19 May 2008 while the Hon. Ian Callinan, AC, QC, was appointed for a period of three years. In June 2008, the Council had two vacancies. STRATEGIC PLAN 2007–2010 The vision of the Gallery, as stated in the Strategic Throughout the year, the Council was assisted by Plan 2007–2010, is the cultural enrichment of all three committees: Australians through access to their national art s &INANCE 2ISK -ANAGEMENT AND !UDIT #OMMITTEE gallery, the quality of the national collection, the s !CQUISITIONS #OMMITTEE exceptional displays, exhibitions and programs and the professionalism of our staff. s "UILDING #OMMITTEE
The plan maps out the goals, key strategies and Details of the membership of the Council of the direction of the Gallery for 2007–10, with the National Gallery of Australia and its committees are following key priorities: in Appendix 1. s CONTINUE BUILDING FOR THE NATION AN OUTSTANDING collection of works of art MANAGEMENT STRUCTURE s MAINTAIN AND PROTECT THE NATIONAL COLLECTION The management structure of the National Gallery s PROVIDE ENGAGING DISPLAYS EXHIBITIONS AND of Australia is outlined in Appendix 2. The structure public programs was not altered during the year. s PROVIDE EXTENSIVE ACCESS TO AND PUBLICATION AND promotion of the national collection and the visual arts INTERNAL AND EXTERNAL SCRUTINY s COMPLETE THE 3TAGE BUILDING PROJECT WORKS AND secure funding for Stage 2, featuring the Centre for A number of performance and compliance Australian Art and refurbished gallery spaces. reviews were undertaken in the year as part of the Strategic Internal Audit Plan 2007–10. The audit of financial statements was undertaken by the COUNCIL OFTHE NATIONAL Australian National Audit Office (ANAO). The GALLERY OF AUSTRALIA financial statements are included on pages 59 to 89. The Gallery also participated in the ANAO The National Gallery of Australia is governed by a Cross Portfolio Audit on Green Procurement and Council of up to eleven members. The Director of Sustainable Office Management. the Gallery is the Executive Officer and a member
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 13 Audit activity is monitored by the Council’s Finance, As part of the Strategic Plan, the Gallery revised Risk Management and Audit Committee. The role and updated its risk management policy. To further of the committee is to assist the Council in fulfilling enhance the Gallery’s risk management framework, its responsibilities in relation to the identification of a Planning, Risk Management and Compliance areas of significant risk and monitoring of: Advisory Group was established with responsibility s lNANCIALAND BUSINESS RISKS for providing strategic advice on the planning and compliance framework to the Gallery executive. s BUDGETS AND lNANCIAL ARRANGEMENTS ASSOCIATED WITH Gallery activities The Gallery participated in Comcover’s Risk s MANAGEMENT REPORTING Management Assessment Services (RMAS) which s COMPLIANCE WITH LAWS AND REGULATIONS IN RESPECT OF provided an independent assessment of the financial management reporting Gallery’s risk management culture. The RMAS report’s recommendations were incorporated s AN EFFECTIVE AND EFlCIENT INTERNAL AND EXTERNALAUDIT into the Gallery’s Risk Management Strategy. The Gallery achieved a score of 7.9 (maximum 10) The Finance, Risk Management and Audit in Comcover’s Benchmarking Risk Management Committee met six times during the year. The Survey for 2008, which resulted in a 7.9% discount following audit reports were considered by on the insurance premium for 2008–09. The the committee: Gallery welcomes Comcover’s ongoing support s 2EVIEW OF #OMMERCIAL /PERATIONS and assistance. s 2EVIEW OF #ASH (ANDLING 0ROCEDURES s /(3 2EVIEW BUSINESS CONTINUITY s 2EVIEW OF3UPERANNUATION !UTHORISATIONS MANAGEMENT s 2EVIEW OF 0RICING OF 'OODS AND 3ERVICES As a result of changes in senior management and s )MPLEMENTATION OF !UDIT 2ECOMMENDATIONS n 3TATUS changed circumstances relating to the Stage 1 Reports (December and June) building project, a structured review of business s !.!/ "ETTER0RACTICE 'UIDE n 0UBLIC 3ECTOR continuity management processes was conducted Internal Audit. and the Business Continuity Plan updated. Training was conducted with new staff during the year and testing of the updated plan over the next twelve RISK MANAGEMENT months has been identified. The Gallery continued its focus on integrating The purpose of business continuity management risk management into planning and operations is to create business resilience, with the aim of across the organisation. Risk management is a key lessening the probability of incidents occurring element of strategic planning, decision-making that may adversely affect people and the national and business operations within the Gallery. To collection, and to minimise the impact should assist in achieving this goal the Gallery developed incidents occur. In accordance with Federal the Risk Management Strategy 2008–10 which sets Government initiatives, the Gallery has in place out the strategies that will be implemented over a pandemic plan under the umbrella of business the next two years aimed at improving enterprise continuity management planning. risk management.
The Gallery’s Risk Registers are central to this FRAUD CONTROL strategy and are subject to regular review. All risks identified in the registers are managed through The Gallery has in place fraud prevention, detection, established mitigating processes, which include the investigation, reporting and data collection Risk Management Plan, Business Continuity Plan, procedures and processes, which, together with the Emergency Response Plan and Disaster Recovery Plan. Fraud Risk Assessment and Fraud Control Plan, meet the specific needs of the Gallery and comply with the Commonwealth Fraud Control Guidelines.
14 In 2007–08, the Fraud Control Plan 2007–09 was developed and endorsed by the Gallery Council. include: Fraud awareness training sessions were also s A WELCOMING AND SAFE ENVIRONMENT developed and delivered to over 180 staff during the year. s DEVELOPMENT AND CARE OFTHE NATIONAL COLLECTION s PERMANENT COLLECTION DISPLAYS s EXHIBITIONS INCLUDING TRAVELLING EXHIBITIONS FREEDOM OF INFORMATION s EDUCATION PUBLIC PROGRAMS AND RESEARCH Enquiries about procedures for seeking information from the National Gallery of Australia under the s MEMBERSHIP Freedom of Information Act 1982 (FOI Act) may s WEBSITES be made by contacting the Gallery’s Freedom of s MERCHANDISE AND PUBLICATIONS Information Coordinator (details are included at s APPROPRIATE AND WELL MAINTAINED FACILITIES page 181). Visitors are invited to provide feedback on the extent In 2007–08 the Gallery received six requests for to which these service standards have been met in access to documents under the FOI Act. Five several ways: using the Service Charter form on the requests were granted while one was denied. Gallery’s website
The Gallery provides information as required to the ADVERTISING AND MARKET Privacy Commissioner for inclusion in the Personal Information Digestt. No reports by the Privacy RESEARCH Commissioner under Section 30 of the Privacy Act Market research and audience evaluation was 19888 concerning actions or practices by the Gallery conducted during the year to gain a high level of were received during 2007–08. understanding of the Gallery’s visitors and markets.
A total of $29000 was spent on market research in SERVICE CHARTER 2007–08 compared to $84000 in the previous year. The National Gallery of Australia’s Service Charter Exhibition surveys conducted throughout the year outlines the services that the Gallery provides, what examined visitor demographics and psychographics, services visitors can expect, and how visitors can use of Gallery facilities and awareness of marketing assist the Gallery in making improvements to the and communications initiatives. Evaluation of major current level of service.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 15 exhibitions was also undertaken to assist in the development of marketing programs.
Market research ensures effective advertising and communication with visitors and the broader public. The Gallery promotes its programs through print, outdoor and electronic media. Total expenditure on advertising in 2007–08 was $1178000 compared to $623069 in the previous year.
INTERACTION WITH OTHER AUTHORITIES The nature of the Gallery’s business requires it to deal with Commonwealth, state and local government representatives and agencies as well as diplomatic missions, art dealers, auction houses, other galleries and museums, universities, art schools, and related professional bodies, nationally and internationally. Reference to the interaction that occurred during 2007–08 is made throughout this report.
COMMITTEES OF INQUIRY National Gallery of Australia staff appeared before the Senate Standing Committee on Environment, Communications and the Arts and the Joint Standing Committee on the National Capital and External Territories.
JUDICIAL DECISIONS During the year the Federal Court made orders that the National Gallery of Australia had breached the Occupational Health and Safety Act 19911 in relation to an incident involving an external contractor. The Gallery took steps to immediately address issues raised by the incident and was subject to a pecuniary penalty.
OMBUDSMAN One issue, relating to a request under the FOI Act was lodged with the Commonwealth Ombudsman’s Office.
16 PERFORMANCE REPORT 2007–08 OUTCOME AND OUTPUTS OUTPUT 1.2 COLLECTION MANAGEMENT The purpose of the National Gallery of Australia is to serve the public by enhancing understanding The national collection is accessioned and and enjoyment of the visual arts. It serves the documented in order to account for each work of public through the effective and efficient use of its art in the collection. Works of art are catalogued collections, which will be developed, researched, to provide information about the collection and preserved, displayed, interpreted, promoted to enable access to that information. The National and complemented with exhibitions and loans. Gallery of Australia stores, secures and conserves its The Gallery aims to provide access to and collection in order to preserve it for the Australian information about works of art, locally, nationally people, now and in the future. and internationally.
This purpose is consistent with the National Gallery OUTPUT 1.3 ACCESS TO AND Act 19755 which directs the Gallery to: PROMOTION OF WORKS OF ART s DEVELOP AND MAINTAIN A NATIONAL COLLECTION OF WORKS The National Gallery of Australia provides access to of art works of art by displaying, exhibiting and lending its collection as well as borrowing works from s EXHIBIT OR MAKE AVAILABLE FOR EXHIBITION BY OTHERS other sources. Access to works from the national works of art from the national collection, or works of collection that are not on display is also provided in art that are in the possession of the Gallery the Collection Study Room or through the Gallery’s s USE EVERY ENDEAVOUR TOMAKE THE MOST ADVANTAGEOUS publications and websites. use of the national collection in the national interest. The Gallery enhances the understanding, knowledge A national collection of outstanding aesthetic quality and enjoyment of art by providing information is important to the Australian community. The about and promoting the benefits of works of art national collection provides the basis for enhancing through visitor services, education, public programs understanding and enjoyment of the visual arts, and and multimedia. The Gallery seeks to achieve the thus the Gallery seeks to maximise the productive widest possible audience both by attracting visitors use of the national collection as a public asset. to the Gallery and sending works of art around Australia and overseas, thereby improving access to and providing information about works of art. OUTCOME The National Gallery of Australia delivers three The following table lists the performance outputs to achieve the outcome of enhancing information that the Gallery used to assess the level understanding, knowledge and enjoyment of achievement during 2007–08. The table shows of the visual arts by providing access to, and the efficiency of the outputs in contributing to the information about works of art locally, nationally outcome. Information shown is both quantitative and internationally. and qualitative.
Targets for effectiveness have been included OUTPUT 1.1 COLLECTION where these are applicable and appropriate for DEVELOPMENT performance information for the outcome. The National Gallery of Australia aims to build a collection of works of art of outstanding quality through purchase, gift and bequest and through deaccession.
18 PORTFOLIO BUDGET STATEMENTS PERFORMANCE INFORMATION Outcome
EFFECTIVENESS – OVERALL ACHIEVEMENT OFTHE OUTCOME TARGET ACTUAL Improved understanding and knowledge % of visitors to the Gallery, and to works displayed 85% 94% of the visual arts by the Gallery, who believed their understanding and knowledge of the visual arts was improved through such visits Enhanced enjoyment of the visual arts % of visitors to the Gallery, and to works of 85% 91% art displayed by the Gallery, who enjoyed their experience of the visual arts Increased access to works of art Number of people who saw works of art from the 3000000 6230179 national collection or exhibitions* Number of works of art from the national collection 1200 1532 loaned nationally and internationally
Outputs
PERFORMANCE INFORMATION FOR DEPARTMENTAL OUTPUTS TARGET ACTUAL OUTPUT 1.1 QUALITY Collection development % of works of art acquired consistent with acquisition policy 100% 100% % of works of art acquiredresearched and documented 100% 100% QUANTITY Number of works of art acquired during the year - 9931 Number of works of art deaccessioned during the year - 30 PRICE Costs associated with acquiring and deaccessioning works of art $6.637m $4.998m OUTPUT 1.2 QUALITY Collection management % of the national collection reviewed to assess condition and maintenance requirements 4% 9.7% % of works of art kept in appropriate environmental conditions 100% 100% % of works of art identified for maintenance treated in accordance with priorities 100% 100% QUANTITY Number of works of art in the national collection 141000 153532 Number of works of art subjected to conservation treatment 1800 4700 PRICE Cost per item stored $58.83 $47.16 Cost per work of art treated $1562.31 $521.72 Costs associated with collection management $11.107m $9.692m continued
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 19 PERFORMANCE INFORMATION FOR DEPARTMENTAL OUTPUTS TARGET ACTUAL OUTPUT 1.3 QUALITY Access to and promotion of % of visitors satisfied with displays and exhibitions 85% 91% works of art % of attendees satisfied with Gallery events 85% 93% QUANTITY Number of people who saw works of art from the national collection or exhibitions* 3000000 6230179 Number of attendees at Gallery events 110000 132998 Number of people who accessed information via the Gallery’s Research Library Collection Study Room and website 5000000 1185593 PRICE Cost per visitor $8.75 $4.88 Cost per attendee at events $47.30 $46.77 Cost per user access $0.24 $0.95 Costs associated with access to and promotion of works of art $32.653m $37.738m
* People visiting National Gallery of Australia exhibitions in Canberra, nationally and internationally, plus visitors to other institutions displaying works from the national collection.
20 REPORT AGAINST STRATEGIC PLAN 2007–2010 This report on performance is made against the seven goals expressed in the Strategic Plan 2007–2010. A detailed discussion of performance follows.
GOAL 1 Build and maintain an outstanding national art collection
GOAL 2 Increase the audience for and engagement with the exhibitions and programs of the National Gallery of Australia
GOAL 3 Create a welcoming and engaging visitor experience
GOAL 4 Secure and strategically manage resources to support Gallery operations and activities
GOAL 5 Provide a safe and productive working environment for all staff appropriate to the Australian Public Sector and art museum standards
GOAL 6 Ensure the highest standards of corporate governance
GOAL 7 Build productive relationships with Government and other stakeholders
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 21 GOAL 1 BUILD AND MAINTAIN AN OUTSTANDING NATIONAL ART COLLECTION
KEY STRATEGIES DISPOSAL OF WORKS OF ART s !CQUIRE BY PURCHASE OR GIFT WORKS OF ART OF In accordance with the National Gallery Act 1975, outstanding aesthetic quality in accordance with the the disposal of works of art from the national Gallery’s acquisitions policies that build on the collection must be approved by the Gallery Council and the Minister. The Gallery’s Disposal strengths of the national art collection Policy approved in 1995 was reviewed, and a new s %NCOURAGE FACILITATE AND ACKNOWLEDGE GIFTS AND Deaccession and Removal of Works of Art Policy donations that enhance the national art collection was approved. s 7HERE APPROPRIATE DISPOSE OF WORKS OF ART THAT NO longer comply with national art collection During the year, curatorial staff continued assessing development policies by transfer, gift, exchange the appropriateness of works of art to remain in the or sale national collection, and 30 strips of press cuttings of materials by Cazneaux were deaccessioned and s $OCUMENT THE COLLECTION AND REVIEW COLLECTION transferred to the Gallery’s Research Library. documentation to ensure best museum practice s $IGITISE NEW ACQUISITIONS AND WORK TOWARDS THE digitisation of the collection over time ACQUISITIONS 2007–08 s -AINTAIN AND CONSERVE THE NATIONAL ART COLLECTION ON Aboriginal and Torres Strait Islander Art display and in storage in accordance with the During 2007–08 the Aboriginal and Torres Strait endorsed Collection Preservation Plan Islander Art department acquired 93 works of art, s 0ROTECT THE NATIONAL ART COLLECTION BY CONTINUOUSLY comprising bark paintings, paintings on canvas, improving the security of the collection and by weaving and fibre works, works on paper, sculpture, providing optimum environmental conditions metalwork, carvings, digital media and a large s 0ROTECT THE ARCHIVALAND RARE MATERIALS SUPPORTING THE number of photographic works. Highlights of the national collection in the Research Library Aboriginal and Torres Strait Islander art purchases include Clifford Possum Tjapaltjarri’s Warlugulong, a significant work by this leading and pioneering ACQUISITION OF WORKS OF ART painter from the Western Desert that was purchased with the generous assistance of Roslynne Bracher, The National Gallery of Australia purchased 9931 AM, and the Paspaley Family, David Coe and works of art in the year at a cost of $17.615 million, Michelle Coe, Charles Curran, AC, and Eva Curran. all meeting the requirements of the Gallery’s Acquisitions Policy. These were premium works of art that strengthen the national collection. Other highlights include the acquisition of The Gallery’s capacity to acquire works of art is 25 works for the inaugural Culture Warriors: dependent on ongoing funding provided by the National Indigenous Art Triennial, a significant Australian Government and on the generosity of and important initiative of the Gallery to increase donors and benefactors. An additional 1063 works the stature and raise awareness of contemporary of art valued at $6.919 million were acquired as gifts Aboriginal and Torres Strait Islander art in Australia. while $2.197 million was received in cash donations to assist the purchase of works of art. Important acquisitions from this exhibition include Dennis Nona’s award winning sculpture Ubirikubiri 2007, a three-metre-long bronze sculpture, which was the overall winner of the 24th Telstra National
22 Aboriginal and Torres Strait Islander Art Award in 2007. Nona’s earlier bronze sculpture Apu Kaz works: a sculpture by Kitty Kantilla (Tiwi), a 1998 features a mother dugong and her baby. painting by Turkey Tolson Tjupurrula (Luritja/ These are the first large scale bronze works in the Warlpiri), a painting by Anatjari No.III Tjakamarra Aboriginal and Torres Strait Islander Art collection (Pintupi), a watercolour by Otto Pareroultja and each work strengthens the Gallery’s small (Western Arrernte) and another watercolour by holding of Torres Strait Islander works. Highlights Walter Ebaterinja (Western Arrernte). include senior Tiwi artist Jean Baptiste Apuatimi’s spectacular painting Yirrikaminii 2007, which is Generous gifts were accepted from John and based on pukumanii poles; two bark paintings, Diana Coates of two large bark paintings by Mardayin at Milmilngkann 2006 and Mardayin George Milpurrurru (Ganalbingu), two paintings design at Dilebangg 2006, by senior Kuninjku on canvas by Willy Billabong (Kukatja) from Toby (eastern Kunwinjku) artist John Mawurndjula; Blyth, a large painting by Angelina Ngal (Alyawarr), Kurdukadj (Emu)) 2004, a work on paper by also known as Angelina Ngale Pwerle, from Lauraine senior Kundedjnjenghmi artist Lofty Bardayal Diggins and a large painting by Kathleen Ngale Nadjamerrek; and Gunyunmirringa (landscape) (Anmatyerr) by Don and Janet Holt and family. 2007, a hollow log work by senior Liyagalawumirr artist Philip Gudthaykudthay. A major carving, Yawk Australian Decorative Arts and Design yawkk, and three yawk yawkk figures by Owen Yalandja (Kuninjku (eastern Kunwinjku)), a stunning untitled The Gallery’s collection of nineteenth- and early canvas by Doreen Reid Nakamarra (Pintupi/ twentieth-century Australian Decorative Arts and Ngaatjatjarra) and a bark painting by Gulumbu Design was extended through the acquisition of an Yunupingu (Gumatj/Rrakpala) represent remotely exceptional collection of 100 examples of Australian based artists and complement the collection. silver- and gold-smithing, comprising works by most of the leading Victorian, New South Wales, South The Gallery’s collection of works by urban-based Australian and Western Australian silversmiths artists was strengthened by large works such as and jewellers of the nineteenth and early twentieth mythreadd 2007, a triptych by Vernon Ah Kee (Kuku centuries. Assembled from Australian sources over Yalanji/Yidinji/Waanyi/Gugu Yimithirr); Big brush a thirty-year period by Sydney collector Jack Grace, strokee, a triptych by Richard Bell (Kamilaroi/Kooma/ it includes presentation and testimonial objects, Jiman/Gurang Gurang); King No Beardd by Daniel sporting and achievement trophies, inkwells, Boyd (Kudjla/Gangalu); FIGHT: To Survive, To Live; boxes, jewel cases, wine jugs, cutlery and personal To Die!! by Gordon Hookey (Waanyi/Waanjiminjin); accessories in styles ranging from rococo and five shields made from old travelling trunks by renaissance revival to naturalism and art deco. Danie Mellor (Mamu/Ngagen/Ngajan); a stunning Australian floral and faunal subject matter pervades possum skin cloak by Treahna Hamm (Yorta Yorta); the collection, further contributing to its importance and a canvas by Judy Watson (Waanyi). as a document of nationalist fervour, achievement and aspiration during the colonial and post- Works purchased with the generous assistance of Federation periods. the Rotary Collection of Australian Art Fund 2007, in memory of Philip McElligott, AM, MBA, and in The acquisition of a c.1820 Regency-style, double- celebration of the Gallery’s twenty-fifth anniversary ended sofa made by the King’s Yard Hobart for the comprise a larrakitjj (hollow log) by Malaluba Convict Department allows the Gallery to document Gumana (Dhalwangu/Nungburundi) and two the design of the early nineteenth century in more painted larrakitjss by Naminapu Maymuru-White depth and, through this fine example, to show an (Manggalili). Additional acquisitions include two important influence on Australian design. A c.1869 shell works by Esme Timberry (Bidjigal), two works 2APHAEL #O 3YDNEY .37 WORKTABLE WITH lNE on paper by England Banggala (Burarra/Gun- turned frame elements, elaborate Australian wood nartpa) and an archival collection of batiks from the veneers and precise functionality was acquired as an 1980s by various artists at Utopia. excellent and rare example of the best of Australian design and production of the mid nineteenth
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 23 CENTURY 4HE ACQUISITION OF A C ! 3IMPSON and sculptures by the foremost artists associated Son painted cast iron settee is of interest for the with Surrealism in Australia including James collection, which had no industrially produced Gleeson, Sidney Nolan, Arthur Boyd, Albert Tucker, furniture from this period or of this style, and Robert Klippel, Joy Hester, James Cant, Peter Purves little outdoor furniture. Its acquisition extends Smith and Dusan Marek, as well as lesser known the Gallery’s representation of historical South artists who were influenced by Surrealism Australian design and decorative arts. and produced some of their best work under its influence. The gift by Janelle Constable of Advance Australia Fairr, a c.1910 quilt by New South Wales artist A number of significant gifts under the Australian Mary Jane Hannaford, extends the small collection Government’s Cultural Gifts Program were received of works by this artist and adds interest to the during 2007–08. These included a group of works by collection of early Australian textiles. Western Australian artist Howard Taylor, gifted by Christopher and Philip Constable in honour of their Contemporary works acquired include a gift mother Esther Constable. The gift includes several by Pauline Hunter of a 1988 porcelain bowl by sculptures, works on paper and a stunning late New South Wales potter Col Levy and purchases of painting by Taylor, At Shannon Damm 1998. ceramics by South Australian artist Bruce Nuske, New South Wales artist Lex Dickson and Western In March 2008 the Gallery announced the gift Australian artist Amanda Shelsher, each building of Rosalie Gascoigne’s last major series, Earth the representation of craft practice from these 1999. A multi-panelled installation comprising states. To build upon the Gallery’s growing strength ten works, Earthh is a significant addition to the in contemporary Australian glass, the Gallery Gallery’s collection of works by the artist. Valued acquired glass works by ACT artist Mel Douglas, at an estimated $2 million, Earthh was donated by purchased in memory of Philippa Winn, National Ben Gascoigne, AO, and family. Gallery of Australia Educator (1996–2005), by her family, friends and colleagues; by New South Wales Chris Deutscher generously donated a rare oil artist Brian Hirst, gifted by Raphy Star; and by portrait by William Nicholas, Portrait of a woman Western Australian artist Kevin Gordon, gifted by 1852. This large oil painting is an excellent example Sandy Benjamin. of colonial Australian society portraiture and is the only oil painting by William Nicholas in the The acquisition of a silver bowl from Helge Larsen national collection. and Darani Lewers, two of Australia’s most experienced silversmiths, celebrates their fiftieth J M Crossland’s paintingg Staffordshire bull terrier year of practice. It joins other silver hollowware belonging to the Rev. John Gower 1851 was gifted works in the collection from established Australian to the Gallery by Director Ron Radford, AM. This silversmiths, adding strength to the Gallery’s rare portrait of a dog is one of only fourteen known holdings of Australian metalwork, both historical surviving Australian colonial paintings by Crossland and contemporary. Its acquisition was funded from and helps to strengthen the collection of South the Meredith Hinchliffe Fund, which focuses on Australian colonial art. contemporary Australian craft, and was a major Australian contemporary decorative arts and design Harbourscapee c.1896, a small oil impression by acquisition in the Gallery’s silver anniversary year. Tom Roberts, was donated by Perpetual Benefactor Dr Joseph Brown, AO, OBE. Painted directly onto Australian Painting and Sculpture the panel in thick impasto, it depicts a scene around Sydney Harbour, probably from the north shore This year saw the significant acquisition of the looking towards the city. Agapitos/Wilson collection of Australian Surrealist art, a combination of gift and purchase from Also continuing in the tradition of benefaction, Ray Wilson, OAM. The collection of over 170 works Philip Bacon, AM, gifted George W Lambert’s covering the period from 1925 to 1955 includes landscape painting of the Monaro region, Michelago paintings, prints, collages, drawings, photographs
24 landscapee 1923. This painting has particular Story Bridge 1957, a relevance for the national collection given its modernist work depicting and celebrating a major connection to Lambert’s iconic The squatter’s Brisbane landmark, and by the acquisition of Gods daughterr 1923–24. and heroess 2005 and Curtainn 1996, two mixed media works by Queensland artist Madonna Staunton. Denis Savill has generously donated Floating mask 1 1943, a painting by significant twentieth century Other notable acquisitions of contemporary Australian artist John Perceval. The painting Australian art include Lucy Culliton’s oil on is concerned with the Surrealist themes of the canvas painting Hand knit toyy 2007 and Hossein unconscious and is an excellent companion to Valamanesh’s multimedia work Touch love 2006. works by Perceval and his contemporaries that The Gallery’s holdings of contemporary Australian have recently been acquired as part of the Agapitos/ sculpture were enhanced by a gift from the Wilson collection. Prescott Family Foundation of Tuskk 2007 by Ricky Swallow and by the purchase of Garlandd 2006 by Emmanuel Hirsh presented the Gallery with the Bronwyn Oliver that has been on display with major gift of four exceptional works by contemporary international works in the National Australia Bank Australian artists Domenico de Clario, Dale Hickey, Sculpture Gallery. Gareth Sansom and Heather Ellyard. The gift has addressed weaknesses in the collection of works by Australian Prints and Drawings these artists and strengthens the representation of contemporary Australian art practice. During 2007–08 the Gallery received gifts of drawings by significant Australian artists. Mr L Gordon Darling, AC, CMG, and Marilyn Two large abstract colourfield paintings, Equinox Darling gifted fifteen Albert Namatjira watercolours c.1980 and Banderolee c.1980, by Sam Atyeo were for the planned Gordon and Marilyn Darling Gallery gifted to the Gallery by the artist’s wife, Madame of Hermannsburg Painting, which forms part of Anne Atyeo, in addition to a group of watercolours the Stage 1 building redevelopment. Madame Anne by the artist. Atyeo gave nine watercolours by her late husband Sam Atyeo, and Christopher and Philip Constable Selected for the exhibition Andy and Ozz at the donated two Howard Taylor pastel drawings in Andy Warhol Museum in Pittsburgh, Timothy memory of their mother Esther Constable. Horn’s sculpture Sthenoo 2006 captured the attention of members of the American Friends of the National Artists also gave generously to the collection with Gallery of Australia and was subsequently purchased Rick Amor gifting his collection of 299 etchings, with partial funding from the American Friends. lithographs and relief prints from 1968–2005. Other artists who donated their own works included Two works by Frederick McCubbin were purchased Mike Parr, eX de Medici, William Robinson, at auction. The first, the luminescent late work Violet Brent Harris, Robert Jacks, Robert Rooney, John and goldd 1911, was purchased with the generous Neeson, Gregor Cullen, Leonie Lane, Lesbia assistance of the Hon. Mrs Ashley Dawson-Damer, Thorpe, Pamela Griffiths, Marion Manifold and John Wylie, AM, and Myriam Wylie. It is one of Penny Mason. McCubbin’s most beautiful Macedon paintings with rays of dappled light flickering through the John Loane of Viridian Press gave a significant dark trees. The second, At the falling of the year gift of 105 prints produced at the print workshop 1886, is an intimate, plein-air painting of a glade by artists including Aida Tomescu, Mike Parr and of gum saplings painted at Box Hill in 1886 by Judith Wright. Other significant donations of prints McCubbin during a key, pioneering period of his included Mike Parr’s multi-plate etching Stick career, showing the advances in Australian landscape into eyee 1993 from Sara Kelly, an early etching by imagery that McCubbin made at this time. John Glover from John McPhee, the 1996 etching Mahalahalaa by John Pule from Theo Tremblay, The Gallery’s collection of works by Queensland a group of etchings by Dorothy Cameron from artists was improved by the acquisition of Joy her son Peter Cameron, a folio of monoprints by
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 25 Tim Maguire from Derek Kreckler and 26 posters Twentieth-century prints acquired include the from Martin Munz, ex-Director of Tin Sheds. c.1932 woodcut Spring magnoliaa and the 1949 stencil print The snaill by Margaret Preston, two The Margaret Olley Foundation financed the states of William Hunter’s c.1930s etching The acquisition of two exquisite watercolours on silk by riverr, the c.1918 lithograph The batherss by Thea Thea Proctor; the Rotary Collection of Australian Proctor, and two lyrical monotypes of island life by Art Fund supported the acquisition of papercut Ray Crooke from 1968. drawings by Pamela Mei-Leng See and Megan Keating; and Vicki Vidor, OAM, sponsored the Contemporary prints acquired through the Gordon purchase of Danial Kogan’s 1993 folio Childprooff, Darling Australia Pacific Print Fund include four which contains linocut portraits of child survivors etchings by Jessie Traill, including the key works of the Holocaust. Autumnn 1922 and The great archh 1932; Lofty Bardayal Nadjamerrek etchings Rainbow serpent The Gallery has continued to collect nineteenth- and Namarrkonn from 2000; two artist books by century works on paper. Early Australian drawings Clyde McGill, including his 1996 award-winning acquired include Simpkinson de Wesselow’s Borders and burning boatss; a group of etchings 1847 watercolour On the road to Sassafras Valley by Rosella Namok, Gloria Petyarr, Nura Rupert Hobartonn and a 1906 conté crayon portrait by and Judy Watson; a collection of subverted street- George W Lambert of his wife Amy. signs by Richard Tipping; 1980s political posters from Redback Graphix, which will feature in the Acquisitions of Australian prints from this period forthcoming National Gallery of Australia catalogue include N. Chevalier’s album of chromolithographs raisonné; an etching and two large linocuts by Badu 1865, a much-sought after 1857 edition of island artist Dennis Nona; the early 1955 screenprint Henry Heath Glover’s 12 Hours road scraping Connemarra girll by Tate Adams; a boxed set of seven in Melbournee, three c.1860 lithographs of printed fans by Robin White; the late John Stringer’s kangaroo hunting by S T Gill, Samuel Calvert’s 1960 colour woodcut Icarus fallingg; two etchings by 1866 etching A Christmas scene by the Yarraa and Pax Jakupa Jr produced through the Australian Print Oswald Rose Campbell’s 1867 wood-engraving Workshop in 2005; and the 1998 artist book Portrait Christmas in the bush: an Australian homestead. of an Australiann, by Jonathan Tse. Early views of Tasmania were acquired in the form of a lithographic view of Launceston in 1863 The Gordon Darling Australia Pacific Print Fund by Margaret Black, a c.1833 group of 14 views celebrated the National Gallery of Australia’s twenty- of Tasmaniaa by Louis de Sainson and the 1867 fifth anniversary with four major acquisitions: lithographic series Salmon Ponds and vicinity New s A GROUP OF SCREENPRINTS PRODUCED AT THE ,ARRY Norfolkk by William Piguenit. Rawling Print Workshop in Melbourne between 1966 and 2005, including works by Juan Davila, Significant acquisitions of twentieth-century Alun-Leach Jones, Brent Harris, David Band, Australian drawings include the 1945 gouache Brook Andrew and Rosslynd Piggott and watercolour Seaside Sundayy by Surrealist Bernard Boles; a c.1937 study for The windswept s A GROUP OF WORKS PRODUCED AT #ICADA 0RESS IN farmm by Dorrit Black, and a c.1908 watercolour Sydney between 2000 and 2007, including prints by on silk work Le baiser [The kiss] by Thea Proctor. Cherry Hood, Adam Cullen, Nicholas Harding, Contemporary works acquired included the John Peart, Euan Macleod and Noel McKenna luminous 2006 saffron drawing Practicee by s A GROUP OF PRINTS PRODUCED AT 6IRIDIAN 0RESS IN Hossein Valamanesh; Conversation piece [blow Melbourne and Canberra, including works by torch and lighter], Conversation piece [fan and Gordon Bennett, Brent Harris, Imants Tillers, feet]] and drawings for public sculpture from the Jeffrey Harris and Savandhary Vongpoothorn Amendmentss series by David Watt; two gouache works by John R Walker; and abstract watercolours s A GROUP OF WORKS BY )NDIGENOUS ARTISTS INCLUDING by New Zealand artist Liz Coats. Rover Thomas, Kitty Kantilla and Shirley Purdie and printed by Franck Gohier in Darwin.
26 Asian Art Strategic purchases, especially in the areas of exquisite textiles from Uzbekistan. Comprising nine sculpture and textiles, have added depth and embroidered Tur kmen mantles, three ikat-dyed wall richness to the national collection. The most hangings and an embroidered dowry textile (suzanii), significant acquisition of the year was a large these textiles add strength and depth to the Gallery’s eleventh–twelfth century bronze sculpture of Shiva collection of textiles and costume. as Lord of the Dance [Nataraja], the quintessential image of the Hindu god Shiva performing his A number of important gifts were received this dance of creation and destruction. Made during year covering a broad range of dates, origins and Chola rule (ninth–thirteenth centuries), a period media, including a royal prize winning women’s widely recognised as the pinnacle of Indian wrap skirt (kiraa) from Bhutan, a wooden Buginese metal casting, the sculpture makes a magnificent roof finial, and an ink rubbing by New York-based contribution to the Gallery’s outstanding collection contemporary Chinese artist Wenda Gu. The Gallery of Indian sculpture. was honoured to receive a gift presented by His Excellency Mr Teuku Mohammad Hamzah Thayeb, The department has also continued its emphasis on Ambassador of Indonesia to Australia, of a richly large Indian painted shrine hangings (pichhavaii) adorned ceremonial costume by noted Indonesian associated with festivals devoted to the popular god fashion designer Adjie Notonegoro. A selection Krishna. A nineteenth-century painting Festival of fine traditional textiles from cultural groups of the cattle [Gopashtamii] was selected for the throughout the Philippines and two santoss (saint Gallery’s 2007 Masterpieces for the Nation Fund figures) were also presented to the Gallery by His appeal and a second hanging, Autumn moon festival Excellency Mr Ernesto H de Leon, Ambassador [Sharad purnimaa] from the eighteenth century, has of the Philippines to Australia, on behalf of Her been chosen for the 2008 Masterpieces appeal. Excellency Mrs Gloria Macapagal Arroyo, President of the Republic of the Philippines. In Southeast Asian art, ancestral sculpture and textiles have been a collecting focus. Works of In reviewing works in the national collection, a art acquired include a painted wooden effigy number of objects acquired in previous decades have of a hornbill (kenyalangg) and a spectacular been identified as being of insufficient quality for pair of nineteenth century ceremonial cloths the collection. In view of the Gallery’s aim to refine (pua kumbuu) from the Iban people of Malaysia. as well as strengthen the collection, steps have been A significant purchase was a wooden funerary taken towards deaccessioning these works of art. figure (hampatongg), made by the Bahau people on the island of Borneo, which has been radiocarbon International Decorative Arts dated to the fourteenth century. The art of the and Design Islamic peoples of the Southeast Asian region is The International Decorative Arts and Design another important collecting area exemplified by collection of historical works was extended with the opulent Malay silverware in the form of a pair of acquisition of a group of four drawings from 1899 to royal lustration bowls and a ceremonial lidded bowl. 1904 for jewellery by French jeweller René Lalique, Also acquired was an engraved stone Islamic grave an 1898 Bing and Grøndahl art nouveau porcelain marker from Sumbawa in Indonesia, an object of a jar designed by Siegfried Wagner, a Courtier’s hat type long sought by the Gallery. designed by Henri Matisse for the Ballets Russes de Serge Diaghilev 1920 production of Le chant du In addition to the art of South and Southeast Asia, rossignoll and the gift by Diana Woollard of a c.1900 the Gallery has small but high-quality collections of Daum art nouveau glass vase. East Asian and Central Asian art, both of which have been enriched by recent acquisitions. These include a complete series of portrait prints, Thirty-two aspects International Prints, Drawings and of customs and manners [Fuzoku Sanjuniso], 1888, Illustrated Books by the Japanese printmaker Tsukioka Yoshitoshi The department continued a focus on buying prints (1839–1892), which will be exhibited in the newly from the second half of the nineteenth century,
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 27 including Mary Cassatt’s Hélène de Septeuil The department continued to be generously assisted 1889–90, Edgar Degas’ La sortie du bainn c.1882 and with funding for staff provided by benefactors Paul Gauguin’s Manao Tupapaouu 1894. The noted Kenneth Tyler and Marabeth Cohen-Tyler Australian artist Margaret Olley, AC, also generously through American Friends of the National Gallery contributed to holdings in this area by gifting of Australia. Paul Cézanne’s Portrait of Guillaumin with the ‘Hanged man’’ 1873. Pacific Arts
Another focus for the department was early During 2007–08 the Pacific Arts department modernism, with the purchase of Pablo Picasso’s acquired twelve works of art from Papua New cubist etching L’homme au chien (rue Schelcher) Guinea, New Zealand, the Solomon Islands, 1915, Max Beckmann’s expressionist drypoint the Micronesia island of Chuuk and the central Frauenbadd 1922 and two works from Kandinsky’s Polynesian island of Aitu. Each work was acquired to lithographic series Kleine Weltenn 1922. This build upon specifically targeted areas of the Pacific purchase was complemented by the generosity of arts collection or to strengthen previously identified Tony and Carol Berg, who chose to give two further sections of the collection. Several important works colour lithographs from the Kleine Weltenn series in were acquired including the prehistoric stone honour of the National Gallery of Australia’s twenty- mortar from the Chambri lakes region of Papua fifth anniversary. Another generous gift was from New Guinea. The mortar was acquired as part of Dorothy Danta, who donated Frans Masereel’s Die the Diczbalis Sepik River art collection collected Passion eines Menschenn 1924 and Struck’s Die Kunst in the field in 1954 and is one of only four known des Radierens 1920, both in honour of her parents examples in the world from this region produced Professor F H Reuter and Mrs I Reuter. around 2000 to 4000 years ago by same (or related) prehistoric culture that made the Gallery’s Ambum stone. The surrealist holdings of prints and illustrated books were greatly augmented by Max Ernst’s La brebis galantee 1949, Kurt Seligmann’s Les The Chieftain’s cloak Huakii from the Hooper vagabondages héraldiques 1934, René Magritte’s collection firmly consolidates the Gallery’s small Moralité du sommeil 1941, and Louis Marcoussis’s collection of Maori art. The cloak represents Eaux-fortes pour Alcools de Guillame the highest level of textile art from Polynesia, is Apollinaire 1934. exceedingly rare if not unique for having three decorated borders. Dated between 1800 and 1830, it is also one of the earliest examples of its kind. The The collection of David Hockney prints in the chief’s seat No’oangaa from the Polynesian island collection was supplemented with two works from of Aitu went on immediate display as part of the his early years during the 1960s, when he explored foyer showcases of African, Pre-Columbian and contentious issues regarding his student days at the Polynesian art to coincide with the Gallery’s twenty- Royal Academy in The diplomaa 1862 and themes of fifth anniversary celebrations. Two figurative works homosexuality in Gretchen and the snurl 1961. from the Solomon Islands were acquired to increase the Gallery’s limited holdings from this area Bust of A notable acquisition was George Baselitz’s 2006 a young man (c.1870–1900) and Figure of a deity series Remixx in which the artist revisits an earlier [Adaro] by Tigoana of Star Harbour. The work by subject matter and style and develops it further with celebrated artist Tigoana is particularly important great originality and some dark humour. He echoes for being one of the last traditional images of a deity earlier expressionist works with the addition of a in use prior to great cultural upheaval in this area backdrop of brilliant yellow. during Second World War and for having the name of the artist recorded with the work. The department continued to acquire key Japanese prints, which complement our existing holdings in this area. Works were acquired with funds from the Photography Poynton Bequest, established following the death of Principally, acquisitions for works to be included major benefactor Orde Poynton Esq., AO, CMG. in Picture paradise: Asia–Pacific photography
28 1840s–1940ss were made. This included a major CONSERVATION OFTHE acquisition of over 7000 items, including single COLLECTION images, albums and reference books from the eminent Dutch collector of Indonesian material Leo Providing care to the collection is a primary Haks. This significant purchase was supplemented objective for the Gallery, and preventive by single purchases such as a rare panorama of conservation, as well as treatments and the Foochow made in 1870 by the Chinese photographer preparation of works of art for display, has been a Tung Hing. major focus. Conservation staff have been active in monitoring the conditions within our building and Additionally six works from the second half of those of borrowing institutions to ensure the best the 1930s by Max Dupain entered the collection. possible environment is provided for our collection. These were part of the partial gift to the Gallery The Conservation department has also been active of surrealist works from James Agapitos, OAM, in advising on all aspects of the Stage 1 building and Ray Wilson, OAM. These works by Dupain project to ensure the needs of the collection are complement the Gallery’s large holdings of works considered at all levels of the project. by this major Australian photographer. An early and important work From the waist downn 1998 As the building works impacted significantly on by Deborah Paauwe was given by Paul Greenaway, the textile store, conservation staff have managed OAM. A major series The native typess 2000–2004 modifications to the store and the relocation of by contemporary Indian photographer Pushpamala 1065 collection items as well as the design of new N in collaboration with Clare Arni was also storage cabinets. acquired, one of the last sets available. The series has proved very popular and has already achieved near To monitor the condition of works on loan, iconic status. conservators have travelled to over 30 national venues and institutions overseas including Spain, the United States of America, Italy, Switzerland, MAINTENANCE AND, ACCESSTO Japan and New Zealand. THE COLLECTION Staff have also been active in advising the public, The National Gallery of Australia maintains and gallery visitors, members and professionals on the preserves its collection of over 150000 works of art care of the collection by presenting 16 lectures, to enhance the community’s understanding and 44 tours, five information posters and responded enjoyment of the visual arts, now and for the future. to over 300 inquiries from the public on the care of The Gallery provides high quality facilities and works of art. This year four articles prepared by the environmental conditions in its display and storage Paper and Objects sections have been published in areas and applies the highest professional standards international professional journals. of collection management. A critical activity in preventive conservation is to The ongoing review of the storage of the collection monitor the condition of the collection. During has seen a number of the Gallery’s art storage 2007–08, over 10245 works were condition checked. facilities refined and enhanced during the year. Collection growth and storage capacity requirements To assist the efficiency of preventive conservation continue to be assessed. A plan to address the to the collection the Collection Disaster Recovery Gallery’s storage requirements has been developed Plan has been revised and a complete review and and is being implemented through a staged upgrade of the Integrated Pest Management Plan approach, with many of the short-term solutions has commenced. In implementing this plan, a major being implemented. Considerable effort has been survey and treatment of works at risk of insect given to the treatment, packing and storage of damage has been undertaken in the offsite Small objects in the Small Objects Store. Objects Store.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 29 During this survey, every work of organic material production of Sadkoo c.1916 by Natalia Gontcharova, in the store was checked and over 2400 preventive which has never been available for display due treatments undertaken. to its extremely poor condition. Other costumes have been treated, including Alexander Golovin’s Over 2300 treatments were carried out on works of costumes for the Ballets Russes production L’Oiseau art for exhibition from the permanent collection. de feuu and Natalia Goncharova’s Dress for a member Major treatments were undertaken on a number of Kostchei’s entourage, Costume for Finale and of large outdoor sculptures including the Charles Costume for a Princess. Ginnever Green mountain blue II 1978 (located on a hill top on the road between Canberra and Cooma, The exhibition Picture paradise: Asia–Pacific NSW), which was demounted and fully restored. photography 1840s–1940s has been the main The 66 heads that form Dadang Christanto’s Heads treatment focus for the Paper section during the from the Northh 2004 were removed, surface cleaned year with hundreds of photographic images treated and placed back onto their specific display brackets and prepared for display. Included in the exhibition in the Sculpture Garden pond. Objects conservation is Bernardt Otto Holtermann and Charle’s Bayliss’s staff also undertook the first major treatment ten-metre-long Panorama of Sydney Harbour and program of the Pacific collection involving dating suburbs from the north shore 1875, which will some of the works and developing complex be displayed vertically for the first time. A major treatments for works from this collection that pose research project was undertaken into pigment unique conservation issues. consolidation on Danila Vasilieff works (e.g. Peter and the wolff) in association with the internship of The Paintings section managed the condition Sophia Elze, a conservation student from Cologne, checking and monitoring of all paintings in where a suitable treatment has been developed the exhibition Turner to Monet: the triumph to finally allow these works to go on display. The of landscapee as well as treating over 60 works Paper conservation section facilitated the National from Australian Surrealism: the Agapitos/ Research Institute in Tokyo who are currently Wilson collectionn. Major treatments included coordinating the treatment the Gallery’s Japanese The Matterhorn from Zermatt Valley 1861 fourteenth-century scroll The Buddha and the by Louis Buvelot along with Tom Roberts’s sixteen protectorss. The treatment of the Gallery’s Harbourscapee c.1896, Frederick McCubbin’s Russian newspaper collection was completed and the Hauling rails for a fence, Mount Macedon 1910, treatment of photographic albums and the satirical Percy Lindsay’s Ducks in garden, Creswick French newspaper Le Charivarii are underway. c.1890–1917 and Bernard Hall’s J. Montgomery, Esquire 1885. A large part of the year was devoted Providing care to works during storage and display to works for the exhibition Richard Larter: a has been a major undertaking by the department retrospectivee in which large paintings presented during the year. A silver-cleaning project resulted in unique problems for cleaning and stabilisation 100 works being cleaned and stored to reduce future before display. A total of 72 works were treated tarnishing. During the year a complete stocktake of for the exhibition: 16 of the Gallery’s works and the Gallery’s frames was undertaken and a database 56 works by private owners. for frame retrieval has been developed. Conservation staff prepared and packed over 800 works for Major conservation treatments this year have storage and manufactured or prepared over 3000 been carried out in the Textile section on a silk display mechanisms. patolaa from India and Shri Nathji and Saratt, an Indian pichhavaii. Research has been ongoing into the pigments and materials used to manufacture PROTECTION OFTHE COLLECTION pichhavaii as well as number of treatments for The protection of the national collection has been loans, including Margaret Preston’s rug Tea-tree maintained through the continued efforts and and Hakea petiolaris 1936. Conservation of theatre vigilance of the Gallery’s security staff, systems costumes are well underway for a major theatre and infrastructure. Security risks are reviewed costume exhibition in 2009 with the completion regularly and efforts are made to continuously of the Costume for a squid for the Ballets Russes
30 protection. The Gallery has enhanced and increased coverage of its closed-circuit television network, introducing over 120 additional cameras.
COLLECTION DOCUMENTATION The Gallery’s collection is accessioned and documented so that each work is accurately recorded, with this information held on a collection management system. This year 3256 works of art were inscribed with their respective accession numbers and the corresponding numbers on the collections management system were updated. The total number of catalogued work records for the collection at 30 June 2008 is 153532 individual works.
IMAGING AND DIGITISATION In support of the Gallery’s activities, 11081 digital images were created, of which 6794 were of works of art. These images were distributed widely and made available to the public nationally and internationally through catalogues, publications, the website, other cultural institutions, media outlets and commercial publishers.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 31 GOAL 2 INCREASE THE AUDIENCE FOR AND ENGAGEMENT WITH THE EXHIBITIONS AND PROGRAMS OF THE NATIONAL GALLERY OF AUSTRALIA
KEY STRATEGIES OVERVIEW s $ISPLAY WORKS OFART FROM THE NATIONAL ART COLLECTION The Gallery maintains an ambitious program of and from other collections in our building in a exhibitions and displays that provide visitors with a meaningful and engaging way stimulating, informative and enjoyable experience of the visual arts. Access to works of art from the s 2ESEARCH AND PRESENT A BALANCED STIMULATING four collecting areas of the national collection – informative and enjoyable exhibition program in Aboriginal and Torres Strait Islander Art, Australian Canberra, throughout Australia and internationally Art, International Art and Asian Art – is provided s $ISPLAY WORKS OF ART FROM THE 'ALLERYSCOLLECTION IN A locally, nationally and internationally through meaningful and engaging way and seek to increase displays and exhibitions, loans, educational and access to the collection locally, nationally and public programs as well as through printed and internationally through loans, partnerships, electronic publishing. travelling exhibitions and joint ventures During 2007–08 a total of 6230179 people visited s -AXIMISE OPPORTUNITY THROUGH THE 'ALLERYSONLINE the National Gallery of Australia’s collection program to allow access to Gallery research, and its temporary and travelling exhibitions. Of information on the national art collection and these, 502320 came to the Gallery in Canberra, exhibitions to be widely accessible 563914 visited the Gallery’s travelling exhibitions s )NCREASE AWARENESS OF THE 'ALLERYS #OLLECTION 3TUDY and 5163945 people attended exhibitions, which Room, which provides physical access in Canberra, included works of art on loan from the national by appointment, to works of art not on display collection in venues around Australia and throughout the world. s #ONDUCT EVENTS SUCH AS ARTISTS TALKS CONFERENCES AND symposia that stimulate debate, discussion and The total numbers of visitors to the National Gallery understanding about the visual arts of Australia in Canberra, to Gallery exhibitions in s 0UBLISH INFORMATION ABOUT THE COLLECTION AND Australia and to Gallery exhibitions internationally exhibitions in books, catalogues, in the Gallery’s from 2002–03 to 2007–08 is included in Appendix 7. quarterly magazine, Artonvieww, journals and electronically s $EVELOP RESEARCH COLLECTIONS AND ARCHIVES IN THE ACCESSTOTHE NATIONAL visual arts to support the Gallery’s collection and COLLECTION scholarly consideration of works of art Access to the national collection was achieved s $ESIGN AND DELIVER TARGETED PROGRAMS FOR STUDENTS through the display of works from the collection and teachers at the Gallery in Canberra, the provision of works in travelling exhibitions, through the loans of s 0ROVIDE ACCESS AND ENGAGEMENT FOR PEOPLEWITH works to official residences and for exhibition particular needs by others, arranged visits to view works in the s 0ROMOTE AND SUPPORT THE 'ALLERYS COLLECTION Gallery’s Collection Study Room and print and exhibitions and associated programs through focused electronic publishing. and strategic marketing s &OSTER PARTNERSHIPS THAT ENHANCE THE 'ALLERYS PROlLE In 2007–08 the Gallery loaned 1532 works of art from the national collection. Outward loan details s 2EVIEW AND IMPROVE THE .ATIONAL 'ALLERY OF are included in Appendices 9 and 11. Details of Australia brand inward loans are included in Appendix 10.
32 DISPLAY OFTHE COLLECTION figure groups, from his sparkling oil sketches to The National Gallery of Australia regularly changes his major battle paintings and large sculpture. It the display of its permanent collection in order displayed the full breadth of Lambert’s approaches to provide access to a wide range of works of art. to image making and the variety of his handling of This practice ensures that fragile items are rested, pencil, pen and paint. It also demonstrated his sure recent acquisitions are shown to the public and that draughtsmanship and the seductive glamour and popular items are rotated. sensual appeal of his paint surfaces. The Gallery also maintains a program of changing exhibitions in the Project Gallery and the Orde Culture Warriors: National Indigenous Poynton Gallery. These exhibitions are drawn mainly Art Triennial from the permanent collection, and sometimes 13 October 2007 – 10 February 2008 complemented by loans, and highlight specific areas The National Gallery of Australia presented its of the Gallery’s collection. inaugural National Indigenous Art Triennial in 2007. Works by 30 Indigenous Australian artists The Gallery ran a program of changing exhibitions were selected to represent the diversity of regions in the Children’s Gallery, a dedicated space designed throughout Australia and to demonstrated the to introduce children and families to aspects of incredible range of contemporary Indigenous art the collection. practice. The works in the exhibition were all created within the past three years and included painting The Gallery also undertook major refurbishment of on canvas and bark, sculpture, weaving, new media, various permanent collection display spaces. In July photomedia, printmaking and installation work. 2007, the Gallery launched a new Pacific Arts gallery. Culture Warriors: National Indigenous Art Triennial The new, custom-designed display of the Pacific Arts provided a highly considered snapshot of Aboriginal collection in new showcases and newly engineered and Torres Straight Islander contemporary and constructed plinths included many works never art practice. before seen on public display.
In September 2007 the Gallery opened improved Australian Surrealism: the Agapitos/ displays of Australian nineteenth- and early Wilson collection twentieth-century works of art, installed new 16 February – 11 May 2008 displays of Pacific Art, Art of the Americas and Art Surrealism, the great revolutionary movement of Africa in the foyer, and in April 2008 the new originating in France in the 1920s, was to change East Asian art display was opened. the course of Australian art in the late 1930s. A generation of Australian artists, including James Gleeson, Sidney Nolan, Albert Tucker, Arthur Boyd EXHIBITIONS and Max Dupain, encountered Surrealism at a A total of 16 exhibitions and new galleries were formative time in their careers, and its influence presented in the Gallery during 2007–08 (see transformed their art forever. This exhibition, Appendix 6). Five major exhibitions were the drawn from the recently acquired Agapitos/Wilson highlight of the year. collection of Australian Surrealist art, showed the extraordinary breadth of surrealist practice in this George W Lambert retrospective: country from the 1920s to the 1950s. Including important works by some of Australia’s greatest heroes and icons artists, the exhibition also presented the work 29 June – 16 September 2007 of lesser-known artists whose involvement with George Lambert (1873–1930) was one of Australia’s Surrealism has only recently come to light. most brilliant, witty and fascinating artists. The exhibition, the most comprehensive showing of Lambert’s work for over 50 years, presented the diverse range of Lambert’s work from his Australian
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 33 Turner to Monet: the triumph by one of Australia’s most influential modern of landscape artists. It opened at the National Gallery of Australia in December 2006 before travelling to five 14 March – 9 June 2008 other venues. This exhibition was a new look at landscape painting in the nineteenth century as it transformed from This was the first exhibition of Grace Crowley’s work the depiction of known places to explorations of since 1975. It included important works from public mood and time passing. Painters ventured into the and private collections and traced her remarkable wilderness, seeking extremes of nature. Increasingly, artistic journey from traditional landscapes to humans were shown in the city, where nature is avant-garde experimentation and pure abstraction. controlled. Works by the finest artists of the time – The exhibition included several newly rediscovered Turner, Constable, Friedrich, Corot, Courbet, Glover, paintings and the largest number of Crowley’s von Guérard, Church, Streeton, Roberts, Cézanne, abstract paintings ever assembled, enabling a new van Gogh, Gauguin, Monet – were gathered from appraisal of her achievement. public and private collections in Australia and from around the world. Ocean to Outback: Australian landscape painting 1850–1950 Richard Larter: a retrospective To mark the twenty-fifth anniversary of the National 20 June – 14 September 2008 Gallery of Australia, an exhibition of treasured Richard Larter is widely considered to be one of works from the national collection was released to Australia’s most distinguished artists. Born in 1929 tour to every state and territory in Australia. Ocean he arrived in Australia from England in 1962 and has to Outback was curated by National Gallery of created an impressive body of work. The exhibition Australia Director Ron Radford, AM, and celebrates conveys the artist’s ongoing interest in the human the rich history of landscape painting in Australia. body and sexuality, popular culture, politics and opposition to censorship. Larter’s non-figurative paintings reveal his mastery of abstract patterning War: the prints of Otto Dix and interest in music and the natural environment. This exhibition opened at the National Gallery of This retrospective also confirms Larter’s reputation Australia in 2005 and proved so popular that it was as one of Australia’s most audacious artists and then offered to four venues around Australia as reveals him to be a remarkable colourist and a travelling exhibition. The exhibition showcases technical innovator. Otto Dix’s war portfolio Der Kriegg [Warr] of 1924, a collection of 51 etchings with aquatint and drypoint. The work is regarded as one of the great TRAVELLING EXHIBITIONS masterpieces of the twentieth century. Consciously The Gallery’s travelling exhibitions program modelled on Goya’s equally famous and equally continues to be an energetic and important part devastating Los desastres de la guerraa [The disasters of our strategy for providing access to works of of warr], the portfolio captures Dix’s horror of, and art to a wide audience beyond Canberra – in fascination with, the experience of war. regional, remote and metropolitan areas throughout Australia, and internationally. The outstanding Culture Warriors: National Indigenous travelling exhibitions program is supported by Art Triennial maintenance of the highest museological standards. The inaugural National Indigenous Art Triennial shown at the Gallery as part of its twenty-fifth In 2007–08, six new exhibitions were released to tour anniversary celebrations began its three-venue tour and nine exhibitions were ongoing. at the Art Gallery of South Australia in Adelaide in June 2008. It will then travel to the Art Gallery Grace Crowley: being modern of Western Australia in Perth and the Gallery of Grace Crowley: being modernn is an important Modern Art in Brisbane. retrospective exhibition of paintings and drawings
34 Andy and Oz: parallel visions This exhibition was developed as a special damage to an indemnified work of art. Without Art international travelling exhibition in collaboration Indemnity Australia, the high cost of commercial with The Andy Warhol Museum, Pittsburgh, USA, as insurance would severely affect our ability to bring part of the National Gallery of Australia’s twenty- high-value works to Australia for major exhibitions. fifth anniversary. The exhibition brought together the work of four generations of Australian artists A key objective of the Art Indemnity Australia – Martin Sharp, Richard Larter, Robert Rooney, program is to provide the people of Australia Tracey Moffatt, Juan Davila, Fiona Hall and Tim with wide access to the world’s cultural treasures; Horn – and explored the parallels between the work 72 percent of visitors to Turner to Monett were of renowned American artist Andy Warhol and these from interstate, following an extensive national Australian artists. marketing campaign.
Art Indemnity Australia is an Australian Black robe white mist: art of the Government program managed by the Department Japanese Buddhist nun Rengetsu of the Environment, Water, Heritage and the Arts. Otagaki Rengetsu (1791–1875), Lotus Moon, was a Japanese Buddhist nun whose tragic life inspired extraordinary creativity. One of a small number VISIONS OF AUSTRALIA of prominent female artists of nineteenth-century The National Gallery of Australia acknowledges Japan, Rengetsu was a poet, calligrapher, potter the significant support it has received from the and painter. This exhibition travelled to two venues Australian Government, which administers the and showed contemplative works on paper and of Visions of Australia program, and the assistance the clay inscribed with Rengetsu’s elegant poetry and program gives to the National Gallery of Australia understated calligraphy. The works were largely to provide access to works of art for the people drawn from international private collections. of Australia. Visions of Australia is an Australian Government program that supports touring The Gallery regularly provides advice to venues exhibitions by providing funding assistance for the and arts professionals including organising and development and touring of Australian cultural presenting preventative conservation, registration material across Australia. and travelling exhibitions workshops. Visions of Australia and the Contemporary Touring In total 826 works of art (498 works from the Initiative, administered under the Visions program, Gallery’s collections and 328 inwards loans) were supported five National Gallery of Australia shown in this year’s travelling exhibitions. During travelling exhibitions throughout 2007–08. The 2007–08, 15 travelling exhibitions (including the Contemporary Touring Initiative, part of the three Elaine and Jim Wolfensohn Gift Travelling Australian Government’s Visual Arts and Craft Exhibitions suitcases and the 1888 Melbourne Cup) Strategy, an initiative of the Australian Government were visited by 563914 people at 88 venues. and state and territory governments, assists major collecting institutions with the development and Details of travelling exhibitions for 2007–08 are touring of major exhibitions of contemporary included in Appendix 8. Australian visual arts and craft across Australia.
The children’s focus exhibition Stage fright: the ART INDEMNITY AUSTRALIA art of theatree, which began its tour in 2006–07, The Australian Government, through Art Indemnity was supported by a Visions of Australia grant and Australia, indemnifies major works of art and concluded its five-venue tour throughout Australia antiquities that tour Australia. in 2007–08.
Art Indemnity Australia supported the Gallery’s In 2006–07, Visions of Australia supported the five- exhibition Turner to Monet: the triumph of venue tour of the exhibition Michael Riley: sights landscapee. The Commonwealth acts as insurer unseenn, which also concluded in 2007–08.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 35 In 2007–08, Visions of Australia supported one new- Gael Newton continued intensive research work release exhibition, Ocean to Outback: Australian for the acquisition program and the major landscape painting 1850–19500 and its nine-venue temporary exhibition Picture paradise: Asia–Pacific tour to every state and territory in Australia. photography 1840s–1940ss. Major loans from public and private institutions were secured. The The Contemporary Touring Initiative, administered exhibition will be the first survey show of the under the Visions of Australia program, supported history of photography in the Asia–Pacific region. the three-venue tour of Culture Warriors: National It is the National Gallery of Australia’s contribution Indigenous Art Trienniall, commencing in June 2008, to the Vivid Photography Festival in Canberra, and Australian Street Stencilss, commencing in 2010. which will see 100 exhibitions across 50 venues for which Gael Newton was an initiator and organising committee member. RESEARCH AND PUBLISHING The Gallery supports the research undertaken In November 2007, Gael Newton visited Hawaii, by staff with an active publishing program. The Arizona and California in the United States on program provides access to research material research and loan negotiation for the Gallery’s in both print and electronic formats. The exhibition Picture paradisee. Gael Newton gave publishing program is informed by the Gallery’s two presentations on the Gallery’s Asia–Pacific exhibition program and includes material such photographic collection and exhibition at the as room brochures, educational material and twenty-first annual Oracle International Meeting exhibition websites. of Photography Curators in Arizona.
Following Gael Newton’s presentation at the Oracle Australian Painting and Sculpture Meeting the Gallery was invited to contribute Dr Anna (Anne) Gray, Head of Australian Art and a dozen works to represent Australian pictorial Senior Curator of Australian Painting and Sculpture photography in the International Museum of before 1920 participated in the international study Photography (George Eastman House) and day on J M W Turner at the National Gallery of Art, Vancouver Art Gallery collaborative survey Washington, in October 2007 and the 32nd Congress exhibition Truth/Beauty: Pictorialism and the of the International Committee of the History of Art photograph as art 1845–19455. The Senior Curator in Melbourne in January 2008. She wrote entries on wrote an essay in the catalogue on Australian Orpen for the National Gallery of Victoria catalogue Pictorialism and also provided an essay for the Modern Britainn and on Constable, Daubigny, Girtin retrospective on Harold Cazneaux at the Art Gallery and Steer for the catalogue Turner to Monet: the of New South Wales, Artist in photographyy, to which triumph of landscapee. Dr Gray also contributed an the National Gallery loaned 14 works. essay ‘Art and the environment’ to Oxford University Press’s Australia’s Empiree, which is part of their Anne O’Hehir, contributed an essay on the series History of the British Empire companion series. Under the sign of Scorpioo by Tracey Moffatt for the catalogue for a festival of Indigenous photography at Australian Photography the Wood Street Galleries in Pittsburgh, USA. With volunteer Sharon O’Connor, she catalogued the The exhibition VIP: very important photographs Carol Jerrems archive, which came into the building 1840s to 1940ss, co-curated by Senior Curator of in 1981. It consists of 1593 photographs, 249 proof Photography Gael Newton and Assistant Curator of sheets and 581 proof shots. This also supplied Photography Anne O’Hehir, was very well received. greater information on the works already catalogued. The over 240 works on view across the Orde The works were also shot digitally, making the Poynton and Project Galleries represented highlights archive easily accessible. This was undertaken in of the Gallery’s renowned international and preparation for an exhibition including Jerrems’s Australian collections. The combined hanging of work to be held at Heide Museum and Art Gallery Australian and international works was particularly in Melbourne, which has an associated publication well received. Many comments were received about to which Anne O’Hehir will contribute an essay. the desire of the public to see local and foreign works side by side.
36 Serious research can now be done on a collection acquired in the 1980s that had not been catalogued. Australian National University, following which Robyn Maxwell, Melanie Eastburn and Lucie Folan After attending the Venice Biennale in June 2007, introduced students to the three recently installed Anne O’Hehir spent a month in India were she permanent Asian galleries. was able to continue her research into the career of expatriate Australian photographer Robyn Beeche, Asian art staff provided a textile seminar for view historical material for Picture paradisee at members of The Asian Arts Society of Australia a dealer gallery and increase her network and (TAASA). Robyn Maxwell introduced works in the knowledge of contemporary Indian photography, South and Southeast Asian galleries and Lucie Folan, particularly visiting photographer Dayanita Singh. Bronwyn Campbell (Assistant Manager, Travelling She also attended the Adelaide Biennale in 2008. Exhibitions) and Dr Hwei-Fen Cheah (Lecturer in The Gallery’s interest in contemporary Indian Art History, ANU) delivered talks on works from photography has been appreciated given that much the national collection – tablet weaving in Southeast foreign attention is exclusively on the era of the Asia, symbolism on Lao textiles and Southeast Asian British Raj. beadwork respectively. Staff from the department also organised the temporary display of works of Asian Art Chinese art to coincide with the production of William Yang’s play Emma’s Dynastyy presented by In addition to increasing engagement with the Jigsaw Theatre Company, throughout which the permanent collection of Asian art through the Gallery’s Tang dynasty Standing horsee was a journal articles, public talks and other programs, prominent image. Asian art staff assisted renowned the exhibition Black robe white mist: art of the dancer and choreographer Padma Menon with her Japanese Buddhist nun Rengetsuu, proved popular presentation of an illustrated lecture and dance to a wide range of visitors and attracted new demonstration about goddesses in Indian art and audiences to the Gallery. The exhibition, the first culture, using images of works from the collection. on the subject outside of Japan, was accompanied The performance was held at the National Gallery of by a major catalogue coordinated by Asian art Australia as part of UTSAV 2008 – Dance, Women, staff. The catalogue features a biographical essay Culture and featured acclaimed Indian dancers about the artist by Curator Melanie Eastburn and Sulini Nair and Dheepu Baburaj. essays by some of the world’s foremost scholars of Rengetsu’s work, Japanese art and Buddhism In terms of research, staff investigated a range of – Patricia J Graham, John Stevens, Meher cultural heritage issues with regard to more clearly McArthur, Sayumi Takahashi, Sandra Sheckter articulating the Gallery’s approach to ethical and Chiaki Ajioka. Assistant Curator Lucie Folan acquisition, an area of particular relevance to coordinated the translations of Rengetsu’s poems in Asian art. the exhibition and book. Many of the translations are the result of new work by Sayumi Takahashi Robyn Maxwell wrote the catalogue essay for and Chiaki Ajioka and have been recognised as Dadang Christanto’s exhibition at Sherman exemplary. Published in English and Japanese, Galleries, Sydney, and has been continuing research they make a considerable contribution to the towards the Gallery’s forthcoming exhibition of understanding of Rengetsu’s output. All special ancestral art from Southeast Asia, To please the events associated with the exhibition were extremely living and the dead. well attended, with several oversubscribed. The exhibition travelled from the National Gallery of Lucie Folan conducted an interview with Hab Touch, Australia to Hamilton Art Gallery and RMIT Gallery Director of the National Museum of Cambodia, in Melbourne. Senior Curator Robyn Maxwell gave published in Orientationss. Based on her research lectures at both venues. on Indian pichhavaii paintings depicting the god Krishna, she also wrote an article on the Gallery’s Robyn Maxwell also lectured on Southeast Asian Krishnalilaa shrine painting for TAASA Review. bronzes at the University of Sydney, and on the history of collecting and exhibiting Asian art at the
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 37 Melanie Eastburn has begun preliminary work Woodfire Conference in Mittagong, opened two towards a publication on the national collection exhibitions in Sydney and Canberra and gave five of Indian and South Asian art. lectures on the collection, including a Gallery series of three lectures on aspects of twentieth century Two consultants, Dr Michelle Antoinette and Dr design. He continued to work with Sandy Benjamin, Chiaki Ajioka, were contracted by the department. Chair of the Gallery Foundation’s Decorative Dr Antoinette, a specialist in contemporary Arts and Design Collection Development Fund, Southeast Asian art from the Australian National on projects to assist in the development of the University, researched and catalogued part of the Decorative Arts and Design collection. Gallery’s small contemporary Asian art collection while Dr Ajioka contributed valuable detail International Painting and Sculpture concerning the Gallery’s collection of prints by the Japanese artist Munakata Shiko. Christine Dixon, Senior Curator, International Painting and Sculpture, presented a keynote address to the Art Gallery of NSW symposium Sculpture International Decorative Arts and Design by the Seaa on the history and re-installation of Dr Robert Bell, Senior Curator of Decorative Arts the National Gallery of Australia’s Sculpture and Design, continued with research on historical Gallery. Her essay ‘Nature becomes art: Landscape and contemporary Australian and international and modernism’ was published in the catalogue ceramics, glass, jewellery, metalwork, textiles, Turner to Monet: the triumph of landscape. furniture and costume, resulting in acquisitions, She also contributed 22 catalogue entries to this published articles and improved cataloguing and major publication. documentation of artists and designers in these artforms that are represented in the collection. Lucina Ward, Curator, International Painting and This research informed the new presentation of Sculpture, contributed entries on Jacob Epstein’s over 60 Australian and international decorative sculpture for the National Gallery of Victoria’s arts works in the permanent galleries. Decorative catalogue Modern Britainn. She also gave a talk Arts and Design volunteer Pen Roberts continued on this artist as part of the program for the 32nd research on Australian women textile designers. Congress of the International Committee of the History of Artt in Melbourne. She contributed the With assistance from Decorative Arts and Design essay ‘Science and the Sublime: nature as spectacle’ volunteers Meredith Hinchliffe and Jane Herring and 17 entries to in the catalogue Turner to Monet. Robert Bell continued research on the Gallery’s Lucina Ward continued her research on the Arundel extensive collection of costumes from the Ballets Society, presenting a seminar paper as part of her Russes de Serge Diaghilev and the Ballets Russes de Australian National University doctoral project. Monte Carlo in preparation for a major exhibition of these works in December 2009. Research and Exhibition assistants Niki van den Heuvel and re-cataloguing of this collection is the major Simeran Maxwell and interns Emilie Owens, continuing task in preparation for a new publication Kathleen Warden and Elizabeth Welden contributed on this collection in 2009. He continued to work 11 entries for the Turner to Monett. Christine Dixon, closely with the Gallery’s textile conservators on the Lucina Ward and Niki van den Heuvel also wrote conservation program for these works. Decorative many texts to publicise the exhibition. Arts and Design volunteer Diana Woollard a former curator of the Gallery’s theatre costume collection, International Prints, Drawings continued to advise on aspects of the Ballets Russes and Illustrated Books collection history. Senior Curator Jane Kinsman carried out research Robert Bell was awarded a PhD from the Australian on late nineteenth-century and early Modernist National University for his thesis, Nordic wave: a prints and illustrated books. She also carried out study of the reception and influence of Scandinavian research for the forthcoming exhibition on Edgar design in Australiaa. He presented a keynote paper on Degas, for which she is preparing a catalogue. contemporary Australian ceramics at the 2008 Sturt
38 Curator Mark Henshaw continued research into 636 were given tours by the poster collection. Curator Jaklyn Babington voluntary guides. Self-guided and unbooked school undertook research on prints by artists in the groups also visited the Gallery, totalling 11987. Tyler collection for publication on the website. She also continued the documentation of film, sound, To promote the Gallery’s education programs, photography and other archival material relating information brochures were sent in collaboration to the collection. In this she was ably assisted by with the National Capital Education Tourism Gwen Horsefield and Emilie Owens. Project to all schools in Australia. Staff worked collaboratively to promote exhibitions, activities Pacific Arts and programs through radio, television and media. Professional development sessions and teachers Crispin Howarth, Assistant Curator for Pacific Arts previews for secondary, primary and early- presented public lectures regarding the Gallery’s childhood teachers were held relating to the national collection: Some experiences of a novice curatorr for collection and for each major exhibition. the Museum Studies group at Deakin University in October 2007 and The future role of the National Gallery of Australia Pacific Arts collectionn for the Highlights Association for Social Anthropology in Oceania The Art and Alzheimer’s project is a special program conference at the Australian National University in for people living with dementia and was run in January 2008. collaboration with the Australian Alzheimer’s Association. The program was highly successful Crispin Howarth was recipient of the Gordon and a short video was produced. Education staff Darling Foundation Travel Grant during October made presentations about the project at various 2007, which enabled research into the interpretation forums during Alzheimer’s NSW Dementia and display options of non-western art with Awareness Month. a particular focus on Pacific Arts in American institutions in New York, Washington, Chicago, The Big draww event in September 2007 attracted St. Louis, Minneapolis, San Francisco and Honolulu. over 1000 visitors to the Gallery for a day celebrating drawing with thirteen artists who conducted Crispin Howarth delivered the keynote paper Inside drawing workshops. the Pacific Arts collectionn for the Oceanic Art Society’s inaugural annual forum. The forum itself Sculpture Garden Sundayy was a day of workshops, was organised by the Oceanic Art Society and hosted music and dance, which attracted 2000 visitors. by the Gallery. A new Sculpture Gallery trail for children was launched at this event. An article by Crispin Howarth, ‘Truly hidden treasures: the Pacific arts gallery of the National The 2008 National Gallery of Australia and Sony Gallery of Australia’, appeared in the journal Tribal. Foundation Summer Scholarship brought sixteen students–two from each state and territory – to the Research, storage and conservation projects on the Gallery for an intensive week of study focusing on Melanesian collection were undertaken between the visual arts. November 2007 and May 2008 with particular focus on the Dargie collection of New Guinea art and the Children’s Gallery Reverend Fellows collection of Massim art. The Children’s Gallery is dedicated to exhibitions drawn from the national collection and aimed at EDUCATION enriching children’s visits to the National Gallery of Australia. These exhibitions encourage children to From across Australia a total of 75543 students and be engaged by art, and are supported by a range of teachers in organised excursion groups participated interactive activities. in the Gallery’s education programs during the year. This included 37920 students who were given
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 39 Drawn in impairments. Over 200 special access visitors 14 July 2007 – 30 March 2008 attended Gallery organised tours and viewings with Beginning with the drawings of George W Lambert, hundreds more visiting the exhibition. the exhibition explored some of the ways in which artists use drawing. The exhibition also included Special access tours of the permanent collection works by Sidney Nolan, Fred Williams and many were scheduled regularly throughout the year and other noted Australian artists. advertised in the Eventss brochure. The total number of tours, including tours for carers and people with Treescape disabilities, was 23. A total of 4 tours were scheduled for people who are deaf or have impaired hearing, 12 April – 30 August 2008 and 4 descriptive or touch tours were scheduled Treescape was an exhibition designed for children 3 for people who are blind or who have low vision. A to 8 years of age held in conjunction with the major further 26 tours were booked by community groups exhibition Turner to Monett. Treescape encouraged working with people with a disability. children to discover works of art, which are made from trees, are about trees or even things that live Voluntary guides in trees. Paintings, photographs, drawings, prints, sculpture, installations, furniture and installations Voluntary guides provided 1709 Discovery Tours were included in this wide-ranging exhibition. for 25636 primary school students plus twice-daily tours of the permanent display, major exhibitions Teacher activities and tours for specific groups, including government and diplomatic visitors for a further 21565 visitors. Australian History Identity and Values was a Voluntary guides offered tours of the collection and curriculum pilot project designed for primary exhibitions for a combined total of 47201 attendees. school teachers. The course related selected images of Australian art with core curriculum areas. During the year, voluntary guides began the Building Confident Teachers of the Visual Arts was Rendezvous with Art program where guides discuss another successful program organised for teachers selected works of art in depth with members of the from the early childhood and primary sectors. public before a function in the Members’ Lounge. During the year, six teacher in-services were held Voluntary guides also organised a day trip for – over 220 teachers attended the in-service for drought affected women and men from rural parts the exhibition Turner to Monett and each school of central NSW. Voluntary guides also presented attending received a kit containing a DVD and useful a program based on the Indian deity Krishna for printed material. A collaborative project between the the public. Gallery and the University of Canberra took place during the year. The project observed the interaction between adults and children while drawing. Collection Study Room Works of art in the national collection that are not Special access currently on display are available for viewing in the Collection Study Room (CSR). During 2007–08, During 2007–08 an unprecedented large number of 1190 members of the public viewed a total of people with disabilities attended Gallery programs. 6900 works of art. This presented special challenges for the Gallery with regards to physical access to the building. The Highlights of activity in the CSR included the Education section developed an extensive range of special blessing of objects by members of the special access opportunities, including organised local Maori and Pacific communities and a series viewings, tours and other programs. A broad range of well-attended talks by artists about works of of groups of people with disabilities attended these art not on display. Artists in the Out of the box events, including Onward Stroke Club, Tuggeranong series included, Vivienne Binns, eX de Medici and Men’s Dementia Group, The Rainbow group Savanhdary Vongpoothorn. recovering from mental illness, Canberra Lung Life Group and groups with vision and hearing
40 PUBLIC PROGRAMS s was a hip-hop concert and graffiti art display held in the Gallery’s underground More than 210 programs and events related to the car park as the closing celebration for Culture permanent collection and the Gallery’s temporary Warriors: National Indigenous Art Trienniall. The exhibition program were delivered. Lectures, event drew a crowd of 700 visitors and performers floortalks, symposia, concerts, films and workshops included Urthboy and Brothablack. Underground were presented to enhance visitors’ experiences of Soundss created positive awareness of the Gallery and the Gallery and its collections. tapped into Indigenous and youth culture through hip-hop music. The audience for these events comprised academics, teachers and students from the education sector, the general public, Gallery members and overseas Talks and lectures visitors. Attendance at public programs events A number of international artists and scholars totalled 17800, with 7200 visitors attending talks participated in the lecture program. These included and lectures, 4800 attending special events, 2600 the George W Lambert Symposiumm, which was attending screenings, 780 attending workshops and a collaborative event with the Australian War 2420 attending performances. Audiovisual technical Memorial. Speakers included Daniel Thomas support was provided for 935 events. (keynote), Mary Eagle, Deborah Edwards, Janda Gooding, Anna (Anne) Gray, Sasha Grishin These events were promoted through regular and Andrew Sayers. The forum The Triumph of weekly newspaper advertisements and through the Landscapee, held in conjunction with the exhibition distribution of the quarterlyy Eventss brochure of Turner to Monett, included speakers Charlotte which more than 160000 were distributed during Eyerman, St Louis Museum of Art, Dr Jenns the year. Programs could also be accessed via the Howoldt, Hamburger Kunstalle, and Dr Ted Gott, online calendar and associated web-pages. National Gallery of Victoria.
Highlights Many local, national and international artists and arts professionals also gave presentations on the Talkin’ up big: artists’ dayy marked the beginning Gallery’s collection and temporary exhibitions of the Culture Warriors: National Indigenous during the year. David Lubin of Wake Forest Art Trienniall exhibition. Over 600 visitors heard University in the United States gave a lecture 18 artists speak about their works in the exhibition. on American art and Betty Churcher discussed The artists included Arthur Koo’ekka Pambegan George W Lambert’s iconic war paintings. Other Jnr, Jean Baptiste Apuatimi, Treahna Hamm, visiting speakers included Vietnamese Buddhist Dennis Nona, Destiny Deacon and Gordon Hookey. teacher the Venerable Thich Quang Ba, Thai Other programs included an art interview series photographer Manit Sriwanichpoon, Philippine in which Ron Ramsey interviewed Colin and textiles expert Dr B Lynne Milgram of Ontario Elizabeth Laverty, Brenda L Croft interviewed College of Art and Design, USA, Dr Hwei-fen Cheah Beverly Knight and Hetti Perkins interviewed of the Australian National University and Frazer Apolline Kohen. Ward of Smith College in Massachusetts, USA. In October 2007 the Gallery celebrated its twenty- The Barbara Blac kman Temenos Foundation fifth anniversary with an open day, which saw Lecture: ‘Leonardo da Vinci’s The Last Supper’ over 2500 visitors participating in a wide range of was presented by writer and art historian, Andrew open day events. These included artists’ floortalks Wolpert. The Director, assistant directors, curators, by Richard Larter, Gareth Sansom, eX de Medici and Conservation, Education, Public Programs and Jan Senbergs. Other events were theatre and Exhibitions staff as well as voluntary guides productions developed specifically for the day; delivered approximately 120 lunchtime talks and talks by curators; behind-the-scenes tours; family symposia papers in front of works of art in gallery interactive tours; dance performances; comedy acts; spaces, in the Collection Study Room and in musical performances; workshops; Collection Study the theatres. Room talks; wine tastings; screenings, a Travelling Exhibitions display and a birthday cake.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 41 NAIDOC Week who delivered focus talks included: John McPhee, As NAIDOC Week commemorated its fiftieth Dr Tim Bonyhady, Jason Smith, David Hansen and anniversary, capacity audiences attended dance Dr Chiara O’Reilly. performances by Beizam Koedal and a lecture by Dr Anita Heiss. A workshop with shell artists Esme Timbery, Dulcie Greeno and Betty Grace was MEMBERS PROGRAMS well attended. Other activities included floortalks, During 2007–08 a total of 3013 National Gallery screenings and a dance workshop. of Australia members attended 49 events that were developed and delivered exclusively for members Screenings and their guests. Invitations to attend special exhibition viewings were sent to all members for all The Gallery regularly screened films about art and major exhibitions. artists with over 56 films and videos presented in conjunction with the exhibition program and in Throughout the year, members have enjoyed relation to the permanent collection. Film director special presentations, viewings and programs Bruce Beresford discussed his films Bride of the organised exclusively for their enjoyment. The windd and Breaker Morantt; both films were screened events allow members special access and a closer and introduced by Beresford. A series of films were connection with the Gallery, the national collection screened in connection with the Culture Warriors: and special exhibitions. Highlights include the National Indigenous Art Trienniall exhibition, George W Lambertt members’ opening, which sold including Ten canoess, which was introduced by out so quickly that a second opening event was its Director Rolf de Heer. The Australian premiere scheduled to meet demand and also sold out. As part screening of the film trilogy Journey into Buddhism, of the Gallery’s twenty-fifth anniversary celebrations, a series of documentaries about Southeast Asia and inaugural members, those members who joined Tibet, was held at the Gallery. the Gallery when it opened in 1982, were invited to attend a special function in association with Culture Performances Warriorss, which proved very popular. All events Performances held at the Gallery throughout the for Turner to Monett were heavily subscribed. The year, which related to aspects of the collection members’ opening cocktail reception and members’ and exhibitions, included Music and dance in black-tie dinner the following week also both sold Javanese artt, presented by Lydia Kieven, University out in record time. of Sydney, with a performance of live gamelan music. The Song Company performed Utopia, The number of events has almost doubled since last a program of music related to works on display year and has seen an increase of 36% in attendance throughout gallery spaces. A performance of at members events compared with the previous year. shakuhachi music by noted exponent Dr Riley Lee It has been a busy and productive year with excellent and the annual Autumn Promenadee that is part feedback from our members. of the Canberra International Music Festival – featuring performances by Louise Page, soprano, The Sculthorpe Quartet with William Barton on RESEARCH LIBRARY didjeridu and Melbourne improvisational trio During this past year, the Research Library has Jouissance – were highlights of the year. demonstrated a commitment to creating visibility of its richly diverse collections supporting research Public programs for the exhibition Turner to and scholarship. These encompass a broad range of Monet included Saturday evening Sunset Sessions, contemporary and historical materials that provide with expert focus talks, music of the nineteenth a frame of reference for interpreting art within its century performed by the ANU School of Music global context. Significant achievements have been and extended exhibition opening hours until 7 made in the development of these collections with pm. They included piano recitals by John Luxton, a concomitant increase in services offered to the Geoffrey Lancaster and a performance by the full Gallery staff and improved access for researchers School of Music Orchestra. Some of the speakers and the public. As one of the world’s great visual
42 arts libraries, the Research Library’s focus has been to raise its profile nationally and internationally, from 1972–2005. improving resource discovery and access to the Gallery’s archival treasures. Special collections and archives The Research Library received several artists’ Collections overview archives over the year. Archives preserved and The Research Library’s collection development catalogued this year include Helene Kirsova, program has centred on both the subjects of Gallery Mona Hessing, Michael Bogle, the William Dobell exhibitions over the year and further in-depth Foundation, Bernard Hall, Neil Roberts, Gallery A, development of the collection in specific Asian the Art Association of Australia and New Zealand countries. Through liaison with curators on the and John Leslie Wright. exhibition Culture Warriors: National Indigenous Art Trienniall, the holdings of published materials The ephemera collections consist of more than on Aboriginal and Torres Strait Islander art and 80000 files containing information on Australian artists was substantially increased. The acquisition and international artists, galleries, museums, of Asian photography publications has also been collectors and curators. Significant rehousing for a highlight in the preparation of Picture paradise: preservation and access has been completed for the Asia–Pacific photography 1840s–1940ss, as has a ANZ Art and Artists Files and the International Art concentrated effort to acquire scholarly catalogues and Artists Files. This included around 400 boxes in raissoné, worldwide. total for Macquarie Galleries, David Jones Gallery and the Redfern Gallery. The Peter Burns collection Notable acquisitions include an increase in the of invitations designed for the Heide Museum of holdings of an important series, Visionairee, a Modern Art have been rehoused and catalogued. serial from New York that has come out in limited, numbered editions three times a year since 1991. In the development of integrated resource discovery Each issue has a specific format and theme around and access to all of the collections, procedures and which prominent artists, designers, photographers templates were created to catalogue ephemera, and other guests edit the publication. The New archives and oral history interviews. Over 1000 Yorker called it a ‘gallery in print’. catalogue entries were added for Australian and New Zealand and international artists and organisations. The growth in collections continues to require more off-site storage. A major reconstruction of Oral histories compactus shelving was undertaken to ensure the collection is properly housed and preserved. This The James Gleeson oral history collection in the included the moving of one kilometre of volumes. National Gallery of Australia Research Library A program for distributing duplicate copies of some has been inscribed into UNESCO’s Australian monographs to other art libraries in Australia and Memory of the World 2008 register as being of New Zealand has been implemented. significant Australian cultural heritage. A website has been created to provide excerpts of the Gleeson interviews including audio and images at Electronic collections
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 43 STATISTICS 2006–07 2007–08 Interlibrary loan activity 508 585 Reference inquiries 2750 4403 Monographs acquisitions 1368 1767 Gifts and exchange acquisitions 2408 1500 Auction catalogue acquisitions 669 734 Ephemera acquisitions 1607118366 Total acquisitions excluding serials 20516 25634
Statistics strong, particularly the Turner to Monett exhibition The use of the Research Library has steadily grown catalogue, which had exceptionally high sales. over recent years. In 2007–08, reference inquiries increased by 60% and acquisition of monographs Trade sales increased by 30% over 2006–07. The Gallery continued to work with distributors, nationally and internationally, to expand the distribution of National Gallery of Australia PUBLISHING AND branded merchandise. MERCHANDISING Commercial operations Catering The National Gallery of Australia generates revenue The Café and Members’ Lounge benefited from through commercial operations that supplement the large crowds visiting for the Gallery’s twenty- government and other private funding. Commercial fifth anniversary celebrations and the Turner to activities include retail and wholesale operations and Monet exhibition. revenue from international and national distribution of Gallery publications. The outdoor Sculpture Garden Restaurant continued to be a popular venue for lunch, weddings The Gallery’s commercial operations also include and special events and during the year was enhanced publishing and merchandising. A wide selection with an upgrade of lighting and heating. of products and range of publications related to the collection enables the Gallery to engage with Venue hire audiences within and beyond the Gallery, extending Venue hire also continued to be popular with and expanding the Gallery experience. corporate clients with events ranging from working breakfast seminars to gala corporate dinners. This Commercial contracts include revenue collected for was particularly so during the major exhibition the grant of a licence to a catering contractor and Turner to Monett with a high number of private revenue from venue hire at the Gallery. viewings with external clients.
Retail store A new multifunction space will be included in the The Gallery Shop performed well offering a range Stage 1 building project. This will provide more of merchandise that extends access to the Gallery’s spaces available for hire. collections and provides a lasting memento of a visit or favourite work of art. The popularity of the Total revenue from commercial operations Gallery’s exhibition program was reflected in strong in 2007–08 was $3.526 million compared to sales of product developed for major exhibitions. $2.94 million in 2006–07. National Gallery of Australia catalogue sales were
44 PROMOTION OF GALLERY PROGRAMS perception of the National Gallery of Australia. In 2007–08 key announcements including the plan An extensive exhibition program saw the delivery to raise $25 million from the Gallery’s twenty- of marketing campaigns for seven major events fifth anniversary Gift Program, the first National during the financial year including the National Indigenous Art Triennial, key acquisitions and the Gallery of Australia’s twenty-fifth anniversary. In launch of a new Pacific gallery, received extensive addition to promotional activities for the Gallery’s and positive media coverage. permanent collection and new acquisitions, targeted marketing activities for exhibitions included A significant upgrade to media services on the George W Lambert, Culture Warriors, Australian National Gallery of Australia’s website has made Surrealism, Turner to Monet, Richard Larterr and information and imagery more accessible. This Picture paradise. upgrade was undertaken as part of the marketing program for Turner to Monett. The overwhelming The marketing campaigns for Culture Warriors, majority of media coverage of Turner to Monet the Gallery’s twenty-fifth anniversary and Turner was favourable. to Monett were specifically designed to have broad appeal and attract and educate new audiences. This was achieved using a range of methods including PUBLISHING non-traditional television commercials, website development and outdoor advertising. Almost Publishing activities provide and promote half (42%) of the audience who attended Turner access to information about works of art in the to Monett were first-time visitors to the Gallery Gallery’s collection, its exhibitions and scholarship and 59% identified that they had become aware through publications, print materials and the of the exhibition program through exposure to Gallery’s website. paid advertisements. Eleven new titles and one revised title written by Analysis of the impact of the exhibition on visitors curators and commissioned authors, were published found that 91% were impressed with the experience including the major titles George W Lambert and 94% reported an enhanced understanding of retrospective, Printed: images by Australian artists visual arts. 1885–1995 (vol 2), Culture Warriors: National Indigenous Art Trienniall 2007, Turner to Monet: the triumph of landscape and Richard Larterr. See BRANDING AND MEDIA Appendix 14 for details on publications. The National Gallery of Australia has initiated In addition the Gallery produced the quarterly research into the Gallery’s brand as part of a magazine Artonvieww; education resources for program to improve marketing performance and exhibitions and materials for public programs; increase audiences. This initiative is part of the promotional materials, including invitations, fliers, Gallery’s Strategic Plan to review and improve the brochures and posters; merchandise including card National Gallery of Australia brand. sets and posters; and designs for non-print product. The Gallery’s publications received several print The first phase of the research includes qualitative awards and Printed: images in colonial Australia and quantitative market research that will evaluate (vol 1) was shortlisted for the 56th Australian the current perception of the National Gallery of Publishers Association Book Design Awards in the Australia among target markets and stakeholders. reference and scholarly book category. This scope of research has not been undertaken in more than five years and will inform decision making across areas, including visitor services, Multimedia marketing, development, sponsorship, membership The Gallery’s website
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 45 Website usage continued to grow with 3.8 million pages viewed and 1.18 million visits. A major website redevelopment was completed following user- centred studies; new navigation was implemented throughout the website and a new homepage established; improved reporting was achieved through use of Google Analytics; and restoring e-commerce to the site reviewed.
Significant enhancements were made to the collection search
In addition to four issues of Artonlinee and education sites, the online team developed several exhibition sub-sites, including Ocean to Outback
More information on website visits is included in Appendix 15.
46 GOAL 3 CREATE A WELCOMING AND ENGAGING VISITOR EXPERIENCE
KEY STRATEGIES understand visitors who attended Turner to Monet, s %NSURE QUALITY VISITOR EXPERIENCES THROUGH IMPROVED the largest paid exhibition in 2007–08. Importantly building services and facilities, staff training, the exhibition attracted a higher proportion of improved wayfinding and directional signage males (50%) than usual for the National Gallery of s 5NDERTAKE ONGOING AUDIENCE RESEARCH AND Australia (36%). A large proportion of respondents implement findings cited Turner to Monet as their main reason for visiting Canberra (65%), which is an increase of s 2EVIEW AND REVISE THE RETAIL STRATEGY AND PRESENTATION 15% on previous major exhibitions in the last of the Gallery Shop two years. s $EVELOP PRODUCTIVE RELATIONSHIPSWITH EXTERNAL catering suppliers s #OMPLETE 3TAGE OF THE 'ALLERYS BUILDING NATIONAL GALLERY OF extensions, featuring improved visitor arrival, new AUSTRALIA BUILDING Gallery Shop, and collection display space for A project to refurbish and extend the Gallery Australian Indigenous Art, with minimal disruption building was announced in December 2006. Since to visitors and services then the Gallery has concluded the identified s $EVELOP DETAILED PLANS FOR 3TAGE OF THE 'ALLERYS work on refurbishment of the existing building building extensions, featuring the Centre for and has commenced construction of the Stage Australian Art, refurbished gallery spaces and other 1 South Entrance and Indigenous Australian improved facilities Galleries project. s $EVELOP A BUSINESS CASE AND SECURE FUNDING FOR This project will address a range of pressing needs in Stage 2 relation to the Gallery building, including improving arrival and entry facilities and enhancing collection display space, particularly for Aboriginal and VISITOR RESEARCH Torres Strait Islander art and visitor amenities. Visitor evaluation to understand interest in and satisfaction of experiencing the national collection Stage 1 will provide a new more visible and of art at the Gallery has been ongoing throughout accessible ground-level entrance to the south of 2007–08. the building, facing the current surface car park, The new entrance area will have escalators to and The methodology for this research has been a series from the public spaces on the main level and a of questions asked to explore general entry visitor lift will provide unassisted access to and from the interest in visiting and experiencing the national underground visitor car park. collection and temporary exhibitions. This research is conducted monthly. The entrance area will have new cloaking and reception facilities and a new shop. An adjacent Key findings for 2007–08 identified that 49% ground-level, multi-function space will be created of visitors to the Gallery were first time visitors, for orientation and programs, openings and 48% of visitors were interested in visiting the special events, and will open onto a newly created national collection and 29% of visitors preferred to Australian Garden. At the new ground level visit during a major exhibition. entrance there will be a specially dedicated area for the 1988 Aboriginal Memorial, one of the most
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 47 important works of art in the national collection. detailing the environmental performance of the Appropriately, this impressive sculptural installation organisation and the organisation’s contribution to will be the first work of art visitors will see as they ecologically sustainable development. This remains enter the Gallery. a key objective for the Gallery, and is being applied to the development of plans for the enhancement Above the new multi-function space there will be and ongoing maintenance of the building and the new galleries for Indigenous Australian art that organisation’s operations. will connect with the existing galleries on the main level. Each of these new galleries will be designed The Gallery endorsed and published an to accommodate the needs of specific types of Environmental Policy Statement and has also Indigenous art, with areas for small early dot endorsed the Waste Management Strategy. The paintings, large galleries for larger dot paintings, Gallery continues to focus on minimising waste by spaces for bark paintings, and for watercolours, addressing procurement policy, waste reduction, textiles, prints, ceramics and sculptures. The main waste reuse and waste recycling activities. galleries will be sky-lit, apart from those areas intended for the display of light-sensitive works The Gallery is developing a strategy to re-use waste such as textiles, baskets and watercolours. These water from the Reverse Osmosis plant such that the will be the first galleries in Australia designed for water is returned to a storage tank and then used for the specific needs of displaying different aspects of irrigation and/or for use in bathroom amenities in Indigenous Australian art. the new Gallery building.
Other key elements of Stage 1 include: s A lT OUT OF THE EXISTING UNDERCROFT TO THE 4EMPORARY HERITAGE MANAGEMENT Exhibitions galleries for relocated and dedicated art With the assistance of specialist consultants the packing, framing, storage and administrative Gallery prepared a Heritage Strategy in accordance facilities, including dedicated quarantine inspection with its obligations under section 341ZA of the and treatment spaces; EPBC Act. s NEW SEPARATED LOADING DOCKS AND MOVEMENT ROUTES This Heritage Strategy meets both the Gallery’s for works of art and general goods; and specific obligations to prepare a Heritage Strategy s IMPROVED LANDSCAPING AND EXTERNAL WORKS THAT in relation to the land it manages, and provides incorporate environmentally responsible water a strategy to meet its general obligations under management systems. the EPBC Act to take no action that has, will have or is likely to have a significant impact on the In addition a significant external Skyspacee sculpture, environment unless approved by the Minister for the designed by renowned American artist James Turrell, Environment, Heritage and the Arts. will be incorporated into the new Australian Garden.
The Gallery will remain open to the public throughout the period of construction. The new extension is expected to open early in 2010.
ECOLOGICALLY SUSTAINABLE DEVELOPMENT AND ENVIRONMENTAL PERFORMANCE In accordance with section 516A of the Environmental Protection and Biodiversity Conservation Act 19999 (Cwlth) (the EPBC Act) Australian Government agencies are required to include in their annual reports information
48 GOAL 4 SECURE AND STRATEGICALLY MANAGE RESOURCES TO SUPPORT GALLERY OPERATIONS AND ACTIVITIES
KEY STRATEGIES compared to $51.985 million in the previous s )N PARTNERSHIP WITH 'OVERNMENT AND THE PRIVATE financial year. $42.446 million (69%) was provided sector proactively secure levels of funding necessary by the Australian Government and, $19.098 for operations and programs appropriate to the million (31%) from other sources, compared Gallery’s national and international standing to $42.263 million (81%) and $9.722 million s $EMONSTRATE ENTREPRENEURIAL SKILLS AND WORK CLOSELY (19%) respectively in the previous year. with the National Gallery of Australia Foundation and the American Friends of the National Gallery of Expenses totalled $52.428 million, compared to Australia to secure increased support and $47.014 million in the previous year. A net operating revenue from: surplus of $9.116 million was achieved. All of this surplus related to donations in cash or in kind for s INDIVIDUALS the development of the Gallery’s collection of works s CORPORATIONS of art. s COMMERCIALOPERATIONS In addition an equity injection of $4 million was s SPONSORSHIPS GRANTS DONATIONS AND BEQUESTS received from the Australian Government to fund s MEMBERSHIP PROGRAM the development of the national collection. s !CKNOWLEDGEAND HONOUR ACTS OF BENEFACTION and support Capital outlays in the year of $16.471 million including expenditure on property, plant and s 2EVALUE THE NATIONAL ART COLLECTIONAND THE 2ESEARCH equipment, building refurbishment, the Stage 1: Library’s collection in accordance with South Entrance and Indigenous Australian accounting standards Galleries project and $25.671 million on collection s $EVELOP AND IMPLEMENT A LIFECYCLE ASSET MANAGEMENT acquisitions including: purchases of works of art, plan and sound facilities maintenance programs gifts of works of art, additions to the Research s !DOPT ENVIRONMENTALLY SUSTAINABLE POLICIES Library collection, and digitisation and conservation and practices of the collection. s )NTEGRATE INFORMATION AND COMMUNICATION technology infrastructure across Gallery activities ASSET MANAGEMENT and implement the recommendations of the 2007 The Gallery’s collection assets include works of art Review of Information Technology ($3.359 billion) and the Research Library collection s !DOPT APPROPRIATE RISK MANAGEMENT PRACTICES ($30 million). Works of art on display and works s %NSURE CURRENCY OF THE ENDORSED 2ISK -ANAGEMENT of art valued over $500 000 are valued individually Plan, Business Continuity Management Plan and with remaining collection items valued using related plans sampling techniques. s %NSURE CURRENCY OF THE $ISASTER 2ECOVERY PLANS The Gallery’s land and buildings are valued at $201.684 million. The Stage 1: South Entrance and FINANCIAL OPERATIONS Indigenous Australian Galleries project currently in progress will significantly increase the value of the Financial reports for the year 2007–08 are included building. Infrastructure, plant and equipment are on pages 59 to 89. valued at $2.083 million.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 49 GOVERNMENT FUNDING and philanthropic support for programming. In the financial year 2007–08, the Foundation received The Australian Government appropriations to significant support enabling the $25 million target to the Gallery in 2007–08 totalled $58.243 million, be achieved. $42.446 million for operational expenses and a $15.797 million equity injection. The equity The National Gallery of Australia Foundation injection comprised $4 million for the purchase Annual Report 2007–08 details the Foundation’s of works of art and $11.797 million for the operations, activities and the Board of Directors. Stage 1: Indigenous galleries and new entrance Further information may be obtained by building project. contacting the Foundation Office by telephone on (02) 6240 6454. PRIVATE FUNDING The Gallery’s program this year was achieved with AMERICAN FRIENDS OF the generous support of many sponsors and donors. THE NATIONAL GALLERY Donations of cash and works of art to the Gallery and the National Gallery of Australia Foundation, OF AUSTRALIA and sponsorship of the Gallery’s activities totalled The American Friends of the National Gallery of $8.694 million compared to $3.483 million in the Australia is a charitable foundation established in previous year. The Gallery’s objective of raising the United States of America to provide support to $25 million from the private sector through the National Gallery of Australia. Our American benefaction, sponsorship and grants over a three- Friends organisation provides support to the Gallery year period to mark the Gallery’s twenty-fifth through gifts and bequests of cash, works of art anniversary was achieved. and other property received by it from American taxpayers. Recent support to the Gallery from the American Friends has been made possible NATIONAL GALLERY OF through the generous support of Kenneth Tyler AUSTRALIA FOUNDATION and Marabeth Cohen-Tyler, the Wolfensohn Family Foundation and Mr David Rockefeller. The National Gallery of Australia Foundation is a non-profit organisation established to support the Gallery. It is a company limited by guarantee COMMERCIAL OPERATIONS under the Corporations Law. The Gallery controls the Foundation through its appointment of the The Gallery generates revenue through commercial Foundation’s Board. The Gallery’s Director, the operations that supplement government and other Council Chair and Council members are also private funding. Commercial activities include directors of the Foundation. retail, wholesale and revenue from worldwide distribution of gallery publications including royalty The Gallery’s Financial Report incorporates the and copyright fees. Commercial contracts include financial activities of the Foundation. Mr Charles revenue collected for the grant of a licence to a Curran, AC, Deputy Chair of the Council continues catering contractor, and revenue from venue hire at as the Chairman of the Foundation. the Gallery.
To commemorate the twenty-fifth anniversary of The Gallery’s commercial operations also include the opening of the Gallery, in 2006 the Foundation publishing and merchandising. A wide selection launched the Twenty-fifth Anniversary Gift of products and a range of publications related to Program. The objective of the program was to the collection enable the Gallery to engage with raise $25 million by the end of 2008 to assist with audiences within and beyond the Gallery, extending the further development of the national collection and expanding the Gallery experience. and to support Gallery programs. The program included gifts of cash, gifts of works of art, pledges, Total revenue earned from commercial operations sponsorships, grants, notified and received bequests in 2007–08 was $3.526 million, compared with $2.941 million in the previous year.
50 CONSULTANCY SERVICES assets is performed jointly by in-house technicians Consultants paid more than $10000 to undertake and outsourced contract support. work for the Gallery during the year totalled 32. The total cost of these consultancies was During 2007–08 a major upgrade of the Gallery’s $4.464 million. Consultancy services are used when main electrical switchboard was undertaken. there is a requirement for specialised services that cannot be undertaken by Gallery staff due to lack of expertise, insufficient in-house resources or where independent advice is required. The details of consultancies for 2007–08 are provided at Appendix 16.
COMPETITIVETENDERING AND CONTRACTING The Gallery is committed to achieving best value for money in its procurement practises. Purchasing practices and procedures are consistent with the Commonwealth Procurement Guidelines and best practise principles.
The Gallery remains committed to investigating outsourcing options in cases where this is beneficial. Services outsourced include cleaning, legal, internal audit, printing, construction and painting and other services.
MEMBERSHIP At 30 June 2008 the number of financial members of the Gallery totalled 21847 (21412 at 30 June 2007), which is equivalent to 11892 memberships. All Australian states and territories are represented in the national membership, the majority outside of the ACT being held in NSW and Victoria. Internationally, there are members in New Zealand, Asia, the United Kingdom, North America and Europe.
FACILITIES MANAGEMENT The Gallery has in place a series of policies, procedures and plans that govern how infrastructure and services are upgraded and maintained. A computerised maintenance management system has been implemented and is progressively incorporating all existing maintenance schedules. A waste management strategy is also being implemented.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 51 GOAL 5 PROVIDE A SAFE AND PRODUCTIVE WORKING ENVIRONMENT FOR ALL STAFF APPROPRIATETOTHE AUSTRALIAN PUBLIC SECTOR AND ART MUSEUM STANDARDS
KEY STRATEGIES STATISTICS ON STAFFING s !TTRACT DEVELOP AND RETAIN SKILLED STAFF Gallery staff are employed under the National Gallery Act 19755. On 30 June 2008 the Gallery s 0ROVIDE A WORK ENVIRONMENT IN WHICH STAFF MEMBERS employed 294 staff, made up of 193 permanent are encouraged and provided with opportunities to staff (83 male and 110 female), 54 temporary staff contribute to the maximum of their abilities (15 male and 39 female) and 47 casual employees s %NCOURAGE AND SUPPORT STAFF TO DEMONSTRATE (18 male and 29 female). The 193 permanent staff professional and personal conduct appropriate to an comprised 174 full time and 19 part time employees, art museum and consistent with the Gallery’s Code a slight increase from 192 in 2006–07. of Ethics and Guidelines on Personal and Professional Conduct The average staffing level during the year was 250.7 full-time equivalent (242.7 in 2006–07), s 2EVIEW AND IMPLEMENT THE 7ORKPLACE including staff engaged to service major exhibitions. Diversity Program s )NCREASE OPPORTUNITIES FOR !BORIGINAL TRAINEESHIP and employment WORKPLACE DIVERSITY s %NSURE STAFF OPERATE WITHIN THE 'ALLERYS ENDORSED AND EQUAL EMPLOYMENT policies related to the Occupational Health and OPPORTUNITY Safety legislative framework The Gallery values the contribution made by all staff through their diversity of backgrounds, experiences COLLECTIVE AGREEMENT and perspectives. A number of workshops on Indigenous cultural awareness were conducted The National Gallery Certified Agreement during the year. 2005–20088 has a nominal expiry date of 30 June 2008. Negotiations for a replacement Collective Agreement are progressing. REPORT ON PERFORMANCE IN IMPLEMENTINGTHE POLICIES AND PRACTICESTO COMMONWEALTH DISABILITY ESTABLISH APPROPRIATE ETHICAL STRATEGY STANDARDS The Gallery recognises the importance of the Disability Discrimination Act 19922 and is covered Ethical behaviour was promoted through the by the categories of provider, employer and inclusion of appropriate guidelines in staff purchaser under the Commonwealth Disability induction programs. Strategy Performance Reporting Framework. The following practices address performance criteria for these categories. WORKFORCE PLANNING, STAFF TURNOVER AND RETENTION Programs specially designed for people with During the year there were two retirements, two disabilities are regularly incorporated into the redundancies, and 24 resignations of permanent public programs calendar. Information is available staff. This represents a turnover rate of permanent on the Gallery’s website explaining accessibility to staff of 14.5%, or 11.2% of the Gallery’s full-time the building and special programs for people with equivalent staff. disabilities. Disability strategies are incorporated
52 into the development and continuous improvement INDIVIDUAL DEVELOPMENT AND of these programs. PERFORMANCE AGREEMENTS The Service Charter invites feedback on the Individual Development and Performance provision of Gallery services and how these can Agreements (IDPAs) enable staff, in consultation be improved. Comments and complaints received with their supervisors, to achieve a shared through the Service Charter and Visitor Book understanding of key strategic priorities as well as are responded to and addressed as appropriate. enabling career planning by identifying training Guidelines concerning complaints handling and development needs including a component on procedures are available on the Gallery’s website. /(3 COMPETENCY LEVELS AND REQUIREMENTS
All employment policies, procedures and practices IDPAs contribute to the development of a strong comply with the requirements of the Act. Training performance culture, increase productivity and and development programs consider the needs of individual performance, and ensure the alignment employees with disabilities. of individual effort to the key strategies and targets identified in the Gallery’s annual and strategic plans. All major contracts are reviewed centrally to ensure they meet Commonwealth guidelines. The IDPA process provides for formal feedback every six months as to an individual’s performance All exhibitions reflect consultation processes. Wide against key activities. consultation is undertaken with relevant officials from the community where appropriate. AUSTRALIAN WORKPLACE AGREEMENTS INDUSTRIAL DEMOCRACY Twelve Australian Workplace Agreements The Gallery is committed to consulting and were current at 30 June 2008. The Agreements communicating with employees and employees’ are designed to encourage and reward a high representatives about workplace issues. The Gallery performance culture and provide the flexibility Consultative Committee met on four occasions to attract and retain highly skilled employees at during the year. Its agreed purpose is to discuss senior levels. workplace issues in a spirit of cooperation and trust. PERFORMANCE PAY TRAINING AND DEVELOPMENT During the year performance bonuses totalling Gallery staff participated in a broad range of $81148 were paid to eligible employees. The amount corporate, program and professional training and of each bonus is determined by performance review. development activities throughout the year.
Training and development activities covered a COMPLAINTS wide range of programs including staff induction, There are two formal channels for persons to register /(3 FRAUD CONTROL INFORMATION TECHNOLOGY complaints concerning the Gallery: project management, writing skills, leadership s THROUGH THE SERVICE CHARTER WHICH ENABLES VISITORS TO and management training, mentoring and the Gallery (or to the Gallery’s website) to provide coaching, communicating with influence and feedback about services resolving conflict. s THROUGH COMPLAINTS HANDLING PROCEDURES THAT Expenditure on staff training during the year provide the means for members of the public and totalled $230000. Gallery employees to lodge complaints about any aspect of the Gallery’s operations.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 53 Details of feedback received through the Service OH&S committees and representatives Charter are included under the Corporate Overview 4HE /(3 #OMMITTEE IS MADE UP OF lVE at page 12. management representatives, the Occupational Health and Safety Manager and a representative Employees made one formal complaint or request from each of the five Designated Work Groups for assistance from the Gallery’s Human Resource $7' 4HE /(3 #OMMITTEE IS AN INTEGRAL Management Department in resolving issues. COMPONENT OF THE 'ALLERYS /(3 MANAGEMENT system, and has responsibility for driving the The Gallery’s complaints handling process is a establishment and maintenance of a partnership standing agenda item for a number of forums, relationship between Gallery management and including the Senior Managers Group and the employees in the management of OHS issues. Gallery Consultative Committee. DWG representation comprises a Health and Safety Representative (HSR) with a deputy HSR for each OCCUPATIONAL HEALTH Section within the DWG. All staff representatives AND SAFETY and their deputies have attended training conducted Health and safety management by the NSCA. arrangements 4HE 'ALLERYS /(3 #OMMITTEE MET FOUR TIMES The following information is provided In accordance during the year and the minutes of each meeting with Subsection 74(1) of the Occupational Health were made available to staff via the intranet and and Safety Act 1991. noticeboards.
The Gallery is in its sixth year of membership with OH&S Policies the National Safety Council of Australia (NSCA) and continues to actively implement all elements In 2007–08 the Gallery developed and issued new of the 5 Star Occupational Health and Safety /(3 POLICIES COVERING THE NEW(EALTH AND 3AFETY Management System. The Gallery underwent its management Arrangements, Community and Off fourth audit by the NSCA in July 2007 and was THE *OB (EALTH AND SAFETY !WARENESS AND THE /(3 AWARDED A 3TAR RATING FOR THE /(3 -ANAGEMENT Disposal Policy. A number of policies were reviewed. System and performance against the system. The overall result from the audit demonstrated OH&S training a continued commitment by management and The Gallery recognises that training is an integral employees to provide for and improve safe systems part of achieving and maintaining a high standard of work. Through the development of a Continuous of workplace safety. Training provided during Improvement Action Plan, the Gallery continues to 2007–08 included: REVIEW AND RElNE ITS /(3 -ANAGEMENT 3YSTEM s lRE SAFETY In accordance with Section 16(2) of the Act, a s DEVELOPMENT OF JOB SAFETY ANALYSIS AND STANDARD Health and Safety Management Arrangement has work procedures been developed that incorporates the existing 5 Star s /(3 REFRESHER system and demonstrates the Gallery’s commitment to meeting its duty of care under the Act. A number s DANGEROUS GOODSAND HAZARDOUS SUBSTANCES of policies have been developed that manage the s MANUAL HANDLING promotion and development of measures to ensure s EMPLOYEE /(3 AWARENESS the health, safety and welfare of employees at work and during the cyclical review of these policies, any s /(3 FOR MANAGERS changes necessary to comply with amendments to s TRAINING FOR HEALTH AND SAFETY REPRESENTATIVES the legislation incorporated. s OFlCE SAFETY ESSENTIALS s LEGAL AWARENESS FOR EMPLOYEES
54 OH&S activities OH&S and the building project As the Gallery makes extensive use of contractors, continued targeted efforts were made to improve management contractor, Manteena Pty Ltd the safety of their work in order to minimise the (MPL), and the Gallery have established a risk to themselves and others at or near Gallery sites. Safety and Integrated Systems Committee that This has included the issue of more than 340 work has responsibility for driving the development, permits that are only provided to contractors once implementation and maintenance of appropriate a number of conditions have been met, including strategies, policies and procedures for the safety and onsite induction of all contracted staff and provision health of personnel and the protection of works of of job safety analyses for work to be undertaken. art and the environment.
Incidents and investigations The objectives of the Safety and Integrated Systems Committee are to: Conclusion of previous investigations s PROVIDE AND MAINTAIN A HEALTHY AND SAFE ENVIRONMENT The second investigation into the possible for all personnel involved in or affected by the association of staff cancer related illnesses with the construction works Gallery environment, which commenced in 2006, is nearing conclusion. s PREVENT ACCIDENTS INJURY ILLNESS DISEASE AND dangerous situations related to the Stage 1 of the investigation (assessment of past construction works and present exposure to carcinogens) found in s FOSTERAND MAINTAIN EFFECTIVE AND COOPERATIVE March 2007 that from the available evidence, none relationships between MPL, the Gallery, Trade of the exposures seemed likely to have been high Contractors, Suppliers and the Office of the Federal enough to have meaningfully increased the risk of Safety Commissioner Gallery staff members, or members of the public, developing cancer. s ENSURE THAT WORKS OF ART AND THE ENVIRONMENT ARE appropriately protected. Stage 2 of the investigation involves an epidemiological study of past and present Gallery The Committee comprises representatives from employees, and is dependent upon authorisation the Gallery, Manteena and the Office of the Federal from the Australian Institute of Health and Welfare Safety Commissioner and the Site Safety Committee. for release of information on cancer cases from the state and territory cancer registries. This information was received by the Investigator in June 2008, and is expected to enable the report to be finalised in August 2008.
Details of the investigation are available on the Gallery’s website.
Notifiable Incidents The Gallery had 2 incidents that were notifiable under Section 68 of the Act.
The Gallery was not issued with notices or directions under sections 29, 45, 46 or 47 of the Occupational Health and Safety (Commonwealth Employment) Act 1991.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 55 GOAL 6 ENSURE THE HIGHEST STANDARDS OF CORPORATE GOVERNANCE
KEY STRATEGIES SENIOR EXECUTIVE SERVICE s )MPLEMENT AND MAINTAIN THE HIGHEST STANDARDS OF On 30 June 2008 the Gallery had four male and one corporate governance including processes such as female Senior Executive Service equivalent officers. strategic planning and performance The Director is Band 3 equivalent, the Deputy Director is Band 2 equivalent, and the three Assistant monitoring frameworks Director positions are Band 1 equivalent.
CORPORATE GOVERNANCE SENIOR MANAGEMENT The Gallery is committed to maintaining high COMMITTEES ANDTHEIR ROLES standards of corporate governance. The Gallery Council oversees and endorses the strategic The Gallery has a long established and effective planning and performance framework and monitors framework for decision-making, communication the Gallery’s progress through regular reports and consultation that seeks to be consultative and on performance against the Gallery’s endorsed provide opportunities for staff to participate in the Strategic Plan. planning and delivery of programs and activities.
The Council Chairman and Director meet with the Minister to review the Gallery’s performance.
MINISTER’S STATEMENT OF EXPECTATIONS The expectations of the Government for the period 1 July 2007 to 30 June 2008 were formally communicated to the Gallery in the form of a Statement of Expectations issued by the Minister. The Statement of Expectations was published on the Gallery’s website and the Gallery was accountable for meeting the priorities expressed in the statement.
The Statement of Expectations will be replaced by a Charter of Operations from 2008–09.
SENIOR EXECUTIVES ANDTHEIR RESPONSIBILITIES Four Program Managers, together with the Director, comprise the senior management team. This team meets weekly to develop strategies, review policies, provide advice to the Director and Council and coordinate the Gallery’s activities.
56 GOAL 7 BUILD PRODUCTIVE RELATIONSHIPS WITH GOVERNMENT AND OTHER STAKEHOLDERS
KEY STRATEGIES s "E RESPONSIVE TO 'OVERNMENT AND TO THE 0ARLIAMENT while fulfilling our functions s 7ORK COOPERATIVELY WITH THE $EPARTMENT OF Environment, Water, Heritage and the Arts and with other portfolio agencies s #ONSULT AND ACT COLLABORATIVELY WITH OTHER PORTFOLIO collecting agencies on preservation issues
RESPONSIVENESSTO GOVERNMENT ANDTHE PARLIAMENT The Gallery has been responsive to the Government and the Parliament. Gallery representatives have appeared before the Senate Standing Committee on Environment, Communications and the Arts and the Joint Standing Committee on the National Capital and External Territories.
WORKING COOPERATIVELY AND COLLABORATIVELY The Gallery has worked cooperatively with the Department of the Environment, Water, Heritage and the Arts and other portfolio agencies and continues to consult and act collaboratively.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 57
FINANCIAL REPORTS 60 NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 61 1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(6 67$7(0(17%<7+(&281&,/$1'&+,()(;(&87,9( ,QRXURSLQLRQWKHDWWDFKHGILQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG-XQHDUHEDVHG RQSURSHUO\PDLQWDLQHGILQDQFLDOUHFRUGVDQGJLYHDWUXHDQGIDLUYLHZRIWKHPDWWHUVUHTXLUHG E\WKH)LQDQFH0LQLVWHU¶V2UGHUVPDGHXQGHUWKH&RPPRQZHDOWK$XWKRULWLHVDQG&RPSDQLHV $FW 7KH 0LQLVWHU IRU )LQDQFH DQG 'HUHJXODWLRQ KDV JUDQWHG WKH 1DWLRQDO *DOOHU\RI$XVWUDOLDDQ H[HPSWLRQ IURP WKH DSSOLFDWLRQ RI VHFWLRQ RI 6FKHGXOH WR WKH &RPPRQZHDOWK $XWKRULWLHVDQG&RPSDQLHV2UGHUV )LQDQFLDO6WDWHPHQWVIRUSHULRGVHQGLQJRQRUDIWHU-XO\ 7KLVH[HPSWLRQUHODWHVWRWKHUHTXLUHPHQWWKDWKHULWDJHDQGFXOWXUDODVVHWVZLWKXVHIXO OLYHVLQH[FHVVRI\HDUVVKDOOQRWEHGHSUHFLDWHG ,QRXURSLQLRQDWWKHGDWHRIWKLVVWDWHPHQWWKHUHDUHUHDVRQDEOHJURXQGVWREHOLHYHWKDWWKH 1DWLRQDO*DOOHU\RI$XVWUDOLDZLOOEHDEOHWRSD\LWVGHEWVDVDQGZKHQWKH\EHFRPHGXHDQG SD\DEOH 7KLVVWDWHPHQWLVPDGHLQDFFRUGDQFHZLWKDUHVROXWLRQRIWKH&RXQFLO 6LJQHG«««««««««««««« 6LJQHG««««««««««««« 5XSHUW0\HU$0 5RQ5DGIRUG$0 &KDLUPDQ 'LUHFWRU $XJXVW $XJXVW 6LJQHG«««««««««««««« 6LJQHG««««««««««««« $ODQ)URXG 'HUPRW:DOVK 'HSXW\'LUHFWRU &KLHI)LQDQFH2IILFHU $XJXVW $XJXVW
62 7+(1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(6 ,1&20(67$7(0(17 IRUWKHSHULRGHQGHG-XQH
&RQVROLGDWHG 1*$
1RWHV ,1&20( 5HYHQXH 5HYHQXHIURP*RYHUQPHQW 6DOHRIJRRGVDQGUHQGHULQJRIVHUYLFHV &RQWULEXWLRQV $ $UWDFTXLVLWLRQVJLIWV % ,QWHUHVW & 2WKHUUHYHQXH ' 7RWDOUHYHQXH
*DLQV 1HWJDLQIURPVDOHRIDVVHWV ( 2WKHUJDLQV ) 7RWDOJDLQV 7RWDO,QFRPH
(;3(16(6 (PSOR\HHEHQHILWV $ 6XSSOLHUV % 'HSUHFLDWLRQDQGDPRUWLVDWLRQ & :ULWHGRZQDQGLPSDLUPHQWRIDVVHWV ' 7RWDO([SHQVHV
6XUSOXV 'HILFLW
7KHDERYHVWDWHPHQWVKRXOGEHUHDGLQFRQMXQFWLRQZLWKWKHDFFRPSDQ\LQJQRWHV
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 63 7+(1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(6 %$/$1&(6+((7 DVDW-XQH
&RQVROLGDWHG 1*$
1RWHV $66(76 )LQDQFLDODVVHWV &DVKDQGFDVKHTXLYDOHQWV ,QYHVWPHQWV 7UDGHDQGRWKHUUHFHLYDEOHV 2WKHUILQDQFLDODVVHWV 7RWDOILQDQFLDODVVHWV
1RQILQDQFLDODVVHWV /DQGDQGEXLOGLQJV $ ,QIUDVWUXFWXUHSODQWDQGHTXLSPHQW % +HULWDJHDQGFXOWXUDODVVHWV ,QWDQJLEOHV ,QYHQWRULHV 2WKHUQRQILQDQFLDODVVHWV 7RWDOQRQILQDQFLDODVVHWV
7RWDO$VVHWV
/,$%,/,7,(6 3URYLVLRQV (PSOR\HH3URYLVLRQV $ 7RWDOSURYLVLRQV
3D\DEOHV 6XSSOLHUV % 7RWDOSD\DEOHV
7RWDO/LDELOLWLHV
1HW$VVHWV
(48,7<
&RQWULEXWHGHTXLW\ 5HVHUYHV 5HWDLQHGVXUSOXV 7RWDO(TXLW\
&XUUHQWDVVHWV 1RQFXUUHQWDVVHWV &XUUHQWOLDELOLWLHV 1RQFXUUHQWOLDELOLWLHV
7KHDERYHVWDWHPHQWVKRXOGEHUHDGLQFRQMXQFWLRQZLWKWKHDFFRPSDQ\LQJQRWHV
64 1*$ 7RWDO(TXLW\ 7RWDO(TXLW\ &RQVROLGDWHG LWDO 1*$ &RQVROLGDWHG 1*$ &RQVROLGDWHG $VVHW5HYDOXDWLRQ5HVHUYH &RQWULEXWHG(TXLW\&DSLWDO 1*$ &RQVROLGDWHG 5HWDLQHG6XUSOXV $VVHW5HYDOXDWLRQ5HVHUYH &RQWULEXWHG(TXLW\&DS 5HWDLQHG6XUSOXV WLRQZLWKWKHDFFRPSDQ\LQJQRWHV Q$FFRXQWLQJSROLFLHV Q$FFRXQWLQJSROLFLHV KRXOGEHUHDGLQFRQMXQF $SSURSULDWLRQ HTXLW\LQMHFWLRQ 5HYDOXDWLRQDGMXVWPHQW %DODQFHFDUULHGIRUZDUGIURPSUHYLRXVSHULRG $GMXVWPHQWIRUFKDQJHVL %DODQFHFDUULHGIRUZDUGIURPSUHYLRXVSHULRG $SSURSULDWLRQ HTXLW\LQMHFWLRQ $GMXVWPHQWIRUFKDQJHVL 5HYDOXDWLRQDGMXVWPHQW 6XUSOXV 'HILFLW IRUWKHSHULRG 6XUSOXV 'HILFLW IRUWKHSHULRG 7RWDOLQFRPHDQGH[SHQVHV 7UDQVDFWLRQVZLWKRZQHUV &RQWULEXWLRQVE\2ZQHUV $GMXVWHG2SHQLQJ%DODQFH ,QFRPHDQG([SHQVH 2SHQLQJ%DODQFH GLUHFWO\LQ(TXLW\ 2SHQLQJ%DODQFH 7RWDOLQFRPHDQGH[SHQVHV 7UDQVDFWLRQVZLWKRZQHUV &RQWULEXWLRQVE\2ZQHUV 6XEWRWDOWUDQVDFWLRQVZLWK2ZQHUV 7+(1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(667$7(0(17RI&+$1*(6LQ(48,7< DVDW-XQH &ORVLQJEDODQFHVDW-XQH $GMXVWHG2SHQLQJ%DODQFH &ORVLQJEDODQFHVDW-XQH 6XEWRWDOLQFRPHDQGH[SHQVHVUHFRJQLVHG GLUHFWO\LQ(TXLW\ ,QFRPHDQG([SHQVH 7KHDERYHVWDWHPHQWV 6XEWRWDOLQFRPHDQGH[SHQVHVUHFRJQLVHG 6XEWRWDOWUDQVDFWLRQVZLWK2ZQHUV 7UDQVIHUVEHWZHHQHTXLW\FRPSRQHQWV 7UDQVIHUVEHWZHHQHTXLW\FRPSRQHQWV
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 65 7+(1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(6 67$7(0(172)&$6+)/2:6 IRUWKHSHULRGHQGHG-XQH
&RQVROLGDWHG 1*$ 1RWHV 23(5$7,1*$&7,9,7,(6 &DVKUHFHLYHG *RRGVDQGVHUYLFHV $SSURSULDWLRQV ,QWHUHVW 1HW*67UHFHLYHG 7RWDOFDVKUHFHLYHG &DVKXVHG (PSOR\HHV 6XSSOLHUV 1HW*67SDLG 7RWDOFDVKXVHG 1HW&DVKIURPRU XVHGE\ RSHUDWLQJ DFWLYLWLHV
,19(67,1*$&7,9,7,(6 &DVKUHFHLYHG 3URFHHGVIURPVDOHRISURSHUW\SODQW HTXLSPHQW 3URFHHGVIURPVDOHRIVKDUHV 7RWDOFDVKUHFHLYHG &DVKXVHG 3D\PHQWVIRUSURSHUW\SODQW HTXLSPHQW 3D\PHQWVIRUFROOHFWLRQDVVHWV 3D\PHQWVIRUVKDUHV 7RWDO&DVKXVHG 1HW&DVKIURPRU XVHGE\ LQYHVWLQJ DFWLYLWLHV
),1$1&,1*$&7,9,7,(6 &DVKUHFHLYHG $SSURSULDWLRQVFRQWULEXWHGHTXLW\ 7RWDOFDVKUHFHLYHG 1HW&DVKIURPRU XVHGE\ ILQDQFLQJ
1HWLQFUHDVHRU GHFUHDVH LQFDVKKHOG
&DVKDQGFDVKHTXLYDOHQWVDWWKHEHJLQQLQJ RIWKHUHSRUWLQJSHULRG &DVKDQGFDVKHTXLYDOHQWVDWWKHHQGRI WKHUHSRUWLQJSHULRG
7KHDERYHVWDWHPHQWVKRXOGEHUHDGLQFRQMXQFWLRQZLWKWKHDFFRPSDQ\LQJQRWHV
66 7+(1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(6 6&+('8/(2)&200,70(176 DVDW-XQH
&RQVROLGDWHG 1*$ 1RWHV %<7<3( &DSLWDOFRPPLWPHQWV /DQGDQGEXLOGLQJV ,QIUDVWUXFWXUHSODQWDQGHTXLSPHQW :RUNRI$UW 7RWDOFDSLWDOFRPPLWPHQWV
2WKHUFRPPLWPHQWV 2SHUDWLQJOHDVHV 2WKHUFRPPLWPHQWV 7RWDORWKHUFRPPLWPHQWV
&RPPLWPHQWVUHFHLYDEOH 6SRQVRUVKLSUHYHQXH *67UHFRYHUDEOHRQFRPPLWPHQWV 7RWDOFDSLWDOFRPPLWPHQWV
1HWFRPPLWPHQWVE\W\SH
%<0$785,7< &DSLWDOFRPPLWPHQWV 2QH\HDURUOHVV )URPRQHWRILYH\HDUV 2YHUILYH\HDUV 7RWDOFDSLWDOFRPPLWPHQWV
2SHUDWLQJOHDVHFRPPLWPHQWV 2QH\HDURUOHVV )URPRQHWRILYH\HDUV 2YHUILYH\HDUV 7RWDORSHUDWLQJOHDVHFRPPLWPHQWV
2WKHUFRPPLWPHQWV 2QH\HDURUOHVV )URPRQHWRILYH\HDUV 2YHUILYH\HDUV 7RWDORWKHUFRPPLWPHQWV
&RPPLWPHQWVUHFHLYDEOH 2QH\HDURUOHVV )URPRQHWRILYH\HDUV
1HWFRPPLWPHQWVE\PDWXULW\
1% &RPPLWPHQWVDUH*67LQFOXVLYHZKHUHUHOHYDQW
2XWVWDQGLQJFRQWUDFWXDOSD\PHQWVIRUWKH*DOOHU\EXLOGLQJHQKDQFHPHQWSURMHFW 3ODQWDQGHTXLSPHQWFRPPLWPHQWVDUHSULPDULO\SXUFKDVHRUGHUVIRUWKHSXUFKDVHRIIXUQLWXUHHTXLSPHQWDQG EXLOGLQJZRUNVZKLFKDUHRXWVLGHRIWKHVFRSHRIWKHEXLOGLQJHQKDQFHPHQWSURMHFW &RPPLVVLRQHGZRUNRIDUWWREHEXLOWRYHUWKHQH[WWZRILQDQFLDO\HDUV 2SHUDWLQJOHDVHVLQFOXGHGDUHHIIHFWLYHO\QRQFDQFHOODEOHDQGFRPSULVH
1DWXUHRIOHDVH *HQHUDOGHVFULSWLRQRIOHDVLQJDUUDQJHPHQW 9HKLFOHOHDVHV 3XUFKDVHRSWLRQVDUHQRWDYDLODEOH 3KRWRFRSLHUOHDVH 1RUHQHZDODYDLODEOH$GGLWLRQDOFRVWVIRUHYHU\VKHHWSKRWRFRSLHG
2WKHUFRPPLWPHQWVLQFOXGHSXUFKDVHRUGHUVUDLVHGDVDW-XQHZKHUHWKHJRRGRUVHUYLFHKDGQRW EHHQSURYLGHG &RPPLWPHQWUHFHLYDEOHVFRQVLVWRI*67DQGVSRQVRUVKLSRILQ DQGLQ 7KHDERYHVFKHGXOHVKRXOGEHUHDGLQFRQMXQFWLRQZLWKWKHDFFRPSDQ\LQJQRWHV
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 67 7RWDO 7RWDO 1*$ 1*$ /DQGDQGEXLOGLQJV /DQGDQGEXLOGLQJV &ODLPVIRU &ODLPVIRU GDPDJHVFRVWV GDPDJHVFRVWV 7RWDO 7RWDO &RQVROLGDWHG &RQVROLGDWHG /DQGDQGEXLOGLQJV /DQGDQGEXLOGLQJV SDQ\LQJQRWHV VKRZQLQQRWH &RQWLQJHQW/LDELOLWLHVDQG$VVHWV &ODLPVIRU &ODLPVIRU GDPDJHVFRVWV GDPDJHVFRVWV QGDVVHWVDUH 1RWHV LQFRQMXQFWLRQZLWKWKHDFFRP QWOLDELOLWLHVD 1HZ %DODQFHIURPSUHYLRXVSHULRG 1HZ %DODQFHIURPSUHYLRXVSHULRG 'HWDLOVRIHDFKFODVVRIFRQWLQJH 7KHDERYHVFKHGXOHVKRXOGEHUHDG 1HWFRQWLQJHQW$VVHWV /LDELOLWLHV 7RWDOFRQWLQJHQW$VVHWV &RQWLQJHQWDVVHWV 7RWDOFRQWLQJHQW/LDELOLWLHV 7+(1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(6 6&+('8/(2)&217,1*(1&,(6 DVDW-XQH &RQWLQJHQWOLDELOLWLHV
68 1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(6 127(672$1')250,1*3$572)7+(),1$1&,$/67$7(0(176 )RUWKH\HDUHQGHG-XQH 1RWH 'HVFULSWLRQ 6XPPDU\RI6LJQLILFDQW$FFRXQWLQJ3ROLFLHV 5HYHQXHVIURP*RYHUQPHQW 6DOHRIJRRGVDQGUHQGHULQJRIVHUYLFHV 5HYHQXH ([SHQVHV &DVKDQG&DVK(TXLYDOHQWV ,QYHVWPHQWV 7UDGHDQG2WKHU5HFHLYDEOHV 2WKHU)LQDQFLDO$VVHWV +HULWDJHDQG&XOWXUDO$VVHWV ,QWDQJLEOH$VVHWV 3URSHUW\3ODQWDQG(TXLSPHQW ,QYHQWRULHV 2WKHU1RQ)LQDQFLDO$VVHWV 3URYLVLRQDQG3D\DEOHV &DVK)ORZ5HFRQFLOLDWLRQ &RQWLQJHQW/LDELOLWLHVDQG$VVHWV 1DWLRQDO*DOOHU\RI$XVWUDOLD)XQG 5HPXQHUDWLRQRI([HFXWLYH2IILFHUV 5HPXQHUDWLRQRI$XGLWRUV &RQWUROOHG(QWLW\*RUGRQ'DUOLQJ$XVWUDOLD3DFLILF3ULQW)XQG &RQWUROOHG(QWLW\1DWLRQDO*DOOHU\RI$XVWUDOLD)RXQGDWLRQ 5HPXQHUDWLRQRI&RXQFLO0HPEHUVLQFOXGLQJWKH'LUHFWRU 5HODWHG3DUW\'LVFORVXUHV (YHQWV2FFXUULQJ$IWHU5HSRUWLQJ'DWH &RPSHQVDWLRQDQG'HEW5HOLHI $SSURSULDWLRQV )LQDQFLDO,QVWUXPHQWV 5HSRUWLQJRI2XWFRPHV
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 69 1$7,21$/*$//(5<2)$8675$/,$$1'&21752//('(17,7,(6 )RUWKH\HDUHQGHG-XQH 6XPPDU\RI6LJQLILFDQW$FFRXQWLQJ3ROLFLHV %DVLVRISUHSDUDWLRQRIWKH)LQDQFLDO5HSRUW 7KH FRQVROLGDWHG )LQDQFLDO 6WDWHPHQWV DQG QRWHV RI WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD WKH 1DWLRQDO*DOOHU\RI$XVWUDOLD)RXQGDWLRQDQGWKH*RUGRQ'DUOLQJ$XVWUDOLD3DFLILF3ULQW)XQG DUHUHTXLUHGE\FODXVH E RIWKH&RPPRQZHDOWK$XWKRULWLHVDQG&RPSDQLHV$FW DQG DUHD*HQHUDO3XUSRVH)LQDQFLDO5HSRUW 7KHFRQWLQXHGH[LVWHQFHRIWKH1DWLRQDO*DOOHU\RI$XVWUDOLDLQLWVSUHVHQWIRUPDQGZLWKLWV SUHVHQW SURJUDPV LV GHSHQGHQW RQ *RYHUQPHQW SROLF\ DQG RQ FRQWLQXLQJ DSSURSULDWLRQV E\ 3DUOLDPHQWIRUWKH1DWLRQDO*DOOHU\RI$XVWUDOLD¶VDGPLQLVWUDWLRQDQGSURJUDPV 7KHILQDQFLDOVWDWHPHQWVDQGQRWHVKDYHEHHQSUHSDUHGLQDFFRUGDQFHZLWK x )LQDQFH 0LQLVWHU¶V 2UGHUV )02V IRU UHSRUWLQJ SHULRGV HQGLQJ RQ RU DIWHU -XO\ >H[FHSWLQUHODWLRQWRWKHH[HPSWLRQGHWDLOHGEHORZ@ DQG x $XVWUDOLDQ$FFRXQWLQJ6WDQGDUGVDQG,QWHUSUHWDWLRQVLVVXHGE\WKH$XVWUDOLDQ$FFRXQWLQJ 6WDQGDUGV%RDUGWKDWDSSO\IRUWKHUHSRUWLQJSHULRG 2Q -XQHWKH0LQLVWHUIRU)LQDQFHDQG'HUHJXODWLRQJUDQWHGWKH1DWLRQDO*DOOHU\RI $XVWUDOLD DQ H[HPSWLRQ IURP WKH DSSOLFDWLRQ RI VHFWLRQ RI WKH )02V UHODWLQJ WR WKH GHSUHFLDWLRQRIFXOWXUDODQGKHULWDJHDVVHWV7KLVH[HPSWLRQKDVDOORZHGWKH1DWLRQDO*DOOHU\ RI$XVWUDOLDWRFRQWLQXHWRDSSO\WKHUHTXLUHPHQWVRI$$6%LQFDOFXODWLQJGHSUHFLDWLRQRQ LWVFXOWXUDODQGKHULWDJHDVVHWVLQ 7KH ILQDQFLDO UHSRUW KDV EHHQ SUHSDUHG RQ DQ DFFUXDO EDVLV DQG LV LQ DFFRUGDQFH ZLWK KLVWRULFDO FRVW FRQYHQWLRQ H[FHSW IRU FHUWDLQ DVVHWV DW IDLU YDOXH ([FHSW ZKHUH VWDWHG QR DOORZDQFHLVPDGHIRUWKHHIIHFWRIFKDQJLQJSULFHVRQWKHUHVXOWVRUWKHILQDQFLDOSRVLWLRQ 7KH)LQDQFLDO5HSRUWLVSUHVHQWHGLQ$XVWUDOLDQGROODUVDQGYDOXHVDUHURXQGHGWRWKHQHDUHVW WKRXVDQGGROODUVXQOHVVRWKHUZLVHVSHFLILHG 8QOHVV DQ DOWHUQDWLYH WUHDWPHQW LV VSHFLILFDOO\ UHTXLUHG E\ DQ $FFRXQWLQJ 6WDQGDUG RU WKH )02VDVVHWVDQGOLDELOLWLHVDUHUHFRJQLVHGLQWKH%DODQFH6KHHWZKHQDQGRQO\ZKHQLWLV SUREDEOH WKDW IXWXUH HFRQRPLF EHQHILWV ZLOO IORZ WR WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD DQG WKH DPRXQWVRIWKHDVVHWVRUOLDELOLWLHVFDQEHUHOLDEO\PHDVXUHG+RZHYHUDVVHWVDQGOLDELOLWLHV DULVLQJ XQGHU DJUHHPHQWV HTXDOO\ SURSRUWLRQDWHO\ XQSHUIRUPHG DUH QRW UHFRJQLVHG XQOHVV UHTXLUHGE\DQ$FFRXQWLQJ6WDQGDUG 8QOHVVDOWHUQDWLYHWUHDWPHQWLVVSHFLILFDOO\UHTXLUHGE\DQ$FFRXQWLQJ6WDQGDUGUHYHQXHVDQG H[SHQVHV DUH UHFRJQLVHG LQ WKH ,QFRPH 6WDWHPHQW ZKHQ DQG RQO\ ZKHQ WKH IORZ FRQVXPSWLRQRUORVVRIHFRQRPLFEHQHILWVKDVRFFXUUHGDQGFDQEHUHOLDEO\PHDVXUHG
70 3ULQFLSOHVRI&RQVROLGDWLRQ 7KH FRQVROLGDWHG ILQDQFLDO VWDWHPHQWV DUH WKRVH RI WKH HFRQRPLF HQWLW\ FRPSULVLQJ WKH 1DWLRQDO*DOOHU\RI$XVWUDOLD WKHSDUHQWHQWLW\ WKH1DWLRQDO*DOOHU\RI$XVWUDOLD)RXQGDWLRQ DQGWKH*RUGRQ'DUOLQJ$XVWUDOLD3DFLILF3ULQW)XQG7KHDFFRXQWVRIWKH1DWLRQDO*DOOHU\RI $XVWUDOLD)RXQGDWLRQDQGWKH*RUGRQ'DUOLQJ$XVWUDOLD3DFLILF3ULQW)XQGDUHSUHSDUHGIRUWKH SHULRG-XO\WR-XQHXVLQJDFFRXQWLQJSROLFLHVZKLFKDUHFRQVLVWHQWZLWKWKRVH RI WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD 7KH HIIHFWV RI WUDQVDFWLRQV DQG EDODQFHV EHWZHHQ WKH HQWLWLHVDUHHOLPLQDWHGLQIXOO 6LJQLILFDQW$FFRXQWLQJ-XGJHPHQWVDQG(VWLPDWHV ,QWKHSURFHVVRIDSSO\LQJWKHDFFRXQWLQJSROLFLHVOLVWHGLQWKLVQRWHWKH1DWLRQDO*DOOHU\RI $XVWUDOLD KDV PDGH WKH IROORZLQJ MXGJHPHQWV WKDW KDYH WKH PRVW VLJQLILFDQW LPSDFW RQ WKH DPRXQWVUHFRUGHGLQWKHILQDQFLDOVWDWHPHQWV x 7KH IDLU YDOXH RI ODQG DQG EXLOGLQJV KDV EHHQ WDNHQ WR EH WKH PDUNHW YDOXH RI VLPLODU SURSHUWLHV DV GHWHUPLQHG E\ DQ LQGHSHQGHQW YDOXHU ,Q VRPH LQVWDQFHV WKH 1DWLRQDO *DOOHU\RI$XVWUDOLDEXLOGLQJVDUHSXUSRVHEXLOWDQGPD\LQIDFWUHDOLVHPRUHRUOHVVLQWKH PDUNHW DQG x 7KHIDLUYDOXHRIKHULWDJHDQGFXOWXUDODVVHWVKDVEHHQWDNHQWREHWKHPDUNHWYDOXHRI VLPLODU KHULWDJH DQG FXOWXUDO DVVHWV DV GHWHUPLQHG E\ DQ LQGHSHQGHQW YDOXHU ,Q VRPH LQVWDQFHVWKHVDOHRIWKHKHULWDJHDQGFXOWXUDODVVHWVPD\LQIDFWUHDOLVHPRUHRUOHVVLQ WKHPDUNHW 1RDFFRXQWLQJDVVXPSWLRQVRUHVWLPDWHVKDYHEHHQLGHQWLILHGWKDWKDYHDVLJQLILFDQWULVNRI FDXVLQJ D PDWHULDO DGMXVWPHQW WR FDUU\LQJ DPRXQWV RI DVVHWV DQG OLDELOLWLHV ZLWKLQ WKH QH[W DFFRXQWLQJSHULRG 6WDWHPHQWRI&RPSOLDQFH $GRSWLRQRIQHZ$XVWUDOLDQ$FFRXQWLQJ6WDQGDUGUHTXLUHPHQWV 1RDFFRXQWLQJVWDQGDUGKDVEHHQDGRSWHGHDUOLHUWKDQWKHHIIHFWLYHGDWHLQWKHFXUUHQWSHULRG 7KHIROORZLQJQHZVWDQGDUGLVDSSOLFDEOHWRWKHFXUUHQWUHSRUWLQJSHULRG )LQDQFLDOLQVWUXPHQWGLVFORVXUH $$6%)LQDQFLDO,QVWUXPHQWV 'LVFORVXUHVLVHIIHFWLYHIRUUHSRUWLQJSHULRGVEHJLQQLQJRQRU DIWHU-DQXDU\ WKHILQDQFLDO\HDU DQGDPHQGVWKHGLVFORVXUHUHTXLUHPHQWVIRU ILQDQFLDO LQVWUXPHQWV ,Q JHQHUDO $$6% UHTXLUHV JUHDWHU GLVFORVXUH WKDQ WKDW SUHYLRXVO\ UHTXLUHG$VVRFLDWHGZLWKWKHLQWURGXFWLRQRI$$6%DQXPEHURIDFFRXQWLQJVWDQGDUGVZHUH DPHQGHG WR UHIHUHQFH WKH QHZ VWDQGDUG RU UHPRYH WKH SUHVHQW GLVFORVXUH UHTXLUHPHQWV WKURXJK $PHQGPHQWV WR $XVWUDOLDQ $FFRXQWLQJ 6WDQGDUGV >$$6% $$6% $$6%$$6%$$6%$$6% $$6%$$6%$$6% $$6%@ 7KHVH FKDQJHV KDYH QR ILQDQFLDO LPSDFW EXW ZLOO DIIHFW WKH GLVFORVXUH SUHVHQWHG LQ IXWXUH ILQDQFLDOUHSRUWV
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 71 7KH IROORZLQJ QHZ VWDQGDUGV DPHQGPHQWV WR VWDQGDUGV RU LQWHUSUHWDWLRQV IRU WKH FXUUHQW ILQDQFLDO\HDUKDYHQRPDWHULDOILQDQFLDOLPSDFWRQWKH1DWLRQDO*DOOHU\RI$XVWUDOLD x $$6%3UHVHQWDWLRQRI)LQDQFLDO6WDWHPHQWV x $$6%,QWHUSUHWDWLRQDQG$SSOLFDWLRQRI6WDQGDUGV x $$6% $PHQGPHQWV WR $XVWUDOLDQ $FFRXQWLQJ 6WDQGDUGV DULVLQJ IURP $$6% ,QWHUSUHWDWLRQ $$6%@ x $$6%$PHQGPHQWVWR$XVWUDOLDQ$FFRXQWLQJ6WDQGDUGVDULVLQJIURP('DQG RWKHUDPHQGPHQWV x $$6% $PHQGPHQWV WR $XVWUDOLDQ $FFRXQWLQJ 6WDQGDUG ± ,QYHQWRULHV +HOG IRU 'LVWULEXWLRQE\1RWIRU3URILW(QWLWLHV>$$6%@ x $$6% $PHQGPHQWV WR $XVWUDOLDQ $FFRXQWLQJ 6WDQGDUGV >$$6% @ x $$6% $PHQGPHQWV WR $XVWUDOLDQ $FFRXQWLQJ 6WDQGDUG ± .H\ 0DQDJHPHQW 3HUVRQQHO'LVFORVXUHVE\'LVFORVLQJ(QWLWLHV>$$6%@ x (55(UUDWXP3URSRUWLRQDWH&RQVROLGDWLRQ>$$6%$$6%$$6%$$6% ,QWHUSUHWDWLRQ@ x $$6%,QWHUSUHWDWLRQ,QWHULP)LQDQFLDO5HSRUWLQJDQG,PSDLUPHQW x $$6%,QWHUSUHWDWLRQ$$6%±*URXSDQG7UHDVXU\6KDUH7UDQVDFWLRQVDQG $PHQGPHQWV WR $XVWUDOLDQ $FFRXQWLQJ 6WDQGDUGV DULVLQJ IURP $$6% ,QWHUSUHWDWLRQ DQG x $$6%,QWHUSUHWDWLRQ$XVWUDOLDQ3HWUROHXP5HVRXUFH5HQW7D[ )XWXUH$XVWUDOLDQ$FFRXQWLQJ6WDQGDUGUHTXLUHPHQWV 7KHIROORZLQJQHZVWDQGDUGVDPHQGPHQWVWRVWDQGDUGVRULQWHUSUHWDWLRQVKDYHEHHQLVVXHG E\WKH$XVWUDOLDQ$FFRXQWLQJ6WDQGDUGV%RDUGEXWDUHHIIHFWLYHIRUIXWXUHUHSRUWLQJSHULRGV,W LVHVWLPDWHGWKDWWKHLPSDFWRIDGRSWLQJWKHVHSURQRXQFHPHQWVZKHQHIIHFWLYHZLOOKDYHQR PDWHULDOILQDQFLDOLPSDFWRQIXWXUHUHSRUWLQJSHULRGV x $$6%%XVLQHVV&RPELQDWLRQV x $$6% 2SHUDWLQJ 6HJPHQWV DQG $PHQGPHQWV WR $XVWUDOLDQ $FFRXQWLQJ 6WDQGDUGVDULVLQJIURP$$6% x $$6%3UHVHQWDWLRQRI)LQDQFLDO6WDWHPHQWV x $$6%&RQVROLGDWHGDQG6HSDUDWH)LQDQFLDO6WDWHPHQWV x $$6%&RQWULEXWLRQV x $$6%/DQG8QGHU5RDGV x $$6%'LVDJJUHJDWHG'LVFORVXUHV x $$6%$PHQGPHQWVWR$XVWUDOLDQ$FFRXQWLQJ6WDQGDUGVDULVLQJIURP$$6% x $$6%$PHQGPHQWVWR$XVWUDOLDQ$FFRXQWLQJ6WDQGDUGVDULVLQJIURP$$6% x $$6% $PHQGPHQWVWR$XVWUDOLDQ$FFRXQWLQJ6WDQGDUGVDULVLQJIURPWKHUHYLHZRI $$6V DQG >$$6% $$6% $$6% $$6% $$6% $$6% $$6% $$6%@ x $$6%$PHQGPHQWVWR$XVWUDOLD$FFRXQWLQJ6WDQGDUG±6KDUHEDVHGSD\PHQWV± 9HVWLQJ&RQGLWLRQVDQG&DQFHOODWLRQV>$$6%@ x $$6% $PHQGPHQWV WR $XVWUDOLDQ $FFRXQWLQJ 6WDQGDUGV ± 3XWWDEOH )LQDQFLDO ,QVWUXPHQWV DQG 2EOLJDWLRQV DULVLQJ RQ /LTXLGDWLRQ >$$6% $$6% $$6% $$6% ,QWHUSUHWDWLRQ@
72 x $$6%$PHQGPHQWVWR$XVWUDOLDQ$FFRXQWLQJ6WDQGDUGVDULVLQJIURP$$6%DQG $$6%>$$6%V ,QWHUSUHWDWLRQV @ x $$6% ,QWHUSUHWDWLRQ &KDQJHV LQ ([LVWLQJ 'HFRPPLVVLRQLQJ 5HVWRUDWLRQ DQG 6LPLODU /LDELOLWLHV x $$6%,QWHUSUHWDWLRQ'HWHUPLQLQJ:KHWKHUDQ$UUDQJHPHQW&RQWDLQVD/HDVH x $$6% ,QWHUSUHWDWLRQ 6HUYLFH &RQFHVVLRQ $UUDQJHPHQWV DQG $PHQGPHQWV WR $XVWUDOLDQ$FFRXQWLQJ6WDQGDUGVDULVLQJIURP$$6%,QWHUSUHWDWLRQ x $$6%,QWHUSUHWDWLRQ&XVWRPHU/R\DOW\3URJUDPPHV x $$6% ,QWHUSUHWDWLRQ $$6% ± 7KH /LPLW RQ D 'HILQHG %HQHILW $VVHW 0LQLPXP )XQGLQJ5HTXLUHPHQWVDQGWKHLU,QWHUDFWLRQ x $$6%,QWHUSUHWDWLRQ 6HUYLFH&RQFHVVLRQ$UUDQJHPHQW'LVFORVXUHV DQG x $$6%,QWHUSUHWDWLRQ&RQWULEXWLRQE\2ZQHUV0DGHWR:KROO\2ZQHG3XEOLF6HFWRU (QWLWLHV 2WKHU 7KH IROORZLQJ VWDQGDUGV DQG LQWHUSUHWDWLRQV KDYH EHHQ LVVXHG EXW DUH QRW DSSOLFDEOH WR WKH RSHUDWLRQVRIWKH1DWLRQDO*DOOHU\RI$XVWUDOLD x $$6% )LQDQFLDO5HSRUWLQJRI*HQHUDO*RYHUQPHQW6HFWRUVE\*RYHUQPHQWV$$6% VSHFLILHVWKHUHSRUWLQJUHTXLUHPHQWVIRUWKH*HQHUDO*RYHUQPHQW6HFWRU7KH)02V GR QRW UHIHU WR WKLV VWDQGDUG DV LW FRQWDLQV JXLGDQFH DSSOLFDEOH WR WKH FRQVROLGDWHG ILQDQFLDO VWDWHPHQWV RI WKH $XVWUDOLDQ *RYHUQPHQW UDWKHU WKDQ ILQDQFLDO UHSRUWV RI LQGLYLGXDO$JHQFLHVRU$XWKRULWLHV DQG x $$6%$GPLQLVWHUHG,WHPV 5HYHQXH 7KHUHYHQXHVGHVFULEHGLQWKLVQRWHDUHUHYHQXHVUHODWLQJWRWKHFRUHRSHUDWLQJDFWLYLWLHVRI WKH1DWLRQDO*DOOHU\RI$XVWUDOLDDQGRIWKHFRQVROLGDWHGHQWLW\ 5HYHQXHIURPWKHVDOHRIJRRGVLVUHFRJQLVHGZKHQ x 7KHULVNVDQGUHZDUGVRIRZQHUVKLSKDYHEHHQWUDQVIHUUHGWRWKHEX\HU x 7KHVHOOHUUHWDLQVQRQPDQDJHULDOLQYROYHPHQWQRUHIIHFWLYHFRQWURORYHUWKHJRRGV x 7KHUHYHQXHDQGWUDQVDFWLRQFRVWVLQFXUUHGFDQEHUHOLDEO\PHDVXUHG DQG x ,WLVSUREDEOHWKDWWKHHFRQRPLFEHQHILWVDVVRFLDWHGZLWKWKHWUDQVDFWLRQZLOOIORZWRWKH *DOOHU\ 5HFHLYDEOHVIRUJRRGVDQGVHUYLFHVZKLFKKDYHGD\WHUPVDUHUHFRJQLVHGDWWKHQRPLQDO DPRXQWVGXHOHVVDQ\SURYLVLRQIRUEDGDQGGRXEWIXOGHEWV&ROOHFWDELOLW\RIGHEWVLVUHYLHZHG DWEDODQFHGDWH3URYLVLRQVDUHPDGHZKHQFROOHFWDELOLW\RIWKHGHEWLVQRORQJHUSUREDEOH ,QWHUHVW UHYHQXH LV UHFRJQLVHG XVLQJ WKH HIIHFWLYH LQWHUHVW PHWKRG DV VHW RXW LQ $$6% )LQDQFLDO,QVWUXPHQWV 5HFRJQLWLRQDQG0HDVXUHPHQW 'LYLGHQGUHYHQXHDQGGLVWULEXWLRQVIURPSURSHUW\WUXVWVDUHUHFRJQLVHGZKHQUHFHLYHG
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 73 5HYHQXH IURP GLVSRVDO RI QRQFXUUHQW DVVHWV LV UHFRJQLVHG ZKHQ FRQWURO RI WKH DVVHW KDV SDVVHGWRWKHEX\HU 5HYHQXHVIURP*RYHUQPHQW 7KH IXOO DPRXQW RI WKH DSSURSULDWLRQ IRU GHSDUWPHQWDO RXWSXWV IRU WKH \HDU LV UHFRJQLVHG DV UHYHQXH *LIWV *LIWVRIZRUNVRIDUWUHFHLYHGE\WKH1DWLRQDO*DOOHU\RI$XVWUDOLDDUHUHFRJQLVHGDVUHYHQXHLQ WKH,QFRPH6WDWHPHQWLQWKH\HDURIUHFHLSWDWIDLUYDOXH *DLQV 6DOHRI$VVHWV *DLQVIURPGLVSRVDORIDVVHWVDUHUHFRJQLVHGZKHQFRQWURORIWKHDVVHWKDVSDVVHGWRWKH EX\HU 7UDQVDFWLRQVZLWKWKH*RYHUQPHQWDV2ZQHU (TXLW\,QMHFWLRQV $PRXQWVDSSURSULDWHGZKLFKDUHGHVLJQDWHGDVµHTXLW\LQMHFWLRQV¶IRUD\HDUDUHUHFRJQLVHG GLUHFWO\LQ&RQWULEXWHG(TXLW\LQWKH\HDUUHFHLYHG (PSOR\HH%HQHILWV /LDELOLWLHV IRU VHUYLFHV UHQGHUHG E\ HPSOR\HHV DUH UHFRJQLVHG DW WKH UHSRUWLQJ GDWH WR WKH H[WHQWWKDWWKH\KDYHQRWEHHQVHWWOHG /LDELOLWLHVIRUµVKRUWWHUPHPSOR\HHEHQHILWV¶ DVGHILQHGLQ$$6% DQGWHUPLQDWLRQEHQHILWV GXHZLWKLQWZHOYHPRQWKVRIEDODQFHGDWHDUHPHDVXUHGDWWKHLUQRPLQDODPRXQWV 7KHQRPLQDODPRXQWLVFDOFXODWHGZLWKUHJDUGWRWKHUDWHVH[SHFWHGWREHSDLGRQVHWWOHPHQW RIWKHOLDELOLW\ $OORWKHUHPSOR\HHEHQHILWOLDELOLWLHVDUHPHDVXUHGDVWKHSUHVHQWYDOXHRIWKHHVWLPDWHGIXWXUH FDVKRXWIORZVWREHPDGHLQUHVSHFWRIVHUYLFHVSURYLGHGE\HPSOR\HHVXSWRWKHUHSRUWLQJ GDWH /HDYH 7KH OLDELOLW\ IRU HPSOR\HH HQWLWOHPHQWV LQFOXGHV SURYLVLRQ IRU DQQXDO OHDYH DQG ORQJ VHUYLFH OHDYH 1R SURYLVLRQ KDV EHHQ PDGH IRU VLFN OHDYH DV DOO VLFN OHDYH LV QRQYHVWLQJ DQG WKH DYHUDJHVLFNOHDYHWDNHQLQIXWXUH\HDUVE\HPSOR\HHVRIWKH1DWLRQDO*DOOHU\RI$XVWUDOLDLV HVWLPDWHGWREHOHVVWKDQWKHDQQXDOHQWLWOHPHQWIRUVLFNOHDYH
74 7KH OHDYH OLDELOLWLHV DUH FDOFXODWHG RQ WKH EDVLV RI HPSOR\HHV¶ UHPXQHUDWLRQ LQFOXGLQJ WKH 1DWLRQDO*DOOHU\RI$XVWUDOLD¶VHPSOR\HUVXSHUDQQXDWLRQFRQWULEXWLRQUDWHVWRWKHH[WHQWWKDW WKHOHDYHLVOLNHO\WREHWDNHQGXULQJVHUYLFHUDWKHUWKDQSDLGRXWRQWHUPLQDWLRQ 7KH OLDELOLW\ IRU ORQJ VHUYLFH OHDYH KDV EHHQ GHWHUPLQHG LQ DFFRUGDQFH ZLWK WKH VKRUWKDQG PHWKRGGHWDLOHGLQGLYLVLRQRIWKH)02V7KHHVWLPDWHRIWKHSUHVHQWYDOXHRIWKHOLDELOLW\ WDNHVLQWRDFFRXQWDWWULWLRQUDWHVDQGSD\LQFUHDVHVWKURXJKSURPRWLRQDQGLQIODWLRQ 6HSDUDWLRQDQGUHGXQGDQF\ 3URYLVLRQLVPDGHIRUVHSDUDWLRQDQGUHGXQGDQF\SD\PHQWV7KH1DWLRQDO*DOOHU\RI$XVWUDOLD UHFRJQLVHVDSURYLVLRQIRUWHUPLQDWLRQZKHQLWKDVIRUPDOO\LGHQWLILHGSRVLWLRQVDVH[FHVVWR UHTXLUHPHQWVDQGDUHOLDEOHHVWLPDWHRIWKHDPRXQWRIWKHSD\PHQWVFDQEHGHWHUPLQHG 6XSHUDQQXDWLRQ (PSOR\HHV RI WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD DUH PHPEHUV RI WKH &RPPRQZHDOWK 6XSHUDQQXDWLRQ6FKHPH &66 WKH3XEOLF6HFWRU6XSHUDQQXDWLRQ6FKHPH 366 WKH366 DFFXPXODWLRQSODQ 366DS RURWKHUVXSHUDQQXDWLRQVFKHPHV7KH&66DQG366DUHGHILQHG EHQHILWVFKHPHVIRUWKH$XVWUDOLDQ*RYHUQPHQW7KH366DSLVDGHILQHGFRQWULEXWLRQVFKHPH &RQWULEXWLRQV WR WKH RWKHU VXSHUDQQXDWLRQ VFKHPHV DUH PDGH LQ DFFRUGDQFH ZLWK WKH 6XSHUDQQXDWLRQ*XDUDQWHH $GPLQLVWUDWLRQ $FW 7KH OLDELOLW\ IRU GHILQHG EHQHILWV LV UHFRJQLVHG LQ WKH ILQDQFLDO VWDWHPHQWV RI WKH $XVWUDOLDQ *RYHUQPHQW DQG LV VHWWOHG E\ WKH $XVWUDOLDQ *RYHUQPHQW LQ GXH FRXUVH 7KLV OLDELOLW\ LV UHSRUWHGE\WKH'HSDUWPHQWRI)LQDQFHDQG'HUHJXODWLRQDVDQDGPLQLVWHUHGLWHP 7KH 1DWLRQDO *DOOHU\ RI $XVWUDOLD PDNHV HPSOR\HU FRQWULEXWLRQV WR WKH HPSOR\HH VXSHUDQQXDWLRQVFKHPHVDWUDWHVGHWHUPLQHGE\DQDFWXDU\WREHVXIILFLHQWWRPHHWWKHFRVWWR WKH *RYHUQPHQW RI WKH VXSHUDQQXDWLRQ HQWLWOHPHQWV RI WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD¶V HPSOR\HHV 7KHOLDELOLW\IRUVXSHUDQQXDWLRQUHFRJQLVHGDVDW-XQHUHSUHVHQWVRXWVWDQGLQJFRQWULEXWLRQV IRUWKHILQDOIRUWQLJKWRIWKH\HDU /HDVHV 2SHUDWLQJOHDVHSD\PHQWVDUHH[SHQVHGRQDVWUDLJKWOLQHEDVLVZKLFKLVUHSUHVHQWDWLYHRIWKH SDWWHUQRIEHQHILWVGHULYHGIURPWKHOHDVHGDVVHWV7KH1DWLRQDO*DOOHU\RI$XVWUDOLDKDVQR ILQDQFHOHDVHV &DVK &DVKDQGFDVKHTXLYDOHQWVLQFOXGHVQRWHVDQGFRLQVKHOGDQGDQ\GHSRVLWVLQEDQNDFFRXQWV ZLWKDQRULJLQDOPDWXULW\RIPRQWKVRUOHVVWKDWDUHUHDGLO\FRQYHUWLEOHWRNQRZQDPRXQWVRI FDVKDQGVXEMHFWWRLQVLJQLILFDQWULVNRIFKDQJHVLQYDOXH&DVKLVUHFRJQLVHGDWLWVQRPLQDO DPRXQW
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 75 )LQDQFLDODVVHWV 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDFODVVLILHVLWVILQDQFLDODVVHWVLQWKHIROORZLQJFDWHJRULHV x )LQDQFLDODVVHWVµDWIDLUYDOXHWKURXJKSURILWDQGORVV¶ DQG x µORDQVDQGUHFHLYDEOHV¶ 7KH FODVVLILFDWLRQ GHSHQGV RQ WKH QDWXUH DQG SXUSRVH RI WKH ILQDQFLDO DVVHWV DQG LV GHWHUPLQHGDWWKHWLPHRILQLWLDOUHFRJQLWLRQ )LQDQFLDODVVHWVDUHUHFRJQLVHGDQGGHUHFRJQLVHGXSRQµWUDGHGDWH¶ (IIHFWLYHLQWHUHVWPHWKRG 7KHHIIHFWLYHLQWHUHVWPHWKRGLVDPHWKRGRIFDOFXODWLQJWKHDPRUWLVHGFRVWRIDILQDQFLDODVVHW DQGRIDOORFDWLQJLQWHUHVWLQFRPHRYHUWKHUHOHYDQWSHULRG7KHHIIHFWLYHLQWHUHVWUDWHLVWKHUDWH WKDW H[DFWO\ GLVFRXQWV HVWLPDWHG IXWXUH FDVK UHFHLSWV RYHU WKH H[SHFWHG OLIH RI WKH ILQDQFLDO DVVHWRUZKHUHDSSURSULDWHDVKRUWHUSHULRG ,QFRPH LV UHFRJQLVHG RQ DQ HIIHFWLYH LQWHUHVW UDWH EDVLV H[FHSW IRU ILQDQFLDO DVVHWV µDW IDLU YDOXHWKURXJKSURILWRUORVV¶ )LQDQFLDODVVHWVDWIDLUYDOXHWKURXJKSURILWRUORVV )LQDQFLDODVVHWVDUHFODVVLILHGDVILQDQFLDODVVHWVDWIDLUYDOXHWKURXJKSURILWRUORVVZKHUHWKH ILQDQFLDODVVHWV x KDYHEHHQDFTXLUHGSULQFLSDOO\IRUWKHSXUSRVHRIVHOOLQJLQWKHQHDUIXWXUH x DUHSDUWRIDQLGHQWLILHGSRUWIROLRRIILQDQFLDOLQVWUXPHQWVWKDWWKH1DWLRQDO*DOOHU\RI $XVWUDOLD PDQDJHV WRJHWKHU DQG KDV D UHFHQW DFWXDO SDWWHUQ RI VKRUWWHUP SURILW WDNLQJ RU x DUHGHULYDWLYHVWKDWDUHQRWGHVLJQDWHGDQGHIIHFWLYHDVDKHGJLQJLQVWUXPHQW $VVHWVLQWKLVFDWHJRU\DUHFODVVLILHGDVFXUUHQWDVVHWV )LQDQFLDODVVHWVDWIDLUYDOXHWKURXJKSURILWRUORVVDUHVWDWHGDWIDLUYDOXHZLWKDQ\UHVXOWDQW JDLQ RU ORVV UHFRJQLVHG LQ SURILW RU ORVV 7KH QHW JDLQ RU ORVV UHFRJQLVHG LQ SURILW RU ORVV LQFRUSRUDWHVDQ\LQWHUHVWHDUQHGRQWKHILQDQFLDODVVHW /RDQVDQGUHFHLYDEOHV 7UDGHUHFHLYDEOHVORDQVDQGRWKHUUHFHLYDEOHVWKDWKDYHIL[HGRUGHWHUPLQDEOHSD\PHQWVWKDW DUHQRWTXRWHGLQDQDFWLYHPDUNHWDUHFODVVLILHGDVµORDQVDQGUHFHLYDEOHV¶7KH\DUHLQFOXGHG LQFXUUHQWDVVHWVH[FHSWIRUPDWXULWLHVJUHDWHUWKDQPRQWKVDIWHUWKHEDODQFHVKHHWGDWH 7KHVHDUHFODVVLILHGDVQRQFXUUHQWDVVHWV/RDQVDQGUHFHLYDEOHVDUHPHDVXUHGDWDPRUWLVHG FRVWXVLQJWKHHIIHFWLYHLQWHUHVWPHWKRGOHVVLPSDLUPHQW,QWHUHVWLVUHFRJQLVHGE\DSSO\LQJWKH HIIHFWLYHLQWHUHVWUDWH
76 ,PSDLUPHQWRIILQDQFLDODVVHWV )LQDQFLDODVVHWVDUHDVVHVVHGIRULPSDLUPHQWDWHDFKEDODQFHGDWH )LQDQFLDO $VVHWV KHOG DW $PRUWLVHG &RVW ,I WKHUH LV REMHFWLYH HYLGHQFH WKDW DQ LPSDLUPHQW ORVV KDV EHHQ LQFXUUHG IRU ORDQV UHFHLYDEOHV RU KHOG WR PDWXULW\ LQYHVWPHQWV FDUULHG DW DPRUWLVHG FRVW WKH DPRXQW RI WKH ORVV LV PHDVXUHG DV WKH GLIIHUHQFH EHWZHHQ WKH DVVHW¶V FDUU\LQJ DPRXQW DQG WKH SUHVHQW YDOXH RI HVWLPDWHG IXWXUH FDVK IORZV GLVFRXQWHG DW WKH DVVHW¶VRULJLQDOHIIHFWLYHLQWHUHVWUDWH7KHFDUU\LQJDPRXQWLVUHGXFHGE\ZD\RIDQDOORZDQFH DFFRXQW7KHORVVLVUHFRJQLVHGLQWKH,QFRPH6WDWHPHQW )LQDQFLDO/LDELOLWLHV 6XSSOLHUDQGRWKHUSD\DEOHV 6XSSOLHUDQGRWKHUSD\DEOHVDUHUHFRJQLVHGDWDPRUWLVHGFRVW/LDELOLWLHVDUHUHFRJQLVHGWRWKH H[WHQW WKDW WKH JRRGV RU VHUYLFHV KDYH EHHQ UHFHLYHG DQG LUUHVSHFWLYH RI KDYLQJ EHHQ LQYRLFHG 'HUHFRJQLWLRQRI)LQDQFLDO$VVHWVDQG/LDELOLWLHV )LQDQFLDO DVVHWV DUH GHUHFRJQLVHG ZKHQ WKH FRQWUDFWXDO ULJKWV WR WKH FDVK IORZV IURP WKH ILQDQFLDODVVHWVH[SLUHRUWKHDVVHWLVWUDQVIHUUHGWRDQRWKHUHQWLW\,QWKHFDVHRIDWUDQVIHUWR DQRWKHUHQWLW\LWLVQHFHVVDU\WKDWWKHULVNVDQGUHZDUGVRIRZQHUVKLSDUHDOVRWUDQVIHUUHG )LQDQFLDOOLDELOLWLHVDUHGHUHFRJQLVHGZKHQWKHREOLJDWLRQXQGHUWKHFRQWUDFWLVGLVFKDUJHGRU FDQFHOOHGRUH[SLUHV &RQWLQJHQW/LDELOLWLHVDQG&RQWLQJHQW$VVHWV &RQWLQJHQW/LDELOLWLHVDQG&RQWLQJHQW$VVHWVDUHQRWUHFRJQLVHGLQWKHEDODQFHVKHHWEXWDUH UHSRUWHG LQ WKH UHOHYDQW VFKHGXOHV DQG QRWHV 7KH\ PD\ DULVH IURP XQFHUWDLQW\ DV WR WKH H[LVWHQFHRIDOLDELOLW\RUDVVHWRUUHSUHVHQWDOLDELOLW\RUDVVHWLQUHVSHFWRIZKLFKWKHDPRXQW FDQQRW EH UHOLDEO\ PHDVXUHG &RQWLQJHQW DVVHWV DUH GLVFORVHG ZKHQ VHWWOHPHQW LV SUREDEOH EXWQRWYLUWXDOO\FHUWDLQDQGFRQWLQJHQWOLDELOLWLHVDUHGLVFORVHGZKHQVHWWOHPHQWLVJUHDWHUWKDQ UHPRWH $FTXLVLWLRQRI$VVHWV $VVHWVDUHUHFRUGHGDWFRVWRQDFTXLVLWLRQH[FHSWDVVWDWHGEHORZ7KHFRVWRIDFTXLVLWLRQV LQFOXGHVWKHIDLUYDOXHRIDVVHWVWUDQVIHUUHGLQH[FKDQJHDQGOLDELOLWLHVXQGHUWDNHQ)LQDQFLDO DVVHWVDUHLQLWLDOO\PHDVXUHGDWWKHLUIDLUYDOXHSOXVWUDQVDFWLRQFRVWVZKHUHDSSURSULDWH $VVHWVDFTXLUHGDWQRFRVWRUIRUQRPLQDOFRQVLGHUDWLRQDUHLQLWLDOO\UHFRJQLVHGDVDVVHWVDQG UHYHQXHVDWWKHLUIDLUYDOXHDWWKHGDWHRIWKHDFTXLVLWLRQ
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 77 3URSHUW\3ODQWDQG(TXLSPHQW $VVHW5HFRJQLWLRQ7KUHVKROG 3XUFKDVHV RI SURSHUW\ SODQW DQG HTXLSPHQW DUH UHFRJQLVHG LQLWLDOO\ DW FRVW LQ WKH EDODQFH VKHHW H[FHSW IRU SXUFKDVHV FRVWLQJ OHVV WKDQ ZKLFK DUH H[SHQVHG LQ WKH \HDU RI DFTXLVLWLRQ RWKHUWKDQZKHUHWKH\IRUPSDUWRIDJURXSRIVLPLODULWHPVZKLFKDUHVLJQLILFDQWLQ WRWDO $OOKHULWDJHDQGFXOWXUDODVVHWVDUHUHFRJQLVHGLQLWLDOO\DWFRVWLQWKHEDODQFHVKHHW 5HYDOXDWLRQV )DLUYDOXHVIRUHDFKFODVVRIDVVHWVDUHGHWHUPLQHGDVVKRZQEHORZ $VVHW&ODVV )DLU9DOXH0HDVXUHGDW /DQG 0DUNHWVHOOLQJSULFH %XLOGLQJ 'HSUHFLDWHGUHSODFHPHQWFRVW ,QIUDVWUXFWXUH3ODQW (TXLSPHQW 0DUNHWVHOOLQJSULFH +HULWDJHDQGFXOWXUDODVVHWV 0DUNHWVHOOLQJSULFH )ROORZLQJLQLWLDOUHFRJQLWLRQDWFRVWSURSHUW\SODQWDQGHTXLSPHQWDUHFDUULHGDWIDLUYDOXH OHVV DFFXPXODWHG GHSUHFLDWLRQ DQG DFFXPXODWHG LPSDLUPHQW ORVVHV 9DOXDWLRQV DUH FRQGXFWHGZLWKVXIILFLHQWIUHTXHQF\WRHQVXUHWKDWWKHFDUU\LQJDPRXQWVRIDVVHWVGRQRW GLIIHU PDWHULDOO\ IURP WKH DVVHWV¶ IDLU YDOXHV DV DW WKH UHSRUWLQJ GDWH 7KH UHJXODULW\ RI LQGHSHQGHQWYDOXDWLRQVGHSHQGVXSRQWKHYRODWLOLW\RIPRYHPHQWVLQPDUNHWYDOXHVIRUWKH UHOHYDQWDVVHWV 5HYDOXDWLRQDGMXVWPHQWVDUHPDGHRQDFODVVEDVLV$Q\UHYDOXDWLRQLQFUHPHQWLVFUHGLWHG WRHTXLW\XQGHUWKHKHDGLQJRIDVVHWUHYDOXDWLRQUHVHUYHH[FHSWWRWKHH[WHQWWKDWLW UHYHUVHVDSUHYLRXVUHYDOXDWLRQGHFUHPHQWRIWKHVDPHDVVHWFODVVWKDWZDVSUHYLRXVO\ UHFRJQLVHGWKURXJKRSHUDWLQJUHVXOW5HYDOXDWLRQGHFUHPHQWVIRUDFODVVRIDVVHWVDUH UHFRJQLVHGGLUHFWO\WKURXJKRSHUDWLQJUHVXOWH[FHSWWRWKHH[WHQWWKDWWKH\UHYHUVHD SUHYLRXVUHYDOXDWLRQLQFUHPHQWIRUWKDWFODVV $Q\DFFXPXODWHGGHSUHFLDWLRQDVDWWKHUHYDOXDWLRQGDWHLVHOLPLQDWHGDJDLQVWWKHJURVV FDUU\LQJDPRXQWRIWKHDVVHWDQGWKHDVVHWUHVWDWHGWRWKHUHYDOXHGDPRXQW 'HSUHFLDWLRQ 'HSUHFLDEOH SURSHUW\ SODQW DQG HTXLSPHQW DVVHWV DUH ZULWWHQRII WR WKHLU HVWLPDWHG UHVLGXDO YDOXHVRYHUWKHLUHVWLPDWHGXVHIXOOLYHVWRWKH1DWLRQDO*DOOHU\RI$XVWUDOLDXVLQJLQDOOFDVHV WKHVWUDLJKWOLQHPHWKRGRIGHSUHFLDWLRQ 'HSUHFLDWLRQUDWHV XVHIXOOLYHV UHVLGXDOYDOXHVDQGPHWKRGVDUHUHYLHZHGDWHDFKUHSRUWLQJ GDWHDQGQHFHVVDU\DGMXVWPHQWVDUHUHFRJQLVHGLQWKHFXUUHQWRUFXUUHQWDQGIXWXUHUHSRUWLQJ SHULRGVDVDSSURSULDWH5HVLGXDOYDOXHVDUHUHHVWLPDWHGIRUDFKDQJHLQSULFHVRQO\ZKHQ DVVHWVDUHUHYDOXHG
78 'HSUHFLDWLRQ UDWHV DSSO\LQJ WR HDFK FODVV RI GHSUHFLDEOH DVVHW DUH EDVHG RQ WKH IROORZLQJ XVHIXOOLYHV %XLOGLQJV WR\HDUV WR\HDUV 3ODQWDQGHTXLSPHQW WR\HDUV WR\HDUV +HULWDJHDQGFXOWXUDODVVHWV WR\HDUV WR\HDUV 7KHDJJUHJDWHDPRXQWRIGHSUHFLDWLRQDOORFDWHGIRUHDFKFODVVRIDVVHWGXULQJWKHUHSRUWLQJ SHULRGLVGLVFORVHGLQ1RWH& ,PSDLUPHQW $OODVVHWVZHUHDVVHVVHGIRULPSDLUPHQWDW-XQH:KHUHLQGLFDWLRQVRILPSDLUPHQW H[LVWWKHDVVHW¶VUHFRYHUDEOHDPRXQWLVHVWLPDWHGDQGDQLPSDLUPHQWDGMXVWPHQWPDGHLIWKH DVVHW¶VUHFRYHUDEOHDPRXQWLVOHVVWKDQLWVFDUU\LQJDPRXQW 7KH UHFRYHUDEOH DPRXQW RI DQ DVVHW LV WKH KLJKHU RI LWV IDLU YDOXH OHVV FRVWV WR VHOO DQG LWV YDOXHLQXVH9DOXHLQXVHLVWKHSUHVHQWYDOXHRIWKHIXWXUHFDVKIORZVH[SHFWHGWREHGHULYHG IURPWKHDVVHW:KHUHWKHIXWXUHHFRQRPLFEHQHILWRIDQDVVHWLVQRWSULPDULO\GHSHQGHQWRQ WKH DVVHW¶V DELOLW\ WR JHQHUDWH IXWXUH FDVK IORZV DQG WKH DVVHW ZRXOG EH UHSODFHG LI WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD ZHUH GHSULYHG RI WKH DVVHW LWV YDOXH LQ XVH LV WDNHQ WR EH LWV GHSUHFLDWHGUHSODFHPHQWFRVW ,QYHQWRULHV ,QYHQWRULHVKHOGIRUVDOHDUHYDOXHGDWWKHORZHURIFRVWDQGQHWUHDOLVDEOHYDOXH,QYHQWRULHV QRWKHOGIRUVDOHDUHYDOXHGDWFRVWXQOHVVWKH\DUHQRORQJHUUHTXLUHGLQZKLFKFDVHWKH\DUH YDOXHGDWQHWUHDOLVDEOHYDOXH 3URYLVLRQLVPDGHIRUVORZPRYLQJDQGREVROHWHLQYHQWRU\LWHPV ,QWDQJLEOH$VVHWV 7KH 1DWLRQDO *DOOHU\ RI $XVWUDOLD¶V LQWDQJLEOHV FRPSULVH SXUFKDVHG VRIWZDUH 7KHUH LV QR VRIWZDUH GHYHORSHG IRU LQWHUQDO XVH 7KHVH DVVHWV DUH FDUULHG DW FRVW OHVV DFFXPXODWHG DPRUWLVDWLRQDQGDFFXPXODWHGLPSDLUPHQWORVVHV 6RIWZDUHLVDPRUWLVHGRQDVWUDLJKWOLQHEDVLVRYHULWVDQWLFLSDWHGXVHIXOOLIH7KHXVHIXOOLIHRI WKH1DWLRQDO*DOOHU\RI$XVWUDOLD¶VVRIWZDUHLV\HDUV \HDUV $OOVRIWZDUHDVVHWVZHUHDVVHVVHGIRULQGLFDWLRQVRILPSDLUPHQWDVDW-XQH
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 79 7D[DWLRQ 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDWKH1DWLRQDO*DOOHU\RI$XVWUDOLD)RXQGDWLRQDQGWKH*RUGRQ 'DUOLQJ $XVWUDOLD3DFLILF 3ULQW )XQG DUH H[HPSW IURP DOO IRUPV RI WD[DWLRQ RWKHU WKDQ IULQJH EHQHILWVWD[ )%7 DQGWKHJRRGVDQGVHUYLFHVWD[ *67 5HYHQXHVH[SHQVHVDQGDVVHWV DUHUHFRJQLVHGQHWRI*67 x H[FHSWZKHUHWKHDPRXQWRI*67LQFXUUHGLVQRWUHFRYHUDEOHIURPWKH$XVWUDOLDQ7D[DWLRQ 2IILFH DQG x H[FHSWIRUUHFHLYDEOHVDQGSD\DEOHV ,QVXUDQFH 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDKDVLQVXUHGIRUULVNVWKURXJKWKH*RYHUQPHQW¶VLQVXUDEOHULVN PDQDJHGIXQGFDOOHGµ&RPFRYHU¶:RUNHUVFRPSHQVDWLRQLVLQVXUHGWKURXJK&RPFDUH 5HVWULFWHG$VVHWV 7KH 1DWLRQDO *DOOHU\ FRQWUROV WKH IROORZLQJ DVVHWV WKDW KDYH UHVWULFWLRQV RQ WKH PDQQHU LQ ZKLFKWKHDVVHWVFDQEHGHSOR\HG x IXQGV WKDW UHSUHVHQW GRQDWLRQV DQG EHTXHVWV ZKLFK DUH VXEMHFW WR OLPLWDWLRQV DV WR WKH SXUSRVHIRUZKLFKWKH\PD\EHDSSOLHG 7KHFDUU\LQJDPRXQWRIWKHVHIXQGVDVDW-XQHLV
80 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQVROLGDWHG 1*$
5HYHQXHVIURP*RYHUQPHQW
$SSURSULDWLRQVIRU2XWSXWV 7RWDOUHYHQXHVIURPJRYHUQPHQW
6DOHRIJRRGVDQGUHQGHULQJRIVHUYLFHV
$GPLVVLRQV 0HPEHUVKLS &DWHULQJIDFLOLW\ 0HUFKDQGLVLQJ 7RWDOVDOHRIJRRGVDQGUHQGHULQJRIVHUYLFHV
3URYLVLRQRIJRRGVWR 5HODWHGHQWLWLHV ([WHUQDOHQWLWLHV 7RWDOVDOHRIJRRGV
5HQGHULQJRIVHUYLFHVWR 5HODWHGHQWLWLHV ([WHUQDOHQWLWLHV 7RWDOUHQGHULQJRIVHUYLFHV
$&RQWULEXWLRQV
'RQDWLRQV H[FOXGLQJZRUNVRIDUWLQNLQG &RUSRUDWHVSRQVRUVKLS 'LYLGHQGVDQGGLVWULEXWLRQV
%$UW$FTXLVLWLRQV*LIWV
:RUNVRIDUWGRQDWLRQVLQNLQG
7KH1*$UHFHLYHGGRQDWLRQVRIZRUNVRIDUWDQGFDVKIRUWKHSXUFKDVHRIZRUNVRIDUWWRWDOOLQJ LQ 7KLVVXPZKLFKLVUHFRJQLVHGDVRSHUDWLQJUHYHQXHPXVWEHDSSOLHGWRFDSLWDO SXUSRVHV
&,QWHUHVW
'HSRVLWV 7RWDOLQWHUHVW
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 81 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQVROLGDWHG 1*$
'2WKHU
2WKHU *UDQWVDQGVXEVLGLHV ([KLELWLRQPDQDJHPHQW 7RWDORWKHUUHYHQXH
(*DLQVIURPVDOHRIDVVHWV
,QYHVWPHQWVVKDUHV 3URFHHGVIURPVDOH 1HWERRNYDOXHDWVDOH 6HOOLQJH[SHQVH ,QIUDVWUXFWXUHSODQW HTXLSPHQW 3URFHHGVIURPVDOH &DUU\LQJYDOXHRIDVVHWVVROG 6HOOLQJH[SHQVH 1HWJDLQIURPVDOHRIDVVHWV
)2WKHUJDLQV *DLQVIURPUHPHDVXULQJILQDQFLDOLQVWUXPHQWV KHOGDWIDLUYDOXH 7RWDORWKHUJDLQV
([SHQVHV
$(PSOR\HHEHQHILWV :DJHVDQGVDODULHV 6XSHUDQQXDWLRQ 'HILQHGEHQHILWSODQV 'HILQHGFRQWULEXWLRQSODQV /HDYHDQGRWKHUHQWLWOHPHQWV 6HSDUDWLRQDQGUHGXQGDQF\ 2WKHUHPSOR\HHEHQHILWV 7RWDOHPSOR\HHEHQHILWVH[SHQVHV &RXQFLOIHHV 7RWDOHPSOR\HHH[SHQVHV
82 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQVROLGDWHG 1*$
%6XSSOLHUV([SHQVHV ,QVXUDQFH :RUNHUV&RPSHQVDWLRQSUHPLXPV 2SHUDWLQJOHDVHH[SHQVHV 2WKHUJRRGVDQGVHUYLFHV 7RWDOVXSSOLHUVH[SHQVHV
*RRGVIURP ([WHUQDOHQWLWLHV 7RWDOJRRGVUHFHLYHG
6HUYLFHVIURP 5HODWHGHQWLWLHV ([WHUQDOHQWLWLHV 7RWDOVHUYLFHVUHFHLYHG
&'HSUHFLDWLRQDQG$PRUWLVDWLRQ 'HSUHFLDWLRQ ,QIUDVWUXFWXUHSODQWDQGHTXLSPHQW %XLOGLQJV :RUNVRIDUW /LEUDU\FROOHFWLRQ $PRUWLVDWLRQ ,QWDQJLEOHDVVHWV 7RWDOGHSUHFLDWLRQDQGDPRUWLVDWLRQ
':ULWH'RZQRI$VVHWV 3URYLVLRQIRUVORZPRYLQJDQGREVROHWHVWRFN %DGGHEWH[SHQVH /RVVHVIURPUHPHDVXULQJILQDQFLDOLQVWUXPHQWV KHOGDWIDLUYDOXH 7RWDOZULWHGRZQRIDVVHWV
&DVKDQG&DVK(TXLYDOHQWV
&DVKRQKDQGRURQGHSRVLW 7RWDOFDVKDQGFDVKHTXLYDOHQWV
,QYHVWPHQWV
(TXLWLHV 8QLWVWUXVWV 0DQDJHGIXQGV 7RWDOLQYHVWPHQWV
$OOLQYHVWPHQWVDUHFXUUHQWDQGDUHWUHDWHGDVILQDQFLDODVVHWVDWIDLUYDOXHWKURXJKWKHSURILWDQGORVV
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 83 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQVROLGDWHG 1*$
7UDGHDQGRWKHUUHFHLYDEOHV
*RRGVDQGVHUYLFHV *67UHFHLYDEOHIURP$XVWUDOLDQ7D[DWLRQ2IILFH :LWKKROGLQJWD[UHFHLYDEOH 7RWDOUHFHLYDEOHV JURVV /HVVDOORZDQFHIRUGRXEWIXOGHEWV *RRGVDQGVHUYLFHV 7RWDOUHFHLYDEOHV QHW
5HFHLYDEOHV JURVV DUHDJHGDVIROORZV 1RWRYHUGXH 2YHUGXHE\ /HVVWKDQGD\V WRGD\V WR GD\V 0RUHWKDQ GD\V 7RWDOUHFHLYDEOHV JURVV
7KHDOORZDQFHIRUGRXEWIXOGHEWVLVDJHGDVIROORZV 2YHUGXHE\ /HVVWKDQGD\V WRGD\V WR GD\V 0RUHWKDQ GD\V 7RWDODOORZDQFHIRUGRXEWIXOGHEWV $OOUHFHLYDEOHVDUHFXUUHQW
5HFRQFLOLDWLRQRIWKHDOORZDQFHIRUGRXEWIXOGHEWV
7RWDO 7RWDO *RRGV *RRGV 6HUYLFHV 6HUYLFHV 2SHQLQJEDODQFH $PRXQWVZULWWHQRII $PRXQWVUHFRYHUHGDQGUHYHUVHG ,QFUHDVHGHFUHDVHUHFRJQLVHGLQQHWVXUSOXV &ORVLQJEDODQFH
84 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQVROLGDWHG 1*$
2WKHU)LQDQFLDODVVHWV
$FFUXHGLQFRPH 7RWDORWKHUILQDQFLDODVVHWV
$OORWKHUILQDQFLDODVVHWVDUHFXUUHQW
+HULWDJHDQG&XOWXUDO$VVHWV
:RUNVRIDUW IDLUYDOXH DFFXPXODWHGGHSUHFLDWLRQ 7RWDOZRUNVRIDUW
/LEUDU\ IDLUYDOXH DFFXPXODWHGGHSUHFLDWLRQ 7RWDOOLEUDU\
7RWDOKHULWDJHDQGFXOWXUDODVVHWV QRQFXUUHQW
$QLQGHSHQGHQWYDOXDWLRQRIKHULWDJHDQGFXOWXUDODVVHWVZDVFDUULHGRXWE\WKH6LPRQ6WRUH\9DOXHUVWRSURYLGHD IDLUYDOXHDVDW-XQH
,QWDQJLEOH$VVHWV
&RPSXWHUVRIWZDUHDWFRVW DFFXPXODWHGDPRUWLVDWLRQ 7RWDOLQWDQJLEOHV QRQFXUUHQW
1RLQGLFDWRUVRILPSDLUPHQWZHUHIRXQGIRULQWDQJLEOHDVVHWV
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 85 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQVROLGDWHG 1*$
3URSHUW\3ODQWDQG(TXLSPHQW
$/DQGDQG%XLOGLQJV
/DQG IDLUYDOXH 7RWDOODQG %XLOGLQJV ZRUNLQSURJUHVV IDLUYDOXH DFFXPXODWHGGHSUHFLDWLRQ 7RWDOEXLOGLQJV 7RWDOODQGDQGEXLOGLQJV
$QLQGHSHQGHQWYDOXDWLRQRIODQGDQGEXLOGLQJVZDVFDUULHGRXWE\WKH.QLJKW)UDQNWRSURYLGHDIDLUYDOXHDVDW -XQH
1RLQGLFDWRUVRILPSDLUPHQWZHUHIRXQGIRUODQGDQGEXLOGLQJV
%,QIUDVWUXFWXUH3ODQWDQG(TXLSPHQW
IDLUYDOXH DFFXPXODWHGGHSUHFLDWLRQ 7RWDOLQIUDVWUXFWXUHSODQWDQGHTXLSPHQW
7KHODVWLQGHSHQGHQWYDOXDWLRQRILQIUDVWUXFWXUHSODQWDQGHTXLSPHQWZDVFDUULHGRXWE\WKH$XVWUDOLDQ9DOXDWLRQ 2IILFHLQ$OODVVHWVUHPDLQDWIDLUYDOXHDVDW-XQH
1RLQGLFDWRUVRILPSDLUPHQWIRXQGIRULQIUDVWUXFWXUHSODQWDQGHTXLSPHQW
86 7RWDO 7RWDO QD QD ,QWDQJLEOHV ,QWDQJLEOHV QG QG &XOWXUDO &XOWXUDO SODQW HTXLSPHQW EXLOGLQJV SODQW HTXLSPHQW EXLOGLQJV RQVROLGDWHG QD QD QD QD QD QD /DQG %XLOGLQJV 7RWDOODQGDQG 2WKHULQIUDVWUXFWXUH +HULWDJHD /DQG %XLOGLQJV 7RWDOODQGDQG 2WKHULQIUDVWUXFWXUH +HULWDJHD (TXLSPHQWDQG,QWDQJLEOHV & LQFUHPHQWGHFUHPHQW LQFUHPHQWGHFUHPHQW RQH[SHQVH RQH[SHQVH 5HYDOXDWLRQDQGLPSDLUPHQW 1HWERRNYDOXH 7$%/($5HFRQFLOLDWLRQRIWKH2SHQLQJDQG&ORVLQJEDODQFHV ,WHP $GGLWLRQV RWKHUGLVSRVDOV IURPDFTXLVLWLRQRIRSHUDWLRQV 'HSUHFLDWLRQDPRUWLVDWL E\SXUFKDVH 1HWERRNYDOXH-XO\ $FFXPXODWHGGHSUHFLDWLRQDPRUWLVDWLRQ 'LVSRVDOV $FFXPXODWHGGHSUHFLDWLRQDPRUWLVDWLRQ 1HWERRNYDOXHDVRI-XQHUHSUHVHQWHGE\ *URVVERRNYDOXH $FFXPXODWHGGHSUHFLDWLRQDPRUWLVDWLRQ 1HWERRNYDOXH-XO\ 1HWERRNYDOXH-XQH $VDW-XO\ *URVVERRNYDOXH $VDW-XO\ *URVVERRNYDOXH 1HWERRNYDOXH 5HYDOXDWLRQDQGLPSDLUPHQW $FFXPXODWHGGHSUHFLDWLRQDPRUWLVDWLRQ 1HWERRNYDOXHDVRI-XQHUHSUHVHQWHGE\ *URVVERRNYDOXH RWKHUGLVSRVDOV 7$%/($5HFRQFLOLDWLRQRIWKH2SHQLQJDQG&ORVLQJEDODQFHV IURPDFTXLVLWLRQRIRSHUDWLRQV 'HSUHFLDWLRQDPRUWLVDWL &$QDO\VLVRI3URSHUW\3ODQW $GGLWLRQV ,WHP 'LVSRVDOV E\SXUFKDVH 1HWERRNYDOXH-XQH
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 87 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQVROLGDWHG 1*$
,QYHQWRULHV
,QYHQWRULHVKHOGIRUVDOH )LQLVKHGJRRGV /HVV SURYLVLRQIRUVORZPRYLQJDQGREVROHWH LQYHQWRU\ 7RWDOLQYHQWRULHV FXUUHQW
2WKHU1RQILQDQFLDODVVHWV
3UHSD\PHQWV 7RWDORWKHUQRQILQDQFLDODVVHWV
$OOSUHSD\PHQWVDUHFXUUHQWDVVHWV7KHUHDUHQRLQGLFDWRUVIRULPSDLUPHQWIRURWKHUQRQILQDQFLDODVVHWV
3URYLVLRQDQG3D\DEOHV
$(PSOR\HHSURYLVLRQV 6DODULHVDQGZDJHV 5HFUHDWLRQOHDYH /RQJVHUYLFHOHDYH 6XSHUDQQXDWLRQ 6HSDUDWLRQDQGUHGXQGDQFLHV 2WKHU 7RWDOHPSOR\HHSURYLVLRQV
(PSOR\HHSURYLVLRQVDUHUHSUHVHQWHGE\ &XUUHQW 1RQFXUUHQW 7RWDOHPSOR\HHSURYLVLRQV
7KHFODVVLILFDWLRQRIFXUUHQWHPSOR\HHSURYLVLRQVLQFOXGHVDPRXQWVIRUZKLFKWKHUHLVQRWDQXQFRQGLWLRQDOULJKWWR GHIHUVHWWOHPHQWE\RQH\HDUKHQFHLQWKHFDVHRIHPSOR\HHSURYLVLRQVWKHDERYHFODVVLILFDWLRQGRHVQRWUHSUHVHQW WKHDPRXQWH[SHFWHGWREHVHWWOHGZLWKLQRQH\HDURIUHSRUWLQJGDWH(PSOR\HHSURYLVLRQVH[SHFWHGWREHVHWWOHGLQ WZHOYHPRQWKVIURPWKHUHSRUWLQJGDWHDUH @
%6XSSOLHUV &UHGLWRUVDUWDFTXLVLWLRQV 7UDGHFUHGLWRUV 2WKHUFUHGLWRUV 8QHDUQHGLQFRPH 7RWDOVXSSOLHUSD\DEOHV
6XSSOLHUSD\DEOHVDUHUHSUHVHQWHGE\ &XUUHQW 1RQFXUUHQW 7RWDOVXSSOLHUSD\DEOHV
6HWWOHPHQWLVXVXDOO\PDGHQHWGD\V
88 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQVROLGDWHG 1*$
&DVK)ORZ5HFRQFLOLDWLRQ
5HFRQFLOLDWLRQRIFDVKDQGFDVKHTXLYDOHQWV DVSHU%DODQFH6KHHWWR&DVK)ORZVWDWHPHQW
5HSRUWFDVKDQGFDVKHTXLYDOHQWVDVSHU &DVK)ORZ6WDWHPHQW %DODQFH6KHHW 'LIIHUHQFH
5HFRQFLOLDWLRQRI2SHUDWLQJ6XUSOXVWR1HW&DVKIURP2SHUDWLQJ$FWLYLWLHV
2SHUDWLQJ6XUSOXV 1RQ&DVK,WHPV 'HSUHFLDWLRQDQGDPRUWLVDWLRQ *DLQRQVDOHRIQRQILQDQFLDODVVHWV %DGGHEWH[SHQVH :ULWHGRZQRIDVVHWV *DLQRQVDOHRIVKDUHV /RVV *DLQ RQPDUNHWUHYDOXDWLRQRIVKDUHV /RVVIURPGLVSRVDORIQRQFXUUHQWDVVHWV *LIWVRIZRUNVRIDUW *LIWVRISODQWDQGHTXLSPHQW &DSLWDOLVDWLRQRI&RQVHUYDWLRQVDODU\FRVWV 5HFRJQLWLRQRIDVVHWV &KDQJHLQ$VVHWVDQG/LDELOLWLHV ,QFUHDVH GHFUHDVHLQUHFHLYDEOHV ,QFUHDVH GHFUHDVHLQLQYHQWRULHV ,QFUHDVH GHFUHDVHLQRWKHUDVVHWVDQGOLDELOLWLHV ,QFUHDVH GHFUHDVH LQFUHGLWRUV ,QFUHDVH GHFUHDVH LQSURYLVLRQVIRUHPSOR\HH HQWLWOHPHQWV 1HWFDVKIURP XVHGE\ RSHUDWLQJDFWLYLWLHV
&RQWLQJHQW/LDELOLWLHVDQG$VVHWV
&RQWLQJHQWOLDELOLWLHV &ODLPIRUGDPDJHVFRVWV
&RQWLQJHQWDVVHWV /DQGDQGEXLOGLQJV
1HWFRQWLQJHQWDVVHWV OLDELOLWLHV
7KH1DWLRQDO*DOOHU\UHFHLYHGDSURSHUW\DVDEHTXHVW7KHUHDUHVSHFLILFFRQGLWLRQVDQGHYHQWVWKDWDUHUHTXLUHG WRRFFXUEHIRUHWKH1DWLRQDO*DOOHU\JDLQVFRQWURORIWKHSURSHUW\
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 89 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV 1DWLRQDO*DOOHU\RI$XVWUDOLD)XQG
7KH1DWLRQDO*DOOHU\RI$XVWUDOLD)XQGZDVHVWDEOLVKHGE\VXEVHFWLRQ RIWKH1DWLRQDO*DOOHU\$FW WR UHFHLYHJLIWVDQGEHTXHVWVRIPRQH\RWKHUWKDQRQWUXVWDQGLQFOXGHVWKHUHWXUQRQLQYHVWPHQWRIWKRVHPRQH\V 7KHIXQGEDODQFHLVLQFOXGHGLQFDVKDQGLQFRPHDQGH[SHQGLWXUHDUHUHFRUGHGLQWKH,QFRPH6WDWHPHQW %DODQFHDW-XO\ ,QFRPH 'RQDWLRQV ,QWHUHVW ([SHQGLWXUH $FTXLVLWLRQRIZRUNVRIDUW 2WKHUH[SHQVHV %DODQFHDW-XQH
5HPXQHUDWLRQRI([HFXWLYH2IILFHUV &RQVROLGDWHG 1*$ 7KHWRWDOUHPXQHUDWLRQUHFHLYHGRUGXHDQG UHFHLYDEOHE\WKHH[HFXWLYHRIILFHUVVKRZQ EHORZ 7KHDJJUHJDWHDPRXQWRIVHSDUDWLRQDQG UHGXQGDQF\WHUPLQDWLRQEHQHILWSD\PHQWV GXULQJWKH\HDUWRH[HFXWLYHVVKRZQDERYH
7KHQXPEHURIH[HFXWLYHRIILFHUVLQFOXGHGLQWKHVHILJXUHVDUHVKRZQLQWKHVSHFLILHGEDQGVDVIROORZV
1XPEHU 1XPEHU 1XPEHU 1XPEHU 7RWDO
7KHH[HFXWLYHRIILFHUV UHPXQHUDWLRQLQFOXGHVRIILFHUVZKRUHFHLYHGUHPXQHUDWLRQRIRUPRUHLQWKH\HDU ZKRZHUHFRQFHUQHGZLWKRUWRRNSDUWLQWKHPDQDJHPHQWRIWKH*DOOHU\GXULQJH[FHSWWKH'LUHFWRU'HWDLOV LQUHODWLRQWRWKH'LUHFWRUKDYHEHHQLQFRUSRUDWHGLQWR1RWH
5HPXQHUDWLRQRI$XGLWRUV &RQVROLGDWHG 1*$ $PRXQWVUHFHLYHGRUGXHDQGUHFHLYDEOHE\WKH $XVWUDOLDQ1DWLRQDO$XGLW2IILFH $1$2 DV DXGLWRUVRIWKH1DWLRQDO*DOOHU\RI$XVWUDOLDDQG WKH1DWLRQDO*DOOHU\RI$XVWUDOLD)RXQGDWLRQ 7RWDOIDLUYDOXHRIVHUYLFHVSURYLGHG
560%LUG&DPHURQKDYHEHHQFRQWUDFWHGE\$1$2WRSURYLGHDXGLWVHUYLFHVRQWKH$1$2 VEHKDOI)HHVIRUWKHVH VHUYLFHVDUHLQFOXGHGDERYH1RRWKHUVHUYLFHVZHUHSURYLGHGE\560%LUG&DPHURQ
90 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &RQWUROOHG(QWLW\*RUGRQ'DUOLQJ$XVWUDOLD3DFLILF3ULQW)XQG 7KH*RUGRQ'DUOLQJ$XVWUDOLD3DFLILF3ULQW)XQGLVDWUXVWHVWDEOLVKHGLQ 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDLV WKH7UXVWHHRIWKHWUXVW7KH*DOOHU\DV7UXVWHHKROGVWKHWUXVWIXQGVDQGRSHUDWHVWKHIXQGLQDFFRUGDQFHZLWKWKH WHUPVDQGFRQGLWLRQVRIWKHWUXVWGHHG7KHWUXVWGHHGJLYHVHIIHFWLYHFRQWURORIWKHWUXVWWRWKH1DWLRQDO*DOOHU\RI $XVWUDOLDXQGHUWKHGHILQLWLRQRIFRQWUROLQ$$6%&RQVROLGDWHGDQG6HSDUDWH)LQDQFLDO6WDWHPHQWV &RQWUROOHG(QWLW\1DWLRQDO*DOOHU\RI$XVWUDOLD)RXQGDWLRQ 7KH 1DWLRQDO *DOOHU\ RI $XVWUDOLD )RXQGDWLRQ LV D FRPSDQ\ LQFRUSRUDWHG XQGHU WKH &RUSRUDWLRQV $FW DV D FRPSDQ\OLPLWHGE\JXDUDQWHHDQGQRWKDYLQJVKDUHFDSLWDO 7KH1DWLRQDO*DOOHU\RI$XVWUDOLD)RXQGDWLRQERDUGLVFRQVWLWXWHGLQVXFKDZD\DVWRJLYHHIIHFWLYHFRQWURORIWKH )RXQGDWLRQWRWKH1DWLRQDO*DOOHU\RI$XVWUDOLDXQGHUWKHGHILQLWLRQRIFRQWUROLQ$$6%&RQVROLGDWHGDQG 6HSDUDWH)LQDQFLDO6WDWHPHQWV 7KH )RXQGDWLRQ V VWDWHPHQWV KDYH WKHUHIRUH EHHQ FRQVROLGDWHG ZLWK WKRVH RI WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDKDVQRRZQHUVKLSLQWHUHVWLQWKH)RXQGDWLRQ 5HPXQHUDWLRQRI&RXQFLO0HPEHUVLQFOXGLQJWKH'LUHFWRU 7RWDOUHPXQHUDWLRQUHFHLYHGRUGXHDQGUHFHLYDEOHE\&RXQFLOPHPEHUVDQG WKH'LUHFWRURIWKH1DWLRQDO*DOOHU\RI$XVWUDOLD
7KHQXPEHURIPHPEHUVRIWKH1DWLRQDO*DOOHU\RI$XVWUDOLD&RXQFLO LQFOXGHGLQWKHVHILJXUHVDUHVKRZQEHORZLQWKHUHOHYDQWUHPXQHUDWLRQ EDQGV 1XPEHU 1XPEHU
1LO
0HPEHUVRIWKH1DWLRQDO*DOOHU\RI$XVWUDOLD&RXQFLODUHDSSRLQWHGE\WKH*RYHUQRU*HQHUDO
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 91 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV 5HODWHG3DUW\'LVFORVXUHV $&RQWUROOHG(QWLW\1DWLRQDO*DOOHU\RI$XVWUDOLD)RXQGDWLRQ &HUWDLQ H[SHQGLWXUH LQFXUUHG E\ WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD RQ EHKDOI RI WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLD )RXQGDWLRQ KDV EHHQ FKDUJHG WR WKH )RXQGDWLRQ LQ ZKLFK FRPSULVHV UHVRXUFHV SURYLGHG IUHH RI FKDUJH $Q\ DGGLWLRQDO H[SHQGLWXUH UHODWLQJ WR WKH )RXQGDWLRQ SDLG E\ WKH 1DWLRQDO *DOOHU\ RI $XVWUDOLDKDVEHHQZDLYHG 7KH)RXQGDWLRQGRQDWHG LQ WRWKH1DWLRQDO*DOOHU\RI$XVWUDOLDGXULQJWKH\HDU 'RQDWLRQVFRQVLVWHGRIIXQGVIRUWKHGHYHORSPHQWRIWKHQDWLRQDOFROOHFWLRQRIZRUNVRIDUW %&RQWUROOHG(QWLW\*RUGRQ'DUOLQJ$XVWUDOLD3DFLILF3ULQW)XQG 7KH *RUGRQ 'DUOLQJ $XVWUDOLD3DFLILF 3ULQW )XQG FRQWULEXWHG LQ WR WKH 1DWLRQDO *DOOHU\RI$XVWUDOLDGXULQJWKH\HDUFRQVLVWLQJRIZRUNVRIDUW &&RXQFLO0HPEHUV 0HPEHUVRIWKH1DWLRQDO*DOOHU\RI$XVWUDOLD&RXQFLOGXULQJWKHILQDQFLDO\HDUZHUH 1DPH 'DWHFRPPHQFHG 0UV5%UDFKHU$0 0U-&DOYHUW-RQHV$0 0U&&XUUDQ$&>'HSXW\&KDLUPDQVLQFH@ 0UV$'DZVRQ'DPHU 0U:+HPVOH\ 0V//LEHUPDQ>5HWLUHG @ 0U50\HU$0>&KDLUPDQVLQFH@ 0UV53DFNHU$2 'U55DGIRUG$0 0U,DQ&DOOLQDQ$&4& 1R &RXQFLO PHPEHU KDV UHFHLYHG RU EHFRPH HQWLWOHG WR UHFHLYH D EHQHILW E\ UHDVRQ RI FRQWUDFW PDGH E\ WKH 1DWLRQDO*DOOHU\RI$XVWUDOLDZLWKWKH&RXQFLOPHPEHURUZLWKDUHODWHGHQWLW\RIWKH&RXQFLOPHPEHU &RXQFLOPHPEHUVDUHSDLGLQDFFRUGDQFHZLWK5HPXQHUDWLRQ7ULEXQDOGHWHUPLQDWLRQVDVSURYLGHGE\VHFWLRQRI WKH1DWLRQDO*DOOHU\$FW (YHQWV2FFXUULQJ$IWHU5HSRUWLQJ'DWH 7KHUHDUHQRHYHQWVWKDWRFFXUUHGDIWHUEDODQFHGDWHWKDWKDYHDQLPSDFWRQWKHILQDQFLDOVWDWHPHQWV &RPSHQVDWLRQDQG'HEW5HOLHI 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDLQFXUUHGQRH[SHQVHVRUOLDELOLWLHVLQUHODWLRQWRFRPSHQVDWLRQDQGGHEWUHOLHILQ WKHUHSRUWLQJSHULRG> QLO@
92 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV $SSURSULDWLRQV
7DEOH$ $FTXLWWDORI$XWKRULW\WR'UDZ&DVKIURPWKH&RQVROLGDWHG5HYHQXH)XQGIRU2UGLQDU\$QQXDO 6HUYLFHV$SSURSULDWLRQV
3DUWLFXODUV 'HSDUWPHQW2XWSXWV 7RWDO
%DODQFHFDUULHGIRUZDUGIURPSUHYLRXV\HDU $SSURSULDWLRQ$FW $SSURSULDWLRQ$FW QR $SSURSULDWLRQ$FW QR $SSURSULDWLRQ$FW QR 7RWDODSSURSULDWLRQDYDLODEOHIRUSD\PHQWV &DVKSD\PHQWVPDGHGXULQJWKH\HDU *67 LQFOXVLYH $SSURSULDWLRQVFUHGLWHGWR6SHFLDO$FFRXQWV H[FOXGLQJ*67 %DODQFHRI$XWKRULW\WRGUDZFDVKIURPWKH FRQVROLGDWHGUHYHQXHIXQGIRURUGLQDU\ DQQXDOVHUYLFHVDSSURSULDWLRQVUHSUHVHQWHG E\
&DVKDWEDQNDQGRQKDQG 'HSDUWPHQWDODSSURSULDWLRQVUHFHLYDEOH 7RWDO
'HSDUWPHQWDODQGQRQRSHUDWLQJDSSURSULDWLRQVGRQRWODSVHDWILQDQFLDO\HDUHQG+RZHYHUWKHUHVSRQVLEOH0LQLVWHUPD\GHFLGH WKDWSDUWRUDOORIDGHSDUWPHQWDORUQRQRSHUDWLQJDSSURSULDWLRQLVQRWUHTXLUHGDQGUHTXHVWWKH)LQDQFH0LQLVWHUWRUHGXFHWKDW DSSURSULDWLRQ7KHUHGXFWLRQLQWKHDSSURSULDWLRQLVHIIHFWHGE\WKH)LQDQFH0LQLVWHU VGHWHUPLQDWLRQDQGLVGLVDOORZDEOHE\ 3DUOLDPHQW
7DEOH% $FTXLWWDORIDXWKRULW\WRGUDZFDVKIURPWKH&RQVROLGDWHG5HYHQXH)XQGIRU2WKHUWKDQRUGLQDU\ $QQXDO6HUYLFHV$SSURSULDWLRQV
1RQRSHUDWLQJ 3DUWLFXODUV (TXLW\ /RDQV 7RWDO
%DODQFHFDUULHGIRUZDUGIURPSUHYLRXV\HDU $SSURSULDWLRQ$FW $SSURSULDWLRQ$FW QR $SSURSULDWLRQ$FW QR 7RWDODSSURSULDWLRQDYDLODEOHIRUSD\PHQWV &DVKSD\PHQWVPDGHGXULQJWKH\HDU *67 LQFOXVLYH $SSURSULDWLRQVFUHGLWHGWR6SHFLDO$FFRXQWV H[FOXGLQJ*67 %DODQFHRI$XWKRULW\WRGUDZFDVKIURPWKH FRQVROLGDWHGUHYHQXHIXQGIRURUGLQDU\ DQQXDOVHUYLFHVDSSURSULDWLRQVUHSUHVHQWHG E\
&DVKDWEDQNDQGRQKDQG 'HSDUWPHQWDODSSURSULDWLRQVUHFHLYDEOH 7RWDO
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 93 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV )LQDQFLDO,QVWUXPHQWV $&DWHJRULHVRIILQDQFLDOLQVWUXPHQWV
)LQDQFLDO$VVHWV &RQVROLGDWHG 1*$ )DLU9DOXHWKURXJKWKHSURILWDQGORVV ,QYHVWPHQWV /RDQVDQGUHFHLYDEOHV &DVKDQGFDVKHTXLYDOHQWV 5HFHLYDEOHVIRUJRRGVDQGVHUYLFHV 2WKHU &DUU\LQJDPRXQWRIILQDQFLDODVVHWV
)LQDQFLDO/LDELOLWLHV 2WKHUILQDQFLDOOLDELOLWLHV 7UDGHFUHGLWRUV
&DUU\LQJDPRXQWRIILQDQFLDOOLDELOLWLHV
%1HWLQFRPHDQGH[SHQVHIURPILQDQFLDODVVHWV
/RDQVDQGUHFHLYDEOHV ,QWHUHVWUHYHQXH 1HWJDLQ ORVV ORDQVDQGUHFHLYDEOHV
)DLUYDOXHWKURXJKWKHSURILWDQGORVV 'LYLGHQGDQGGLVWULEXWLRQUHYHQXH JDLQV ORVVHV RQYDOXDWLRQ JDLQV ORVVHV RQVDOH 1HWJDLQ ORVV WKRXJKSURILWDQGORVV 1HWJDLQ ORVV IURPILQDQFLDODVVHWV
7KHUHZHUHQRQHWLQFRPHVDQGH[SHQVHVIURPILQDQFLDOOLDELOLWLHV
7KHQHWLQFRPHH[SHQVHIURPILQDQFLDODVVHWVQRWDWIDLUYDOXHIURPSURILWDQGORVVLVQLO
94 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV &&UHGLW5LVN 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDLVH[SRVHGWRPLQLPDOFUHGLWULVNDVWKHPDMRULW\RIORDQVDQGUHFHLYDEOHVDUH FDVK RU DPRXQWV RZHG E\ WKH $XVWUDOLDQ 7D[ 2IILFH LQ WKH IRUP RI D *RRGV DQG 6HUYLFHV 7D[ UHIXQG 7KH PD[LPXPH[SRVXUHWRFUHGLWULVNLVWKHULVNWKDWDULVHVIURPSRWHQWLDOGHIDXOWRIDGHEWRU7KLVDPRXQWLVHTXDOWR WKHWRWDODPRXQWRIWUDGHUHFHLYDEOHV DQG 7KH1DWLRQDO*DOOHU\RI$XVWUDOLD KDV DVVHVVHG WKH ULVN RI WKH GHIDXOW RQ SD\PHQW DQG KDV DOORFDWHG LQ WR DQ DOORZDQFHIRUGRXEWIXOGHEWV 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDPDQDJHVLWVFUHGLWULVNE\XQGHUWDNLQJEDFNJURXQGDQGFUHGLWFKHFNVSULRUWR DOORZLQJDGHEWRUUHODWLRQVKLS,QDGGLWLRQWKH1DWLRQDO*DOOHU\RI$XVWUDOLDKDVSROLFLHVDQGSURFHGXUHVWKDWJXLGH HPSOR\HHV¶GHEWUHFRYHU\WHFKQLTXHVWKDWDUHWREHDSSOLHG 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDKDYHQRFROODWHUDOWRPLWLJDWHDJDLQVWFUHGLWULVN &UHGLWULVNRIILQDQFLDOLQVWUXPHQWVQRWSDVWGXHRULQGLYLGXDOO\GHWHUPLQHGDVLPSDLUHG 1RW3DVW 1RW3DVW'XH 3DVWGXHRU 3DVWGXHRU 'XH1RU 1RU,PSDLUHG LPSDLUHG LPSDLUHG ,PSDLUHG &DVKDQGFDVKHTXLYDOHQWV 5HFHLYDEOHVIRUJRRGVDQGVHUYLFHV 7RWDO
$JHLQJRIILQDQFLDODVVHWVWKDWDUHSDVWGXHEXWQRWLPSDLUHGIRU
WR WR WR GD\V GD\V GD\V GD\V 7RWDO 5HFHLYDEOHVIRUJRRGVDQGVHUYLFHV 7RWDO
$JHLQJRIILQDQFLDODVVHWVWKDWDUHSDVWGXHEXWQRWLPSDLUHGIRU
WR WR WR GD\V GD\V GD\V GD\V 7RWDO 5HFHLYDEOHVIRUJRRGVDQGVHUYLFHV 7RWDO
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 95 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV ')DLU9DOXHVRI)LQDQFLDO,QVWUXPHQWV
7RWDO 7RWDO &DUU\LQJ )DLU9DOXH &DUU\LQJ )DLU9DOXH $PRXQW $PRXQW 1RWH )LQDQFLDO$VVHWV
&DVKDQGFDVKHTXLYDOHQWV ,QYHVWPHQWV 7UDGH RWKHUUHFHLYDEOHV 2WKHU
7RWDO)LQDQFLDO$VVHWV
)LQDQFLDO/LDELOLWLHV 5HFRJQLVHG
6XSSOLHUV %
7RWDO)LQDQFLDO/LDELOLWLHV (/LTXLGLW\5LVN 7KH1DWLRQDO*DOOHU\RI$XVWUDOLD VILQDQFLDOOLDELOLWLHVDUHSD\DEOHV7KHH[SRVXUHWROLTXLGLW\ULVNLVEDVHGRQWKH QRWLRQWKDWWKH$XWKRULW\ZLOOHQFRXQWHUGLIILFXOW\LQPHHWLQJLWVREOLJDWLRQVDVVRFLDWHGZLWKILQDQFLDOOLDELOLWLHV7KLV LVKLJKO\XQOLNHO\GXHWRDSSURSULDWLRQIXQGLQJDQGPHFKDQLVPVDYDLODEOHWRWKH*DOOHU\ HJLQWHUQDOSROLFLHVDQG SURFHGXUHVSXWLQSODFHWRHQVXUHWKHUHDUHDSSURSULDWHUHVRXUFHVWRPHHWLWVILQDQFLDOREOLJDWLRQV 7KHIROORZLQJWDEOHLOOXVWUDWHVWKHPDWXULWLHVIRUILQDQFLDOOLDELOLWLHV 2Q ZLWKLQ WR ! GHPDQG \HDU \HDUV \HDUV 7RWDO &UHGLWRUV 7RWDO
2Q ZLWKLQ WR ! GHPDQG \HDU \HDUV \HDUV 7RWDO &UHGLWRUV 7RWDO 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDLVDSSURSULDWHGIXQGLQJIURPWKH$XVWUDOLDQ*RYHUQPHQW7KH1DWLRQDO*DOOHU\ PDQDJHVLWVEXGJHWHGIXQGVWRHQVXUHLWKDVDGHTXDWHIXQGVWRPHHWSD\PHQWVDVWKH\IDOOGXH,QDGGLWLRQWKH 1DWLRQDO*DOOHU\RI$XVWUDOLDKDVSROLFLHVLQSODFHWRHQVXUHWLPHO\SD\PHQWVDUHPDGHZKHQGXHDQGKDVQRSDVW H[SHULHQFHRIGHIDXOW
96 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV )0DUNHW5LVN 7KH 1DWLRQDO *DOOHU\ RI $XVWUDOLD KROGV EDVLF ILQDQFLDO LQVWUXPHQWV WKDW GR QRW H[SRVH WKH *DOOHU\ WR FHUWDLQ PDUNHWULVNV7KH1DWLRQDO*DOOHU\RI$XVWUDOLDLVQRWH[SRVHGWRFXUUHQF\ULVNRULQWHUHVWUDWHULVN (TXLW\3ULFHULVN 7KH 1DWLRQDO *DOOHU\ KDV DQ LQYHVWPHQW SRUWIROLR ZKLFK FRQWDLQV VKDUHV LQ FRPSDQLHV OLVWHG RQWKH $XVWUDOLDQ 6WRFN ([FKDQJH 7KH YDOXH RI WKLV SRUWIROLR ZLOO IOXFWXDWH GXH WR FKDQJHV LQ PDUNHW SULFHV DQG LV WKHUHIRUH H[SRVHGWRFKDQJHVLQIDLUYDOXHULVN 6HQVLWLYLW\DQDO\VLV 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDXQGHUWRRNDQDVVHVVPHQWRIWKHUHDVRQDEOHSRVVLEOHFKDQJHLQWKHSULFHRIWKH LQYHVWPHQW SRUWIROLR RYHU WKH QH[W PRQWKV EDVHG RQ KLVWRULFDOIDFWRUV7KLVDVVHVVPHQWZDVEDVHGRQ WKH DVVXPSWLRQ WKDW WKH LQYHVWPHQWV KHOG LQ WKH SRUWIROLR UHPDLQ FRQVWDQW WR -XQH 7KH IDLU YDOXH RI WKH LQYHVWPHQWSRUWIROLRDVDW-XQHDPRXQWHGWR$K\SRWKHWLFDOLQFUHDVH GHFUHDVH LQWKH IDLUYDOXHRIWKHVKDUHVZLWKLQWKHSRUWIROLRZRXOGUHVXOWLQDJDLQ ORVV RIUHVSHFWLYHO\ VXFKDJDLQ ORVV ZRXOGEHUHFRJQLVHGWKURXJKWKH,QFRPHVWDWHPHQW
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 97 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV 5HSRUWLQJRI2XWFRPHV $2XWFRPHVRIWKH1DWLRQDO*DOOHU\RI$XVWUDOLD 7KH1DWLRQDO*DOOHU\RI$XVWUDOLDLVVWUXFWXUHGWRPHHWRQHRXWFRPH 2XWFRPH (QFRXUDJHXQGHUVWDQGLQJNQRZOHGJHDQGHQMR\PHQWRIWKHYLVXDODUWVE\ SURYLGLQJDFFHVVWRDQGLQIRUPDWLRQDERXWZRUNVRIDUWORFDOO\QDWLRQDOO\ DQGLQWHUQDWLRQDOO\ 7KHUHDUHWKUHHRXWSXWVLGHQWLILHGIRUWKHDERYHRXWFRPH 2XWSXW&ROOHFWLRQ'HYHORSPHQW 2XWSXW&ROOHFWLRQ0DQDJHPHQW 2XWSXW$FFHVVWRDQG3URPRWLRQRI:RUNVRI$UW 2XWFRPH ([SHQVHV 'HSDUWPHQWDO 7RWDOH[SHQVHV &RVWUHFRYHUHGIURPSURYLVLRQRIJRRGVDQGVHUYLFHV WRWKHQRQJRYHUQPHQWVHFWRU 'HSDUWPHQWDO 7RWDOFRVWVUHFRYHUHG 2WKHUH[WHUQDOUHYHQXH 'HSDUWPHQWDO 6DOHRIJRRGVDQGVHUYLFHVWRUHODWHGSDUWLHV &RQWULEXWLRQV $UWDFTXLVLWLRQVJLIWV ,QWHUHVW 2WKHU 7RWDO'HSDUWPHQWDO 7RWDORWKHUH[WHUQDOUHYHQXHV 1HWFRVW FRQWULEXWLRQ RIRXWFRPH
7KH1DWLRQDO*DOOHU\RI$XVWUDOLDXVHVDQ$FWLYLW\%DVHG&RVWLQJ6\VWHPWRGHWHUPLQH WKHDWWULEXWLRQRILWVVKDUHGLWHPV
7KHH[WHUQDOUHYHQXHLQFOXGHVGRQDWLRQVRIZRUNVRIDUWDQGFDVKIRUWKHSXUFKDVHRI ZRUNVRIDUWWRWDOOLQJ LQ 7KLVVXPZKLFKLV UHFRJQLVHGDVRSHUDWLQJUHYHQXHPXVWEHDSSOLHGWRFDSLWDOSXUSRVHV
98 7RWDO 2XWSXW 2XWSXW HDFWXDO%XGJHWRXWFRPH SXWV 2XWSXW HHOLPLQDWHGLQFDOFXODWLQJWK GUHYHQXHVRUH[SHQVHV DJRYHUQPHQWFRVWVWKDWZRXOGE DGRHVQRWKDYHDQ\DGPLQLVWHUH 2XWFRPH &'HSDUWPHQWDO5HYHQXHVDQG([SH QVHVE\2XWSXW*URXSVDQG2XW 'HSDUWPHQWDO([SHQVHV (PSOR\HHV 2WKHU $UWDFTXLVLWLRQVJLIV ,QWHUHVW 7RWDOGHSDUWPHQWDOUHYHQXH 7KHQHWFRVWVVKRZQLQFOXGHLQWU '$GPLQLVWHUHG5HYHQXHVDQG([SHQVHVE\2XWFRPHV 7KH1DWLRQDO*DOOHU\RI$XVWUDOL 'HSUHFLDWLRQDQGDPRUWLVDWLRQ 1HWORVVIURPGLVSRVDORIDVVHWV 7RWDOGHSDUWPHQWDOH[SHQVHV :ULWHGRZQRIDVVHWV )XQGHGE\ 5HYHQXHVIURP*RYHUQPHQW &RQWULEXWLRQV 6XSSOLHUV 6DOHRIJRRGVDQGVHUYLFHV 1RWHVWRDQGIRUPLQJSDUWRIWKHILQDQFLDOVWDWHPHQWV
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 99
APPENDICES APPENDIX 1 COUNCIL OF THE NATIONAL GALLERY OF AUSTRALIA
The following members served on the Council and Committee on six occasions and the Building on Council Committees during the year ending Committee met formally on eleven occasions and 30 June 2008. The Council met on six occasions maintained oversight of issues associated with the in the year, the Finance, Risk Management and building on an ongoing manner. Audit Committee on six occasions, the Acquisitions
APPOINTMENTTERMS COUNCIL MEETINGS COUNCIL COMMITTEE MEETINGS ELIGIBLE ELIGIBLE TO ATTEND ATTENDED TO ATTEND ATTENDED Dr Ron Radford, AM (Director) 6 6 23 22 20/12/04 – 19/12/09 Mr Robert Champion de Crespigny, AC 16/5/02 – 15/5/05 – – – – 16/5/05 – 11/7/07 (resigned 11/7/07) Mrs Roslyn Packer, AO 26/6/02 – 25/6/05 6 6 6 4 26/6/05 – 25/6/08 26/6/08 – 25/6/11 Mr Rupert Myer, AM* 24/9/03 – 26/9/06 6 6 23 23 20/10/05 – 19/12/08 Mr Charles Curran, AC** 24/9/03 – 26/9/06 6 6 11 11 27/9/06 – 26/9/09 Ms Lee Liberman 19/2/04 – 18/2/07 5 2 5 2 19/2/07 – 18/2/10 (resigned 19/5/08) Mrs Roslynne Bracher, AM 19/8/04 – 18/8/07 5 4 5 4 6/9/07 – 5/9/10 The Hon. Mrs Ashley Dawson-Damer 22/4/05 – 21/4/08 5 4 5 4 30/5/08 – 29/5/11 Mr John Calvert-Jones, AM 6 6 17 17 1/8/06 – 31/7/09 Mr Warwick Hemsley 6 6 6 6 13/12/06 – 12/12/09 The Hon. Ian Callinan, AC 5 4 – – 26/9/07 – 25/9/10
* Chairman from 20/12/05 ** Deputy Chairman from 27/6/07
102 COUNCIL COMMITTEES
Finance, Risk Management and Audit Committee This committee monitors the Gallery’s finances and the framework for the management of risks and opportunities. The committee also serves as the Gallery’s Audit Committee. Members as at 30 June 2008 Mr Warwick Hemsley (Chair) Mr John Calvert Jones, AM Mr Rupert Myer, AM (Ex-officio) Mr Robert Champion de Crespigny, AC (resigned 11/7/07)
Acquisitions Committee This committee reviews proposals and makes recommendations to the Gallery Council for the acquisition of works of art entering the national collection. Members as at 30 June 2008 Mrs Roslyn Packer, AO (Chair) Mr Rupert Myer, AM Mrs Roslynne Bracher, AM Ms Lee Liberman (resigned 19/5/08) The Hon. Mrs Ashley Dawson-Damer
Building Committee This committee oversees the Gallery’s management of major building projects, including the Stage 1 South Entrance and Indigenous Australian Galleries project. Members as at 30 June 2008 Mr Charles Curran, AC (Chair) Mr Rupert Myer, AM Mr John Calvert-Jones, AM The Hon. Ian Callinan, AC (from 25/6/08)
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 103 APPENDIX 2 MANAGEMENT STRUCTURE AT 30 JUNE 2008
JUNE 2008 COUNCIL
Chairman Rupert Myer, AM
NATIONAL GALLERY OF DIRECTOR AUSTRALIA FOUNDATION
Chairman Ron Radford, AM Charles Curran, AC
ASSISTANT ASSISTANT DEPUTY ASSISTANT DIRECTOR DIRECTOR DIRECTOR DIRECTOR
Development, Exhibitions and Curatorial and Marketing and Administration Collections Services Educational Services Commercial Alan Froud Adam Worrall Simon Elliott Operations Shanthini Naidoo
Education and Exhibitions Major Projects Foundation Public Programs
Travelling Governance and Development and Research Library Exhibitions Reporting Membership
Marketing and Registration Curatorial Finance Communications
Human Resource Commercial Conservation Publishing Management Operations
Information Facilities Technology and Management Imaging
104 APPENDIX 3 STAFF OF THE NATIONAL GALLERY OF AUSTRALIA AT 30 JUNE 2008
EXECUTIVE David Sharrock David Turnbull Zec Stefek Ronald Radford, Director Peter Vandermark Charles Summerell Hester Gascoigne Dominique Nagy, Manager, Jodie Tunks Rebecca Scott Travelling Exhibitions Ben Williams Alan Froud, Deputy Director Bronwyn Campbell Phillip Williams Kirsti Partridge Moses Gibson Erik Wilson Kate Murphy Svetlana Zec ADMINISTRATION Dean Marshall, Head of Sara Kelly, A/g Head of Registration Helen Gee, Manager, Governance Facilities Management Lesley Arjonilla and Reporting Astrid Bloxham Sam Bottari William Fleming, Major Project Yvonne Brown Mark Bradley Coordinator Sylvain Brudo Kate Buckingham Valerie Alfonzi Jose Campuzano Elizabeth Campbell Dermot Walsh, Chief Finance Officer Ramon Cabrera Tess Cashmore Mehran Akbari Myles Chandler Bruce Egan John Kearns Joye Dawe John Gryniewicz Anne Lupton David Eals Christopher Harman Rory McQuinn Larry Geraghty Deb Hill Kirsten Pace Sue Howland Adam Mann Trinity Poonpol Anthony Hughes Jane Marsden Barbara Reinstadler Paul Hulford Jan McKay John Santolin Michelle Izzard David McRoberts Zora Santrac Phillip Jeffries Phil Murphy Roberto Thomas Steve Jones Frank Navarro Tony Rhynehart, Head of Human Brendan Jordan Rebecca Nielson (on leave) Resource Management Len Kershaw Mary-Lou Nugent Phillip Harwood Michael Lawrence Ted Nugent Debra Luck Paula Leglise Aaron Pollock Janine Ossato Darrel Lord Jane Saker Manolita Ramsey Mark Mandy Joel Smith Joanne Sultana Mark Mayne Dominique Webb Helen Ward Frank Mayrhofer Debbie Ward, Head of Conservation Margaret Webber Gail McAllister Lisa Addison Andrew McLeod Shulan Birch EXHIBITIONS AND Gale Millwood Kassandra Coghlan COLLECTIONS SERVICES John O’Malley Catherine Collins Craig O’Sullivan Penny Fisher Adam Worrall, Assistant Director James Parker Micheline Ford Mark Bayly, A/g Head of Exhibitions Peter Petryk Thomasina Fox Pamela Bailey Patrick Pulbrook Scott Franks Emma Doy Kadrinka Ratajkoska Marc Gibson Lloyd Hurrell Brett Redfern Greg Howard Derek O’Connor Morrie Renton Andrew Kaminski Katrina Power Josip Rukavina Fiona Kemp Patrice Riboust Adele Ruzic Blaide Lallemand Salesi Tahi Eduardo Serrano Roy Marchant Ben Taylor
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 105 Cheree Martin Andrew Powrie Chantelle Woods Sarah McHugh Sarah Robinson (on leave) Carmella Mollica Erica Seccombe DEVELOPMENT, Jael Muspratt Kristin Thomas MARKETING AND Chandra Obie Anna (Anne) Gray, Head of COMMERCIAL Sheridan Roberts Australian Art and Senior Curator, Beata Tworek-Matuszkiewicz Australian Paintings and Sculpture OPERATIONS James Ward pre 1920 Shanthini Naidoo, Assistant Director Jane Wild Robert Bell, Senior Curator, Belinda Cotton, Head of Andrea Wise Decorative Arts and Design Development and Membership David Wise Roger Butler, Senior Curator, Frances Corkhill Stefanie Woodruff (on leave) Australian Prints, Drawings and Corrina Cullen Illustrated Books Irene Delofski CURATORIAL AND Brenda L Croft, Senior Curator, Joanne Tuck-Lee (on leave) EDUCATIONAL SERVICES Aboriginal and Torres Strait Maryanne Voyazis Islander Art Liz Wilson Simon Elliott, Assistant Director Christine Dixon, Senior Curator, Annalisa Millar, Executive Director, Lucy Davis International Painting and Foundation Peter Naumann, A/g Head of Sculpture Penny O’Hara %DUCATION 0UBLIC 0ROGRAMS Deborah Hart, Senior Curator, Alison Wright, Head of Marketing Adrianne Boag Australian Paintings and Sculpture and Communications Blythe Guilfoyle post 1920 Jenny Blake Trish Kevin Jane Kinsman, Senior Curator, Norma Davis Joanna Krabman International Prints, Drawings and Elizabeth Malone, Manager, Jenny Manning Illustrated Books Commercial Operations Rose Montebello Robyn Maxwell, Senior Curator, Daniel Bigna Christine Nicholas Asian Art Annette Connor Denise Officer Gael Newton, Senior Curator, Sue Greentree Egidio Ossato Photography Eleanor Kirkham Dorothy Rollins Jaklyn Babington (on leave) Steven Lawlis Katie Russell Melanie Beggs-Murray Patricia Maldon Joanne Walsh Tina Baum Gail Neuss Frances Wild Melanie Eastburn Annette Stefanou Edith Young Juliet Flook Eric Swain Joye Volker, Chief Librarian Lucie Folan Luke Marks, Head of IT and Imaging Kate Brennand Beatrice Gralton (on leave) Robert Cheeseman Kathleen Collins Mark Henshaw Donovan Fritz Jennifer Coombes Chris Haskett Lorraine Jovanovic Gillian Currie Gwen Horsfield Wilhelmina Kemperman Charmane Head Crispin Howarth Eleni Kypridis Helen Hyland Miriam Kelly Barry le Lievre Vicki Marsh Simeran Maxwell Brenton McGeachie Cheng Phillips Anne McDonald (on leave) Stephen Nebauer Samantha Pym Sarina Noordhuis-Fairfax David Pang Julie Donaldson, Head of Publishing Anne O’Hehir John Tassie Kaoru Alfonso (on leave) Emilie Owens Katherine Brennan Sophie Ross Rebecca Chandler Elena Taylor Carla Da Silva Pastrello (on leave) Lucinda Shawcross Eric Meredith Niki van den Heuvel Kirsty Morrison Alexandra Walton Nick Nicholson Lucina Ward
106 APPENDIX 4 ACQUISITIONS 2007–08
Aboriginal and Torres Mount Connor near Musgrave Strait Islander Art Australia 1925–2001 Ranges 1953–59 Burarra/Gun-nartpa peoples watercolour on paper DECORATIVE ARTS Djijarbuun and Djingabardabiya 1999 sheet 25.5 x 35.5 cm natural earth pigments on Gift of Gordon and Marilyn Darling, GREENO, Dulcie Arches paper celebrating the National Gallery of born Australia 1923 sheet 166.0 x 110.6 cm Australia’s 25th anniversary, 2008 Palawa people 2007.1271 2008.239 shell necklace 2007 Djijarbuun Dreaming 1999 Alice Springs country 1954 green mariner shells, white toothie natural earth pigment on watercolour on paper shells and black cats’ teeth on Arches paper sheet 35.5 x 51.5 cm cotton thread sheet 166.0 x 110.6 cm Gift of Gordon and Marilyn Darling, 95.0 x 2.5 cm 2007.1272 celebrating the National Gallery of 2008.74 Australia’s 25th anniversary, 2008 NAMATJIRA, Albert 2008.240 TIMBERRY, Esme Australia 1902–1959 Ghost gumm c.1945–53 born Australia 1931 Arrernte people watercolour on paper Bidjigal people Kangaroo 1936 sheet 41.0 x 31.0 cm Sydney Harbour Bridge 2007 watercolour on paper Gift of Gordon and Marilyn Darling, synthetic fabric, glitter, shells sheet 18.5 x 26.5 cm celebrating the National Gallery of (various), PVA glue and plain flour Gift of Gordon and Marilyn Darling, Australia’s 25th anniversary, 2008 on plywood celebrating the National Gallery of 2008.241 32.5 x 63.0 x 14.5 cm Australia’s 25th anniversary, 2008 Love’s Creek, MacDonnell Ranges 2007.789 2008.235 1945–53 Sydney Harbour Bridge 2007 Mount Giles 1938–39 watercolour and pencil on paper synthetic fabric, glitter, shells watercolour on paper sheet 37.0 x 36.0 cm (various), PVA glue and plain flour sheet 14.5 x 37.5 cm Gift of Gordon and Marilyn Darling, on plywood Gift of Gordon and Marilyn Darling, celebrating the National Gallery of 32.5 x 76.5 x 14.0 cm celebrating the National Gallery of Australia’s 25th anniversary, 2008 2007.821 Australia’s 25th anniversary, 2008 2008.242 2008.236 DRAWING Rocks at the turnoff, Hermannsburg Redbank Gorge, MacDonnell Ranges, Mission 1953–59 AH KEE, Vernon Central Australia 1936–37 watercolour on paper born Australia 1967 watercolour on paper sheet 24.8 x 35.8 cm Kuku Yalanji/Yidinji/Waanyi/Gugu sheet 27.5 x 25.0 cm Gift of Gordon and Marilyn Darling, Yimithirr peoples Gift of Gordon and Marilyn Darling, celebrating the National Gallery of Australia’s 25th anniversary, 2008 mythread 2007 celebrating the National Gallery of 2008.243 synthetic polymer paint, charcoal and Australia’s 25th anniversary, 2008 conte crayon on canvas 2008.237 Njirrakarpa, Finke River, James overall 177.0 x 720.0 cm River gum and Mount Gillen 1951 Ranges 1945–53 each 177.0 x 240.0 cm watercolour on paper watercolour and pencil on paper 2007.188.A–C sheet 34.5 x 34.0 cm sheet 27.5 x 37.0 cm Gift of Gordon and Marilyn Darling, Gift of Gordon and Marilyn Darling, celebrating the National Gallery of celebrating the National Gallery of Australia’s 25th anniversary, 2008 Australia’s 25th anniversary, 2008 2008.238 2008.244
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 107 Ghost gum, Glen Helen 1945–1959 OBJECT HAMM, Treahna watercolour on paper born Australia 1965 sheet 53.0 x 35.0 cm ADAMSON, Yilpi (Imiyari) Yorta Yorta people Gift of Gordon and Marilyn Darling, born Australia 1954 Yakapna yenbena dungudja celebrating the National Gallery of Pitjantjatjara people nyinidhan biganga [family ancestor Australia’s 25th anniversary, 2008 CARROLL, Alison strong fight opossum cloakk] and 2008.245 born Australia 1958 digging stick 2007 Quarritana, Finke River [Organ Pitjantjatjara people common brushtail possum pipes] 1945–53 CARROLL, Karen (Trichosurus vulpeculaa) skin pelts, watercolour on paper born Australia 1979 thread, natural earth pigments sheet 34.5 x 52.0 cm Pitjantjatjara people and wood Gift of Gordon and Marilyn Darling, MICK, Josephine 210.0 x 133.0 cm celebrating the National Gallery of born Australia 1955 2007.436.A–B Australia’s 25th anniversary, 2008 Pitjantjatjara people 2008.246 DAVEY, Malpiya UNKNOWN, MAKER born Australia 1959 BORN DIED UNKNOWN Kangaroo in landscape 1937 Pitjantjatjara people Rainforest people watercolour on paper RUPERT, Edna sheet 25.5 x 39.5 cm Untitled [Rainforest swordd] born Australia 1963 Gift of Gordon and Marilyn Darling, 19th century Pitjantjatjara people celebrating the National Gallery of wood Australia’s 25th anniversary, 2008 Kungkarangalpa munu wati Nyirunys 154.0 x 15.0 cm 2008.247 (The Seven Sisters and old man 2008.199 Nyiru) 2007 Monoliths, Palm Paddocks 1945–53 synthetic polymer paint on 8 PAINTING watercolour on paper terracota pots sheet 28.0 x 39.0 cm dimensions variable APUATIMI, Jean Baptiste Gift of Gordon and Marilyn Darling, 2007.1282.1–8 born Australia 1940 celebrating the National Gallery of Tiwi people Australia’s 25th anniversary, 2008 BROWN, Kunytjitja Yirrikamini 2007 2008.248 born Australia natural earth pigments on canvas The ancient ghost gum at Temple Bar Pitjantjatjara people 160.0 x 200.0 cm Station 1943 Travelling Ngintaka witj Tjiwa 2007 2007.189 watercolour on paper Minarri grass and wool sheet 27.5 x 38.5 cm 240.0 x 37.0 x 50.0 cm BATES, Tjapartji Gift of Gordon and Marilyn Darling, 2008.77 born Australia 1933 celebrating the National Gallery of Ngaanyatjarra people Australia’s 25th anniversary, 2008 DIXON, Anne Kungkarangkalpa 2007 2008.249 born Australia 1965 synthetic polmer paint on canvas Pitjantjatjara people 152.4 x 101.6 cm NAMATJIRA, Enos Not titled (basket) 2007 2008.73 Australia 1920–1966 Minarri grass, raffia, wool and Western Arrernte people emu feathers BELL, Richard not titled [Ghost gum, MacDonnell diameter top 24.0 cm born Australia 1953 Ranges] width at hem 1.0 cm Kamilaroi/Kooma/Jiman/Gurang watercolour on textured off-white 2008.76 Gurang peoples paper Psalm singing 2007 image and sheet 35.1 x 51.2 cm ENTATA, Irene Mbitjana synthetic polymer paint on canvas Gift of Margaret Pask, 2007 born Australia 1946 overall 240.0 x 350.0 cm 2007.942 Western Arrernte people each 240.0 x 175.0 cm Kaltjipuntjia (Babtism) 2007 2007.190.A–B synthetic polymer paint and Big brush stroke 2005 underglaze on terracotta pot synthetic polymer paint on canvas 37.0 x 24.0 cm overall 240.0 x 270.0 cm 2008.75.A–B each 240.0 x 90.0 cm 2007.204.A–C
108 BILLABONG, WILLY 72.0 x 62.5 cm Australia 1930–2005 PURAWARRUMPATU), Kitty Gift of John and Diana Coates, 2008 Kukatja people Australia 1926–2003 2008.2 Untitledd c.1999 Tiwi people Karritharr the Python 1978 synthetic polymer paint on canvas Untitled 1978 natural pigments on eucalyptus bark 64.6 x 64.2 cm natural earth pigments on bark 64.0 x 64.0 cm Gift of Toby Blyth, 2008 160.0 x 30.0 cm Gift of John and Diana Coates, 2008 2008.4 2008.200 2008.3 Untitledd c.1999 KNGALE, Kathleen NADJAMERREK, Lofty Bardayal synthetic polymer paint on canvas born Australia 1931 born Australia 1926 54.0 x 54.0 cm Anmatyerr people Kundedjnjenghmi people Gift of Toby Blyth, 2008 2008.5 Bush Plum 2007 Kurdukadj (Emu) 2004 synthetic polymer paint on canvas natural earth pigments on paper BOYD, Daniel 152.0 x 305.0 cm 150.0 x 105.0 cm born Australia 1982 Gift of Donald and Janet Holt and 2007.197 Kudjla/Gangalu peoples family, 2008 NAKAMARRA, Doreen Reid King No Beard 2007 2008.187 born Australia 1948 oil on canvas KURLTJUNYINTJA GILES, Jackie Pintupi/Ngaatjatjarra peoples 290.7 x 178.9 cm born Australia 1944 2007.191 Untitled 2007 Pintupi/Ngaanyatjarra peoples synthetic polymer paint on canvas EBATERINJA, Walter Untitled 2007 183.0 x 244.0 cm Australia 1915–1968 synthetic polymer paint on canvas 2007.198 Western Arrernte people 152.0 x 152.0 cm NAPURRULA, Josephine Alice Springs from Anzac Hilll c.1950 2008.198 born Australia 1948 watercolour on paper MARIKA, Milirrpum Pintupi people 39.0 x 57.0 cm Australia 1925–1983 2007.353 Untitled 2007 Rirratjingu people synthetic polymer paint on canvas GRANT, Fred Djanda with bush turkey, dingo at 137.0 x 183.0 cm born Australia 1946 sacred waterholee c.1972 2007.384 Pitjantjatjara people natural earth pigments on bark ANDERSON, Jerome 100.0 x 35.0 cm NGAL, Angelina born Australia 1940 2008.202 (also known as PWERLE NGALE, Pitjantjatjara people Angelina) RICTOR, Ian MAWURNDJUL, John born Australia 1951 born Australia 1962 born Australia 1952 Alyawarr people Pitjantjatjara people Kuninjku (eastern Kunwinjku) people Bush plum Arlparra Country 2005 Wati Tjutaku 2007 Mardayin at Milmilngkan 2006 synthetic polymer paint on canvas synthetic polymer paint on canvas natural earth pigments on stringybark 121.0 x 200.0 cm 160.0 x 196.0 cm 180.0 x 52.0 cm Gift of Lauraine Diggins, 2008 2008.72 2007.195 2008.186 Mardayin design at Dilebang 2006 NJIMINJUMA, Jimmy HOOKEY, Gordon natural earth pigments on stringybark Australia 1947–2004 born Australia 1961 200.0 x 47.0 cm Eastern Kunwinjku people Waanyi/Waanjiminjin peoples 2007.196 FIGHT: To Survive, To Live; To Die! Wak Wak 2002 2007 MILPURRURRU, George natural earth pigments on bark oil on canvas Australia 1934–1998 172.0 x 70.0 cm overall 240.0 x 603.70 cm Ganalbingu people 2008.201 2007.437.A–D Flying Fox Dreaming 1978 natural earth pigments on kapok wood
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 109 PAMBEGAN JNR, Arthur Koo’ekka synthetic polymer paint on canvas John 2005 born Australia 1936 200.0 x 160.0 cm Giclée print on Hahnemühle paper Wik Mungkan people 2008.119 79.14 x 51.5 cm Untitled XXVI [Walkan-aw and 2007.381 TJAKAMARRA, Anatjari No.III Kalben designs] 2008 Jeulisa 2005 Australia 1938–1992 natural earth pigment with synthetic Giclée print on Hahnemühle paper Pintupi people polymer paint binder and paint on 79.14 x 51.5 cm canvas Untitled (Wallaby Story) 1972 2007.382 synthetic polymer paint on 76.0 x 66.0 cm Murray 2005 composition board 2008.120 Giclée print on Hahnemühle paper 45.5 x 61.0 cm 79.14 x 51.5 cm PAREROULTJA, Otto 2007.351 2007.383 Australia 1914–1993 Western Arrernte people TJUPURRULA, Turkey TOLSON PRINT Australia 1938–2001 Aranda Landscapee c.1960s Luritja/Warlpiri peoples watercolour and pencil on paper DOOLAN, Christine 53.0 x 73.0 cm Mitukatjirri 1986 Australia, active 2004 2007.349 synthetic polymer paint on canvas Eastern Arrernte people 181.5 x 121.5 cm Urewenhe Station 2004 POSSUM TJAPALTJARRI, Clifford 2007.350 screenprint, printed in colour, from Australia 1932–2002 multiple stencils on paper WANAMBI, Boliny Anmatyerre/Arrernte peoples image 19.0 x 29.7 cm born Australia 1957 Warlugulong 1977 sheet 28.0 x 38.0 cm Marrakulu/Dhurili peoples synthetic polymer paint on canvas Gordon Darling Australia Pacific 202.0 x 337.5 cm Yanawul 2007 Print Fund, 2007 Purchased with the generous natural earth pigments on stringybark 2007.1147 assistance of Roslynne Bracher and 155.0 x 53.5 cm the Paspaley Family, David Coe and 2007.909 DOOLAN, Ruby Michelle Coe, Charles Curran and Australia, active 2004 Eva Curran, 2007 WATSON, Judy Eastern Arrernte people born Australia 1959 2007.200 Nanny Goat at Bonya 2004 Waanyi people screenprint, printed in colour, from PWERLE NGALE, Angelina palm cluster 2007 multiple stencils on paper born Australia 1951 pigment, pastel, synthetic polymer image 19.5 x 28.6 cm Alyawarr people paint and carbon ink on canvas sheet 28.0 x 38.0 cm Bush Plum 2005 196.0 x 106.0 cm Gordon Darling Australia Pacific synthetic polymer paint on canvas 2007.201 Print Fund, 2007 127.0 x 327.0 cm 2007.1150 YUNUPINGU, Gulumbu 2008.197 born Australia 1943 Emu Walking Around on Nice Green Country 2005 STEVENS, Kunmanara Gumatj/Rrakpala peoples screenprint, printed in colour, from Australia 1919–2008 Garak the Universe 2007 multiple stencils on paper Pitjantjatjara people natural earth pigments on stringybark image 29.6 x 19.3 cm 233.0 x 99.5 x 9.5 cm Piltati Tjukurpa 2006 sheet 38.0 x 28.0 cm 2007.1280 synthetic polymer paint on canvas Gordon Darling Australia Pacific 136.0 x 200.0 cm PHOTOGRAPHY Print Fund, 2007 2007.1281 2007.1151
STOKES, Joan Nancy JONES, Dianne Atnarpa Station 2004 born Australia 1961 born Australia 1966 screenprint, printed in colour, from Anmatyerr people Nyoongar people multiple stencils on paper image 19.5 x 29.6 cm The Overseer and the Black Stockman Kirsty 2005 sheet 28.0 x 38.0 cm 2007 Giclée print on Hahnemühle paper 79.14 x 51.5 cm Gordon Darling Australia Pacific 2007.380 Print Fund, 2007 2007.1159
110 GOREY, Lorrayne HALL, Basil (printer) Australia, active 2004 Australia, active 2004 born Australia 1954 Horse Breaking at Santa Teresa 2004 Arrernte people DIGGENS, Jo (printer) screenprint, printed in colour, from Orange creek station 2004 born Australia 1952 multiple stencils on paper screenprint, printed in colour, from NORTHERN EDITIONS PRINT image 19.2 x 29.5 cm multiple stencils on paper WORKSHOP (print workshop) sheet 28.0 x 38.0 cm image 29.6 x 19.5 cm Rainbow Serpent Gordon Darling Australia Pacific sheet 38.0 x 28.0 cm etching, printed in colour from Print Fund, 2007 Gordon Darling Australia Pacific multiple plates on thick cream wove, 2007.1163 Print Fund, 2007 Hahnemühle 350 gsm paper 2007.1144 image 49.5 x 66.0 cm HOCKLEY, Jonathan Limbla Station 2004 sheet 69.0 x 84.0 cm Australia, active 2004 screenprint, printed in colour, from Gordon Darling Australia Pacific Raging Bulls 2004 multiple stencils on paper Print Fund, 2008 screenprint, printed in colour, from image 19.4 x 29.4 cm 2008.86 multiple stencils on paper sheet 28.0 x 38.0 cm NADJAMERREK, Lofty Bardayal image 25.8 x 17.6 cm Gordon Darling Australia Pacific born Australia 1926 sheet 38.0 x 28.0 cm Print Fund, 2007 Kundedjnjenghmi people Gordon Darling Australia Pacific 2007.1166 Print Fund, 2007 KING, Martin (printer) Nanny Goats at Bonya 2004 2007.1158 born Australia 1957 screenprint, printed in colour, from AUSTRALIAN PRINT WORKSHOP The Long Drought 2004 multiple stencils on paper (print workshop) screenprint, printed in colour, from image 19.4 x 28.5 cm established Australia 1989 multiple stencils on paper sheet 28.0 x 38.0 cm Namarrkon [Lightning spiritt] 2000 image 29.5 x 19.0 cm Gordon Darling Australia Pacific lithograph, printed in black ink, from sheet 38.0 x 28.0 cm Print Fund, 2007 one stone on paper Gordon Darling Australia Pacific 2007.1167 Print Fund, 2007 image 54.0 x 36.0 cm 2007.1164 LOWAH, William sheet 76.0 x 56.0 cm Australia, active 2005 Gordon Darling Australia Pacific JOBLING, Winsome Print Fund, 2008 Smoko 2005 born Australia 1957 2008.87 screenprint, printed in colour, from BASIL HALL EDITIONS multiple stencils on paper (print workshop) NAMOK, Rosella image 16.2 x 19.0 cm born Australia 1979 The wet 2006 sheet 38.0 x 28.0 cm Ungkum (Angkum) people etching, printed in colour, from six Gordon Darling Australia Pacific BASIL HALL EDITIONS plates on thick off-white laid paper Print Fund, 2007 (print workshop) plate-mark 33.5 x 25.4 cm 2007.1152 sheet 48.0 x 39.8 cm Blue water 2005 Gordon Darling Australia Pacific MCMILLAN, Cynthia from the series Top end. A limited Print Fund, 2008 Australia, active 2004 edition portfolio of two prints etching, printed in colour, from 2008.165 Horse Trough Santa Teresa 2004 multiple plates on thick off-white laid screenprint, printed in colour, from KENNY, Josephine paper multiple stencils on paper Australia, active 2004 plate-mark 47.4 x 67.4 cm image 29.6 x 18.9 cm sheet 56.0 x 76.5 cm Dinner Camp 2004 sheet 38.0 x 28.0 cm Gordon Darling Australia Pacific screenprint, printed in colour, from Gordon Darling Australia Pacific Print Fund, 2008 multiple stencils on paper Print Fund, 2007 2008.167 image 14.5 x 24.0 cm 2007.1153 sheet 28.0 x 38.0 cm Gordon Darling Australia Pacific NADJAMERREK, Lofty Bardayal Print Fund, 2007 born Australia 1926 2007.1165 Kundedjnjenghmi people
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 111 NAPANGARDI JONES, Peggy NONA, Dennis Gordon Darling Australia Pacific born Australia 1951 born Australia 1973 Print Fund, 2008 Warlpiri people Kala Lagaw Ya people 2008.168 BASIL HALL EDITIONS TREMBLAY, Theo (printer) Not titled [leaves 2] 2005 (print workshop) born United States of America 1952 etching, printed in colour with plate Two birds 2007 Australia from 1977 tone, from one plate on thick yellow etching, printed in colour, from EDITIONS TREMBLAY NFP wove Hahnemühle paper multiple plates on thick white wove (print workshop) plate-mark 29.5 x 24.5 cm paper established 1984 sheet 50.4 x 39.4 cm plate-mark 33.6 x 23.0 cm Baidam 2006 Gordon Darling Australia Pacific sheet 56.0 x 38.0 cm linocut, printed in black ink, from Print Fund, 2008 Gordon Darling Australia Pacific one block on white Saunders 2008.169 Print Fund, 2008 Waterford CP 300 gsm paper Not titled [leaves 3] 2003 2008.163 image 94.0 x 235.0 cm etching, printed in colour with plate Yellow bird 2007 sheet 106.0 x 239.0 cm tone, from one plate on thick off- etching, printed in colour, from Gordon Darling Australia Pacific white laid paper multiple plates on thick white wove Print Fund, 2007 plate-mark 68.6 x 47.4 cm paper 2007.416 sheet 96.4 x 69.2 cm plate-mark 33.4 x 22.2 cm Ara 2006 Gordon Darling Australia Pacific sheet 56.0 x 38.0 cm linocut, printed in black ink, from Print Fund, 2008 Gordon Darling Australia Pacific one block on white Saunders 2008.170 Print Fund, 2008 Waterford CP 300 gsm paper Not titled [awelye] 2003 2008.164 image 90.0 x 240.0 cm etching, printed in colour with plate sheet 106.0 x 253.0 cm tone, from one plate on thick yellow NONA, Dennis Gordon Darling Australia Pacific wove paper born Australia 1973 Print Fund, 2007 plate-mark 29.8 x 24.5 cm Kala Lagaw Ya people 2007.417 sheet 50.2 x 39.8 cm HALL, Basil (printer) Gordon Darling Australia Pacific born Australia 1954 ORSTO, Jimmy Print Fund, 2008 BASIL HALL EDITIONS born Australia 1972 2008.171 (print workshop) Tiwi people Sarup Au Zig 2005, April NORTHERN EDITIONS PRINT RUPERT, Nura etching, printed in colour, from one WORKSHOP (print workshop) born Australia 1933 plate on white Hahnemühle paper Off to the footy match 2003 Pitjantjatjara people plate-mark 81.0 x 128.0 cm etching, printed in blue ink from one BASIL HALL EDITIONS sheet 96.0 x 139.0 cm plate on warm white Hahnemühle (print workshop) Gordon Darling Australia Pacific paper Kalaya tjuta (many emus) 2007 Print Fund, 2007 image 24.6 x 24.4 cm etching, printed in colour, from 2007.415 sheet 39.6 x 36.8 cm three plates on thick off-white wove Gordon Darling Australia Pacific Hahnemühle paper NONA, Dennis Print Fund, 2008 plate-mark 32.2 x 24.6 cm born Australia 1973 2008.83 sheet 53.8 x 39.4 cm Kala Lagaw Ya people Gordon Darling Australia Pacific TREMBLAY, Theo (printer) PETYARR, Gloria Tamerr Print Fund, 2008 born United States of America 1952 born Australia 1938 2008.161 Australia from 1977 Anmatyerre people Tjulpu parpakani (flying birds) 2007 Yarwarr 2007 BASIL HALL EDITIONS etching, printed in colour, from linocut, printed in colour, from one (print workshop) three plates on thick off-white wove block on off-white Hahnemühle Not titled [leaves 1] 2003 Hahnemühle paper paper etching, printed in colour with plate plate-mark 32.4 x 24.6 cm image 119.5 x 599.5 cm tone, from one plate on thick off- sheet 53.6 x 39.4 cm sheet 122.5 x 610.0 cm white laid paper Gordon Darling Australia Pacific Gift of Janet and John Calvert-Jones, plate-mark 29.7 x 24.4 cm Print Fund, 2008 2007 sheet 51.4 x 40.0 cm 2008.162 2007.439
112 TURNER, Amanda Anne VARIOUS INDIGENOUS ARTISTS Australia, active 2004 Gordon Darling Australia Pacific GOHIER, Franck (printer) Roping Calf 2004 Print Fund, 2007 born France 1968 screenprint, printed in colour, from 2007.1162 Australia from 1972 multiple stencils on paper A collection of 157 prints printed by TURNER, Margaret Kemarre image 16.4 x 29.5 cm Franck Gohierr 1993–2004 Australia, active 2004 sheet 28.0 x 38.0 cm Gordon Darling Australia Pacific Gordon Darling Australia Pacific Back to One Gum 2004 Print Fund, celebrating the Print Fund, 2007 screenprint, printed in colour, from National Gallery of Australia’s 25th 2007.1156 multiple stencils on paper anniversary, 2007 image 29.4 x 19.0 cm Dinner Camp 2005 2007.433–2007.599 sheet 38.0 x 28.0 cm screenprint, printed in colour, from Gordon Darling Australia Pacific VARIOUS INDIGENOUS ARTISTS multiple stencils on paper Print Fund, 2007 KEMPSON, Michael (printer) image 19.3 x 29.5 cm 2007.1145 born Australia 1961 sheet 28.0 x 38.0 cm CICADA PRESS (print workshop) Gordon Darling Australia Pacific The Day is Done 2004 established Australia 2003 Print Fund, 2007 screenprint, printed in colour, from 2007.1157 multiple stencils on paper A collection of 47 prints printed by image 16.5 x 26.0 cm Michael Kempsonn 2003–2007 TURNER, Amelia sheet 28.0 x 38.0 cm Gordon Darling Australia Pacific Australia, active 2004 Gordon Darling Australia Pacific Print Fund, celebrating the Bull Catching at Yambah Station 2004 Print Fund, 2007 National Gallery of Australia’s 25th screenprint, printed in colour, from 2007.1154 anniversary, 2007 multiple stencils on paper Washing Day at One Gum 2004 2007.1549 image 17.5 x 29.0 cm screenprint, printed in colour, from VARIOUS INDIGENOUS ARTISTS sheet 28.0 x 38.0 cm multiple stencils on thick off-white RAWLING, Larry (printer) Gordon Darling Australia Pacific wove paper born Australia 1938 Print Fund, 2007 image 29.5 x 19.0 cm LARRY RAWLING PRINT 2007.1148 sheet 38.2 x 28.4 cm WORKSHOP (print workshop) Gordon Darling Australia Pacific Top Bore, Yamba Station 2004 established Australia 1984 screenprint, printed in colour, from Print Fund, 2007 A collection of 23 screenprints multiple stencils on paper 2007.1155 printed by Larry Rawling 1966–2007 image 18.8 x 29.7 cm TURNER, Shirley Purchased with the assistance sheet 28.0 x 38.0 cm Australia, active 2004 of the Gordon Darling Australia Gordon Darling Australia Pacific Alyawarr people Pacific Print Fund, celebrating the Print Fund, 2007 National Gallery of Australia’s 25th 2007.1149 Bull Riding at Sandy Bore 2004 screenprint, printed in colour, from anniversary, 2008 TURNER, Cathy multiple stencils on paper 2008.94 Australia, active 2004 image 16.4 x 21.0 cm WATSON, Judy sheet 28.0 x 38.0 cm Santa Teresa Mustering 2004 born Australia 1959 Gordon Darling Australia Pacific screenprint, printed in colour, from Waanyi people Print Fund, 2007 multiple stencils on paper BASIL HALL EDITIONS 2007.1146 image 21.0 x 30.0 cm (print workshop) sheet 28.0 x 38.0 cm Untitled [horse shoe] 2004 sand palm/resistance 2006 Gordon Darling Australia Pacific screenprint, printed in colour, from etching, printed in colour, from three Print Fund, 2007 multiple stencils on paper plates on thick off-white laid paper 2007.1161 image 29.5 x 21.2 cm plate-mark 32.8 x 24.8 cm sheet 38.0 x 28.0 cm G Cavanagh – in the yard at sheet 48.6 x 40.0 cm Gordon Darling Australia Pacific Ambalindum 2004 Gordon Darling Australia Pacific Print Fund, 2007 screenprint, printed in colour, from Print Fund, 2008 2007.1160 multiple stencils on paper 2008.159 image 19.1 x 29.8 cm
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 113 sand palm/resilience 2006 Hahnemühle paper SCULPTURE etching, printed in colour, from two image 24.7 x 16.8 cm plates on thick off-white laid paper sheet 39.4 x 35.4 cm BELL, Jack plate-mark 32.8 x 24.8 cm Gordon Darling Australia Pacific born Australia 1950 sheet 48.6 x 40.0 cm Print Fund, 2007 Wik Mungkan/Apelech peoples Gordon Darling Australia Pacific 2007.1302 Camp dog 2005 Print Fund, 2008 rainy heart country 2000 natural earth pigments, synthetic 2008.160 etching, printed in colour, from polymer paint on Milkwood multiple plates on cream wove 37.0 x 73.0 x 21.0 cm WATSON, Judy Hahnemühle paper 2007.1278 born Australia 1959 image 33.0 x 24.5 cm KING, Martin (printer) sheet 53.6 x 39.8 cm GUDTHAYKUDTHAY, Philip born Australia 1957 Gordon Darling Australia Pacific born Australia 1923 Waanyi people Print Fund, 2007 Liyagalawumirr people AUSTRALIAN PRINT WORKSHOP 2007.1303 Gunyunmirringa (landscape) 2007 (print workshop) natural earth pigments on hollow log established Australia 1989 vessel 2000 etching, printed in colour, from 106.0 x 11.5 cm, 33.8 cm (diam.) shell midden, swan lagoon 2005 multiple plates on cream wove 2007.192 etching, printed in colour, from two Hahnemühle paper plates on thick off-white Velin Arches GUMANA, Malaluba image 45.4 x 31.6 cm paper born Australia 1952 sheet 66.6 x 50.6 cm image 48.0 x 35.5 cm Dhalwangu/Nungburundi peoples Gordon Darling Australia Pacific sheet 76.0 x 56.0 cm Print Fund, 2007 Garrimala [Hollow logg] 2006 Gordon Darling Australia Pacific 2007.1304 natural pigments on wood Print Fund, 2008 281.0 cm fruit and seeds 2 2000 2008.156 The Rotary Collection of Australian etching, printed in black ink, from Art Fund 2007, in memory of WATSON, Judy one plate; chine collé on cream Philip McElligott AM, MBA, and in born Australia 1959 Hahnemühle paper celebration of the National Gallery of Waanyi people image 24.7 x 16.8 cm Australia’s 25th anniversary NORTHERN EDITIONS PRINT sheet 39.0 x 35.4 cm 2007.1276 WORKSHOP (print workshop) Gordon Darling Australia Pacific fruit and seeds 1 2000 Print Fund, 2007 KANTILLA (KUTUWALUMI etching, printed in black ink, from 2007.1305 PURAWARRUMPATU), Kitty one plate and chine colle on cream Australia 1926–2003 YUNUPINGU, Gulumbu wove Hahnemühle paper Tiwi people born Australia 1943 image 24.7 x 16.8 cm Gumatj/Rrakpala peoples Untitledd c.1980 sheet 39.2 x 35.4 cm BASIL HALL EDITIONS natural earth pigments on ironwood Gordon Darling Australia Pacific (print workshop) 67.5 cm Print Fund, 2007 2007.352 2007.1300 Gan’yu (stars) 2005 from the series dispersal 2000 KOOMEETA, Craig etching, printed in black ink, from Top end. A limited edition portfolio born Cape York Peninsula. Australia one plate chine collé on cream of two prints 1977 Hahnemühle paper etching and silkscreen, printed in Wik-Alkan people image 24.8 x 16.8 cm brown ink, from one plate and one Neetin [The Rainboww] Dingo 2005 sheet 39.4 x 35.6 cm screen on thick cream laid paper natural earth pigments, synthtic Gordon Darling Australia Pacific plate-mark 67.5 x 47.5 cm polymer paint on Milkwood Print Fund, 2007 sheet 76.6 x 56.6 cm 40.0 x 66.0 x 17.0 cm 2007.1301 Gordon Darling Australia Pacific 2007.1277 Print Fund, 2008 fruit and seeds 3 2000 2008.166 etching, printed in black ink, from one plate chine collé on cream wove
114 MAYMURU-WHITE, Naminapu TEXTILE born Australia 1952 Anindilyakwa people Manggalili people Not titled [canoe] 1965 ARTIST, Unknown Milngiyawuy [Hollow logg] 2006 natural earth pigment on wood, Utopia Community natural earth pigments on wood natural string and wood Untitled 1987 320.0 cm 23.5 x 133.0 x 16.5 cm dyes on cotton fabric (batik) 2007.1274 2008.234.1–7 90.0 x 90.0 cm Milngiyawuy [Hollow logg] 2006 2008.124 YALANDJA, Owen natural earth pigmetns on wood Untitled 1987 born Australia 1962 252.0 cm dyes on cotton fabric (batik) Dangkorlo clan 2007.1275 90.0 x 90.0 cm Yawk yawk 2007 2008.125 MELLOR, Danie natural earth pigment and PVA Untitled 1987 born Australia 1971 fixative on Kurrajong (Brachychiton dyes on cotton fabric (batik) Mamu/Ngagen/Ngajan peoples diversifolius) 90.0 x 90.0 cm 332.0 x 37.0 cm (diam.) £5 of culture 2007 2008.126 metal 2007.202 Untitled 1987 88.1 x 43.0 cm Yawk yawk 2007 dyes on cotton fabric (batik) 2008.67 natural earth pigment and PVA 90.0 x 90.0 cm fixative on Kurrajong (Brachychiton In memory (absentia) 2007 2008.127 metal diversifolius) Untitled 1987 77.2 x 36.0 cm 225.0 x 14.3 cm (diam.) dyes on cotton fabric (batik) 2008.68 Gift of Janet and John Calvert-Jones, 2008 90.0 x 90.0 cm Of dreams the parting 2007 2008.121 2008.128 metal Untitled 1987 82.6 x 41.0 cm Yawk yawk 2007 dyes on cotton fabric (batik) 2008.69 natural earth pigment and PVA fixative on Kurrajong (Brachychiton 90.0 x 90.0 cm The heart’s tale 2007 diversifolius) 2008.129 metal 240.0 x 15.8 cm (diam.) Untitled 1987 87.0 x 43.0 cm Gift of Janet and John Calvert-Jones, dyes on cotton fabric (batik) 2008.70 2008 90.0 x 90.0 cm The biggest yet 2007 2008.122 2008.130 metal Yawk yawk 2007 Untitled 1987 136.6 x 66.6 cm natural earth pigment and PVA dyes on cotton fabric (batik) 2008.71 fixative on Kurrajong (Brachychiton 90.0 x 90.0 cm 2008.131 NONA, Dennis diversifolius) born Australia 1973 280.0 x 16.7 cm (diam.) Untitled 1987 Kala Lagaw Ya people Gift of Janet and John Calvert-Jones, dyes on cotton fabric (batik) 2008 90.0 x 90.0 cm Apu Kaz (Mother and baby Dugong) 2008.123 2008.132 2007 bronze YUNKAPORTA, Roderick Untitled 1987 each 55.0 x 70.0 cm, 200.0 cm (diam.) born Australia 1948 dyes on cotton fabric (batik) each 25.0 x 25.0 cm, 80.0 cm (diam.) Wik Mungkan/Apelech peoples 90.0 x 90.0 cm 2007.199.A–B 2008.133 Mother camp dog 2006 Ubirikubiri 2007 natural earth pigments, synthetic Untitled 1987 bronze and pearlshell polymer paint on Milkwood dyes on cotton fabric (batik) overall 110.0 x 360.0 x 120.0 cm 46.0 x 84.0 x 17.0 cm 90.0 x 90.0 cm Gift of Janet and John Calvert-Jones, 2007.1279 2008.134 2007 Untitled 1987 2007.438 dyes on cotton fabric (batik) 90.0 x 90.0 cm 2008.135
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 115 Untitled 1987 Asian Art PHILIPPINES dyes on cotton fabric (batik) 90.0 x 90.0 cm DRAWING Bontoc people 2008.136 Luzon IRAN Untitled 1987 Rice basket dyes on cotton fabric (batik) rattan Safavid dynasty (1501–1722) 90.0 x 90.0 cm 33.7 x 32.5 x 66.5 cm 2008.137 Two pages from the Qur’an mid 16th Gift of the President of the – early 18th century Untitled 1987 Philippines HE Gloria Macapagal- ink, gold leaf on paper dyes on cotton fabric (batik) Arroyo, 2007 30.0 x 60.0 cm 90.0 x 90.0 cm 2007.226 Gift of Nasser Palangi, 2008 2008.138 2008.192.1–2 PAINTING Untitled 1987 dyes on cotton fabric (batik) OBJECT INDIA 90.0 x 90.0 cm 2008.139 BRUNEI Nathdvara Rajasthan Untitled 1987 Malay people dyes on cotton fabric (batik) Autumn moon festival [sharad 90.0 x 90.0 cm Pair of royal ceremonial lustration purnimaa]; shrine hanging [pichhavaii] 2008.140 bowls [timba bersiram] late 19th – 18th century early 20th century watercolour and gold on cotton Untitled 1987 silver 220.0 x 170.0 cm dyes on cotton fabric (batik) 13.9 x 25.5 cm Acquired with the assistance of the 90.0 x 90.0 cm 2008.214.1–2 Masterpieces for the Nation Fund, 2008.141 2008 BURMA Untitled 1987 2008.88 dyes on cotton fabric (batik) Festival of Nanda [Nanda 90.0 x 90.0 cm Burmese people mahotsavaa]; shrine hanging 2008.142 Mandalay [pichhavaii] early 20th century Leaf from a Kammavaca manuscript Untitled 1987 watercolour on cotton 19th century dyes on cotton fabric (batik) 218.0 x 163.0 cm lacquer, gold leaf, cloth 90.0 x 90.0 cm 2008.215 2008.143 11.0 x 55.0 cm Estate of the late Peter Russell Untitled 1987 VIETNAM 2008.193 dyes on cotton fabric (batik) Truong Tan 90.0 x 90.0 cm INDONESIA 2008.144 born Vietnam 1963 Untitled 1987 Malay people Untitled 1997 dyes on cotton fabric (batik) Riau-Lingga archipelago Chinese ink and gouache on rice paper 90.0 x 90.0 cm Lidded bowl [mangkuk bertudungg] 52.0 x 70.0 cm 2008.145 late 19th – early 20th century Gift of Yvon Gatineau and Peter Untitled 1987 silver-copper alloy Jackson dyes on cotton fabric (batik) 13.9 x 25.4 cm 2007.770 90.0 x 90.0 cm 2008.213.A–B 2008.146 MALAYSIA PRINT CHINA Malay people Perak Wenda Gu Ceremonial spittoon [ketur perakk] born China 1955 19th century Rubbing from Forest of stone steles: silver RETRANSLATION REWRITING OF 4ANG 12.6 x 21.3 cm poem no.1 2001 2007.423
116 ink on Chinese rice paper PHILIPPINES 178.0 x 97.0 cm south Sulawesi Gift of Wenda Gu Roof finial 19th century Bicol region 2008.176 wood Luzon 148.0 x 34.0 x 32.0 cm San Antonio de Padua 19th century JAPAN Gift of Robert Vanderstukken in molave wood 48.3 x 22.5 x 15.5 cm Tsukioka Yoshitoshi memory of An Polos and Yamin Gift of the President of the Japan 1839–1892 Makawaru, 2008 2008.191 Philippines HE Gloria Macapagal- Thirty-two aspects of female customs Arroyo, 2007 and manners [Fuzoku sanjuniso] Central Java period (8th–11th 2007.220 1888 centuries) colour woodblock print Java Bohol 38.0 x 24.0 cm Kala mid 9th century central Visayas The Poynton Bequest, 2008 stone Madonna of the Immaculate 2008.183.1–33 26.5 x 42.0 x 24.0 cm Conception 19th century molave wood Yukawa Shodo 2008.231 43.2 x 14.5 x 12.0 cm born Japan 1868 – died Japan Ngaju people Gift of the President of the Beauty posing for a photograph Kalimantan Philippines HE Gloria Macapagal- 1901–03 Hornbill spirit or soul boat Arroyo, 2007 from the series One hundred beauties 19th century 2007.221 depicting modern and ancient wood manners 18.0 x 88.0 x 10.0 cm TEXTILE colour woodblock print 2008.230 36.0 x 25.0 cm BHUTAN The Poynton Bequest, 2007 Sumbawa 2007.1531 Bhutanese people Grave marker 19th century Woman’s wrap skirt [kira ngoshem] stone SCULPTURE c.1975 93.6 x 21.45 x 5.5 cm cotton, silk, natural dyes; 2008.212 INDIA supplementary weft weaving, supplementary warp weaving Chola dynasty (9th–13th centuries) MADAGASCAR 265.0 x 159.0 cm Tamil Nadu Mahafaly people Gift of Catherine and David Harris, Shiva as Lord of the Dance [Natarajaa] south Madagascar 2008 11th–12th century 2008.65 bronze Burial post [aloalo] 19th century wood 128.5 x 106.0 x 40.0 cm Phub Bidha 235.0 x 20.0 x 10.0 cm Purchased with the assistance of active Thimpu from 1960 2008.184 the National Gallery of Australia Gaki Om Dorji Foundation, 2008 MALAYSIA active Thimpu from 1990 2008.1 Woman’s skirt wrap [kira mentse Iban people INDONESIA martha shinglochem] c.2000 Sarawak cotton, silk, metallic thread; Bahau people Effigy of a hornbill [kenyalangg] supplementary warp weaving, Kalimantan 19th century supplementary weft weaving 274.0 x 159.0 cm Funerary figure [hampatongg] wood Gift of Catherine and David Harris, 1300–68 36.0 x 95.0 cm 2008 wood 2008.229 2008.66 114.0 x 18.0 x 18.0 cm 2008.108
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 117 INDIA Man’s loincloth [dinonggas] probably Ferghana Valley 19th century Wall hanging [pardahh] late 19th – Mochi people cotton, glass beads; supplementary early 20th century Kutch, Gujarat weaving, embroidery silk, printed cotton lining; warp ikat Shawl 19th century 231.0 x 13.0 cm 240.0 x 125.0 cm silk, cotton; embroidery Gift of the President of the 2008.226 170.0 x 170.0 cm Philippines HE Gloria Macapagal- Gift of Neville Black for Molly and Arroyo, 2007 Samarkand or Bukhara Shani, 2008 2007.225 Wall hanging [pardahh] late 19th – 2008.177 early 20th century Subanen people silk, printed cotton lining; warp ikat Mindanao INDONESIA 242.0 x 186.0 cm Woman’s skirt [gampekk] early 2008.227 Adjie Notonegoro 20th century born Jakarta 1961 banana fibre [abaca], natural dyes; Turkmen people Ceremonial ensemblee c.2007 warp ikat Group of women’s mantles [chyrpyy] cotton, beads; hand-drawn batik, 82.5 x 63.0 cm 1950–1960 appliqué Gift of the President of the silk, cotton; kesdi stitch embroidery, Gift of Adjie Notonegoro, 2007 Philippines HE Gloria Macapagal- braid, fringing 2007.435.1–3 Arroyo, 2007 each approx. 110.0 x 60.0 cm 2007.222 2008.216–2008.224 MALAYSIA Tagakaolo people Uzbek people Iban people Mindanao probably Tashkent Sarawak Woman’s skirt [panapisan or kisii] Wall hanging [suzanii] 1850–1900 Ceremonial cloth [pua kumbuu] early 20th century silk, cotton, printed cotton lining; 19th century banana fibre [abaca], natural dyes; embroidery: chain stitch, couching hand-spun cotton, natural dyes; warp warp ikat 280.0 x 270.0 cm ikat 144.0 x 88.0 cm 2008.228 233.7 x 128.3 cm Gift of the President of the 2007.424 Philippines HE Gloria Macapagal- VIETNAM Ceremonial cloth [pua kumbuu] Arroyo, 2007 19th century 2007.223 Gia Rai people hand-spun cotton, natural dyes; warp Loincloth [toaii] early 20th century SRI LANKA ikat cotton, natural dyes, Job’s tears 215.9 x 121.9 cm seeds; supplementary weft weaving, Tamil people 2007.425 appliqué Wedding sari [koraa] early 1940s 36.0 x 457.0 cm PHILIPPINES silk, metallic thread; supplementary Gift of Jonathan Hope, 2007 weft brocade 2007.731 Gaddang people 500.0 x 114.0 cm Luzon Gift of Peggy Muttukumaru, 2008 Woman’s jacket [ao] 20th century cotton, natural dyes; supplementary Woman’s skirt [aken] early 2008.178 warp weaving, buttonhole stitch, 20th century embroidery cotton, glass beads; embroidery, UZBEKISTAN 38.0 x 116.0 cm supplementary weaving Bukhara Gift of Jonathan Hope, 2007 87.2 x 71.0 cm 2007.701 Gift of the President of the Wall hanging [pardahh] late 19th – Philippines HE Gloria Macapagal- early 20th century Arroyo, 2007 silk, printed cotton lining; warp ikat 2007.224 190.0 x 117.0 cm 2008.225
118 Australian Art e c.1908 Bucklee c.1890 sterling silver sterling silver DECORATIVE ARTS 8.4 x 9.0 cm, 150 g (weight) 7.3 cm, 50 g (weight) 2007.1171 2007.1183 A SIMPSON & SON (manufacturer) Bucklee c.1914 Australia 1853–1938 DICK, Alexander sterling silver Scotland 1800 – Australia 1843 Setteee c.1896 5.8 cm, 20 g (weight) to Australia 1824 cast iron, paint, wood 2007.1175 85.0 x 186.0 x 73.0 cm Mustard spoon with fiddle and shell 2007.1520 BROAD, Robert patternn c.1827 born 1821 sterling silver BANGS, Edward to Australia c.1831 10.5 cm, 10 g (weight) died Australia Teaspoonn c.1835 2007.1184 Presentation goblett c.1858–59 sterling silver DICKSON, Lex sterling silver 14.5 cm, 20 g (weight) New Zealand 1951 – Australia 2008 15.5 cm, 190 g (weight) 2007.1176 2007.1168 to Australia 1972 BRUNKHORST, August Square platter 2007 BASSÉ, Frederick Germany 1846 – Australia 1919 stoneware with shino glaze Germany 1852 – Australia 1913 to Australia 1875 40.0 x 40.0 cm to Adelaide, South Australia c.1880 Letter openerr c.1904 2007.391 F BASSÉ & CO. sterling silver Vase 2007 Australia 1881–1920 8.8 x 0.8 cm, 10 g (weight) stoneware with shino and tenmoku Desk sett c.1887 2007.1177 glaze sterling silver, glass Rose bowll c.1890 57.0 cm, 15.0 cm (diam.) 11.4 x 23.4 x 15.0 cm, 1010 g (weight) sterling silver 2007.392 2007.1170 19.0 x 22.0 cm, 950 g (weight) DOUGLAS, Melanie Caskett c.1900 2007.1178 sterling silver, tortoiseshell, mother- born Australia 1978 Flaskk c.1900 of-pearl Bias I 2007 sterling silver 8.00 x 6.0 x 4.0 cm, 160 g (weight) glass 14.3 cm, 255 g (weight) 2007.1172 48.0 cm, 24.0 cm (diam.) 2007.1179.A–B Match box coverr c.1914 Purchased in memory of Philippa Bucklee c.1890 sterling silver Winn, NGA Educator (1996–2005) by sterling silver 3.3 x 7.4 x 5.2 cm, 60 g (weight) her family, friends and colleagues 6.9 cm, 40 g (weight) 2007.1173 2007.385 2007.1180 Three coffee spoons with emu, Bucklee c.1890 DUNKLING, William kangaroo and kookaburra motifs sterling silver Great Britain 1846 – Australia 1926 c.1914 7.2 cm, 25 g (weight) to Australia 1884 sterling silver 2007.1181 DUNKLINGS THE JEWELLERS total 40 g (weight) PTY LTD (manufacturer) Bucklee c.1900 2007.1174.1–3 established Australia 1885 sterling silver BASSÉ, Frederick 7.5 x 4.4 cm, 15 g (weight) Set of six teaspoons with Australian Germany 1852 – Australia 1913 2007.1182 State crestss c.1950 to Adelaide, South Australia c.1880 sterling silver, enamel F BASSÉ & CO. (maker) BRUNKHORST, August 2007.1185.1–7 Australia 1881–1920 Germany 1846 – Australia 1919 to Australia 1875 EDWARDS, William Salt/mustard bowll c.1900 AUGUST L BRUNKHORST & CO Great Britain 1819 – Australia 1889 sterling silver (maker) to Australia 1857 2.0 cm, 5.0 cm (diam.), 50 g (weight) Australia 1846 – closed 1919 2007.1169 Australia
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 119 Goblet with mounted emu eggg c.1865 Sea Urchin I 2007 Casket with mounted emu eggg c.1875 sterling silver, emu egg glass sterling silver, emu egg, wood stand, 21.0 cm, 255 g (weight) 30.0 cm, 37.0 cm (diam.) velvet lining to egg 2007.1186 Gift of Sandy Benjamin 23.0 x 23.0 cm Goblett c.1868 2008.203 2007.1201 sterling silver Ricketty Dick walking stickk c.1885 HAMMERTON, John (silversmith) 19.0 cm, 227 g (weight) sterling silver head, wood shaft, brass Australia 1864–1927 2007.1188 tip GEORGE BRADLEY & SON 92.0 cm, 2.2 cm (diam.) Bucklee c.1870 (retailer) 2007.1202 sterling silver ESTABLISHED CLOSED !USTRALIA 4.8 cm, 10 g (weight) Two-handled cup with coverr c.1913 KENDRICK, M 2007.1189 sterling silver died Australia EDWARDS, William (maker) 29.0 cm, 700 g (weight) Pair of decanter labels for brandy and Great Britain 1819 – Australia 1889 2007.1196 whiskyy c.1910 to Australia 1857 Two-handled cup with coverr c.1910 sterling silver WALSH & SONS (retailer) sterling silver each 5.7 cm, 18 g (weight) Casket with mounted emu eggg c.1860 29.5 cm, 590 g (weight) 2007.1203.1–2 sterling silver, emu egg 2007.1197 KILPATRICK AND CO (maker) 22.5 x 19.5 cm HANNAFORD, Mary Jane 2007.1190 Pair of table napkin rings England 1840 – Australia 1930 sterling silver EDWIN HARROP (manufacturer) Australia from 1842 2007.1204.1–2 established Australia 1898 Advance Australia Fair quilt KING’S YARD HOBART Match box coverr c.1935 c.1910–1925 (attributed to) sterling silver printed and woven cotton, wool, silk, ESTABLISHED CLOSED !USTRALIA 6.0 x 3.9 x 1.8 cm, 22 g (weight) velvet, beads, sequins 2007.1191 161.0 x 142.0 cm Double-ended sofaa c.1820 Gift of Janelle Constable Tasmanian oak, Australian cedar, FISCHER, Edward 2008.188 brass castors, horsehair mixture Austria 1828 – Australia 1904 upholstery fabric, jute lining, HILLIARD AND THOMSON Pair of collar studss c.1880 horsehair stuffing (manufacturer) sterling silver 98.0 x 213.0 x 58.0 cm each 1.8 cm (diam.) Card casee c.1900 2007.940.A–D 2007.1192 sterling silver 10.4 x 7.2 cm, 70 g (weight) LARSEN, Helge Lockett c.1880 2007.1198 born Denmark 1929 sterling silver to Australia 1961 5.5 x 3.2 cm, 14 g (weight) HYMAN, H H LEWERS, Darani 2007.1193 Bucklee c.1900 born Australia 1936 Lockett c.1880 sterling silver Mutual support, ring 2006 sterling silver 35 g (weight) sterling silver, glass 7.2 x 4.3 cm, 50 g (weight) 2007.1199 5.5 x 4.5 cm 2007.1194 2007.389 J M WENDT (maker) Locket for photographh c.1880 A feature, pendant 2006 established Australia 1850 sterling silver sterling silver, turquoise 2.8 x 1.3 cm, 10 g (weight) Pair of meat skewerss c.1878 30.0 x 5.0 cm 2007.1195 sterling silver 2007.390 each 25.0 cm, 20 g (weight) GORDON, Kevin 2007.1200.A–B LARSEN & LEWERS (designer) born Norway 1968 LARSEN, Helge (silversmith) to Scotland 1972 JONES, Evan born Denmark 1929 to Western Australia 1980 England 1849 – Australia 1917 to Australia 1961 to Australia 1850s
120 LEWERS, Darani (silversmith) brass hinges and lockplate; brass and born Australia 1936 born Great Britain – died Australia porcelain castors; replaced pleated silk Silver bowl 2008 1963 fabric cover to work bag sterling silver to Australia 1910 75.0 x 63.0 x 47.5 cm 12.2 x 28.0 x 39.0 cm, 1000 g (weight) F J MOLE & CO. PTY LTD 2008.179 Purchased with funds from the (manufacturer) ROWLAND, John R Meredith Hinchliffe Fund established Australia 1913 2008.172 Locket for photographh c.1940 Bucklee c.1910 sterling silver sterling silver LEVY, Col 3.8 cm, 5 g (weight) 5.4 x 6.0 cm, 50 g (weight) born Australia 1933 2007.1208 2007.1212 Bowl 1988 Cylindrical Vesta strikerr c.1930 S SCHLANK & CO LTD glazed porcelain sterling silver established Australia 1879 16.0 cm, 51.5 cm (diam.) 3.3 cm, 10 g (weight) Gift of Pauline Hunter 2007.1209 Scoop spoonn c.1883 2008.189 sterling silver Oval boxx c.1950 2007.1213 LINTON, James A B sterling silver Australia 1904–1980 4.0 x 3.8 cm, 98 g (weight) S SCHLANK & CO LTD 2007.1210 (manufacturer) Set of twelve teaspoonss c.1950 established Australia 1879 sterling silver NUSKE, Bruce 2007.1205.1–13 born Australia 1949 Boxx c.1920 sterling silver Set of six teaspoons with wildflower Tea Wear no.2 2005 1.2 x 5.3 x 3.6 cm, 40 g (weight) motifss c.1950 porcelain 2007.1214 sterling silver 12.5 x 22.0 cm 2007.1206.1–7 2007.386.A–B S SCHLANK & CO LTD Set of six teaspoons with wildflower Japonesque 2005 (manufacturer) motifss c.1950 porcelain established Australia 1879 sterling silver 20.0 x 24.0 cm PERRYMAN (retailer) 2007.1207.1–7 2007.387.A–B ESTABLISHED CLOSED !USTRALIA Trophy cupp c.1904 MAREK, Dusan Bowl 2006 sterling silver Czechoslovakia 1926 – Australia 1993 glazed stoneware 23.5 cm, 270 g (weight) Australia 1948–54; Papua New 13.5 x 21.5 cm 2007.1215 Guinea 1954–59; Australia from 1959 2007.388 Match box holderr c.1922 Ashtray in the shape of a birdd c.1953 PALFREY, G H sterling silver embossed silver-foil Australia 1896–1903 5.3 x 1.8 cm, 20 g (weight) 7.3 x 9.2 cm Match boxx c.1920 2007.1216 Purchased with the assistance sterling silver of James Agapitos, OAM, and Bucklee c.1910 6.0 x 3.0 x 1.0 cm, 20 g (weight) Ray Wilson, OAM, 2007 sterling silver 2007.1211 2007.1081 5.2 x 5.3 cm, 25 g (weight) 2007.1217 Belt ornament with chariot motif RAPHAEL & CO c.1953 Australia 1858–1870 SARGISON’S (manufacturer) embossed silver-foil Work tablee c.1869 established Australia 1908 2.8 x 15.7 cm Frame: Australian tulipwood; Set of six teaspoonss c.1960 Purchased with the assistance case: brush cypress pine; workbag: of James Agapitos, OAM, and sterling silver, coral [?] blackbean and rose 2007.1218.1–7 Ray Wilson, OAM, 2007 mahogany; veneers: rose mahogany, 2007.1082 Huon pine, brush cypress pine, Set of six cake forkss c.1960 Queensland blackbean, [probably] sterling silver Tasmanian musk and native cherry; 2007.1219.1–7
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 121 SCHOMBURGK, Julius (silversmith) Claret jugg c.1878 SUHARD AND CO Germany 1812 – Australia 1893 sterling silver Australia 1870 – closed 1958 to Australia 1850 41.0 x 11.5 x 17.5 cm, 860 g (weight) Bonbon dishh c.1935 H STEINER (retailer) 2007.1225 sterling silver Australia 1860 – closed 1884 Shooting trophy cup and coverr c.1875 9.0 x 11.0 cm, 40 g (weight) Mounted emu egg ornament with sterling silver 2007.1235 Aboriginal figuree c.1860 26.5 cm, 325 g (weight) sterling silver, emu egg 2007.1226.A–B SUTTON 128.0 x 19.0 cm Claret jugg c.1880 Box with lidd c.1950 2007.1220 sterling silver sterling silver, opal matrix Cup with mounted emu eggg c.1862 35.5 cm, 1070 g (weight) 3.2 x 10.0 x 6.0 cm, 160 g (weight) sterling silver, emu egg 2007.1227 2007.1236 30.5 cm Pair of wine bottle labels for reisling unknown maker 2007.1221 and burgundyy c.1869 Cup with mounted emu eggg c.1862 sterling silver Flask with stopper late 19th century sterling silver, emu egg each 6.2 cm, 15 g (weight) sterling silver, Entada phaseoloides 32.0 x 13.0 x 13.0 cm 2007.1228.1–2 bean pod 2007.1222 6.5 x 3.8 cm Dessert spoonn c.1890 2007.1237.A–B sterling silver SCHOMBURGK, Julius (silversmith) 19.0 cm, 40 g (weight) Germany 1812 – Australia 1893 unknown maker 2007.1229 to Australia 1850 Match holder and striker late J M WENDT (retailer) Dessert spoonn c.1884 19th century established Australia 1850 sterling silver sterling silver, Entada phaseoloides 28.0 cm, 50 g (weight) bean pod Inkwell with mounted emu egg and 2007.1230 4.5 x 4.0 cm Aboriginal figuress c.1870 2007.1238 sterling silver, emu egg The Oaks Stakes Coursing Trophy 31.0 x 25.5 x 16.5 cm c.1884 unknown maker 2007.1223 sterling silver 36.0 x 15.0 x 11.0 cm, 850 g (weight) Presentation trowell c.1875 SHELSHER, Amanda 2007.1231 trowel: sterling silver and wood; gavel: born Australia 1971 wood STEVENSON BROTHERS 2007.1239 Number seven 2007 Australia 1878 – closed 1918 porcelain with oxides, slips and unknown maker sgraffito decoration Claret jugg c.1895 39.0 x 29.0 x 11.0 cm sterling silver, Presentation gavell c.1875 2007.393 27.0 cm, 581 g (weight) trowel: sterling silver and wood; gavel: 2007.1232 wood STEINER, Henry Christening mugg c.1893 2007.1240 Germany 1835–1914 sterling silver, unknown maker Australia from 1858 to 1884, to 6.6 cm, 146 g (weight) Germany 1884, Australia 1887–1889, 2007.1233 Ornament with mounted emu egg to Germany 1889 c.1890 Two-handled vasee c.1862 STEVENSON, Walter Hunter sterling silver, emu egg sterling silver, emu egg Australia 1855–1930 18.0 cm 30.0 cm STEVENSON BROTHERS (maker) 2007.1241 2007.1187 Australia 1878 – closed 1918 unknown maker Mounted emu egg on base depicting Teaspoonn c.1895 Bucklee c.1910 the Broken Hill Minee c.1886 sterling silver sterling silver sterling silver, carved emu egg, wood 14.2 cm, 12 g (weight) 5.2 x 6.0 cm, 58 g (weight) base 2007.1234 2007.1242 21.0 x 21.5 cm 2007.1224
122 unknown maker Cigarette casee c.1889 Lockett c.1910 tea pot: 22.0 cm, 855 g (weight) sterling silver sterling silver sugar bowl: 16.0 cm, 520 g (weight) 10.6 x 8.0 cm, 150 g (weight) 5.5 x 3.6 cm, 5 g (weight) cream jug: 17.0 cm, 350 g (weight) 2007.1263 2007.1243 2007.1250.1–4 Card casee c.1900 Inkstand with mounted emu egg sterling silver unknown maker c.1870 9.4 x 6.4 cm, 95 g (weight) Lockett c.1910 sterling silver, emu egg, glass inkwell, 2007.1264 sterling silver ebony stand Photograph holder with mounted 4.8 x 4.0 cm, 8 g (weight) 21.5 x 23.0 cm emu eggg c.1890 2007.1244 2007.1251 sterling silver, emu egg, glass, velvet, Two-handled vase with mounted emu wood base W J SANDERS (maker) eggg c.1880 18.0 x 28.0 x 18.0 cm Wagga Wagga Gold Cupp c.1936 sterling silver, emu egg 2007.1265 9 carat gold 33.0 x 17.5 x 10.0 cm 22.0 x 23.5 cm, 365 g (weight) 2007.1252 WENDT, Jochim Matthias 2007.1245 Denmark 1830 – Australia 1917 Presentation cupp c.1906 to Australia 1854 Set of six teaspoons with Australian sterling silver WENDT’S JEWELLERS PTY LTD wildflower motifss c.1930 29.0 cm, 615 g (weight) (silversmith) sterling silver 2007.1254 2007.1246.1–7 established Australia 1854 Presentation cupp c.1903 Presentation cupp c.1872 sterling silver WENDT, Jochim Matthias sterling silver 26.0 cm, 510 g (weight) Denmark 1830 – Australia 1917 16.5 cm, 175 g (weight) 2007.1255 to Australia 1854 2007.1253 Goblett c.1870 Card casee c.1893 sterling silver sterling silver, lined with leather WILLIAM DRUMMOND and CO 18.0 cm, 200 g (weight) 10.0 x 7.5 cm, 200 g (weight) Formerly BRUSH and DRUMMOND 2007.1256 2007.1247 Australia 1857 Christening mugg c.1900 Bucklee c.1870 Presentation goblet with Australian sterling silver sterling silver Rules Football decorationn c.1880 7.0 cm, 125 g (weight) 5.8 cm, 30 g (weight) sterling silver 2007.1257 2007.1248 28.5 x 13.2 x 13.2 cm, 860 g (weight) Presentation cupp c.1878 2007.1266 WENDT, Jochim Matthias sterling silver WILLIAM DRUMMOND and CO Denmark 1830 – Australia 1917 20.0 cm, 380 g (weight) (manufacturer) to Australia 1854 2007.1258 J M WENDT (maker) Formerly BRUSH and DRUMMOND Fish knifee c.1868 Australia 1857 established Australia 1850 sterling silver Bucklee c.1870 28.0 cm, 60 g (weight) Set of six teaspoonss c.1930 sterling silver 2007.1259 sterling silver, opal 2007.1267.1–7 6.4 cm, 45 g (weight) Butter knifee c.1890 2007.1249 sterling silver DRAWING 13.0 cm, 16 g (weight) WENDT, Jochim Matthias (designer) 2007.1260 ATYEO, Sam Denmark 1830 – Australia 1917 Australia 1910 – France 1990 to Australia 1854 Bucklee c.1899 France from 1936; Australia 1945–46, WENDT’S JEWELLERS PTY LTD sterling silver 1948–49 (maker) 6.3 cm, 40 g (weight) established Australia 1854 2007.1261 Erect 1931 watercolour and gouache on paper Tea and coffee service (four-piece) Bucklee c.1900 image 43.8 x 29.0 cm c.1889 sterling silver sheet 43.8 x 29.0 cm sterling silver 7.3 x 7.0 cm, 40 g (weight) 2007.1262
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 123 Gift of Madame Anne Atyeo, the Venus (1970s) of James Agapitos, OAM, and artist’s wife, 2008 watercolour on paper Ray Wilson, OAM, 2007 2008.96 image 49.8 x 64.6 cm 2007.929 Merri Creek (c.1932) sheet 49.8 x 64.6 cm Nude with hair caught in a door watercolour on paper Gift of Madame Anne Atyeo, the [recto]; Adam’s rib (the birth of Eve) image 31.0 x 48.0 cm artist’s wife, 2008 [verso] (c.1945) sheet 32.6 x 49.8 cm 2008.106 pen and ink drawing on cream wove Gift of Madame Anne Atyeo, the Toilette [recto]; not titled [standing paper artist’s wife, 2008 nude figures] [verso] (1970s) image [recto] 31.2 x 24.8 cm 2008.97 watercolour and gouache (recto); image [verso] 31.2 x 24.8 cm Lyric soprano (1970s-1980s) watercolour (verso) on paper sheet 31.2 x 24.8 cm watercolour on beige paper image (recto) 42.6 x 29.6 cm Purchased with the assistance image 44.8 x 31.2 cm image (verso) 44.4 x 28.0 cm of James Agapitos, OAM, and sheet 49.0 x 32.6 cm sheet 49.6 x 32.4 cm Ray Wilson, OAM, 2007 Gift of Madame Anne Atyeo, the Gift of Madame Anne Atyeo, the 2007.928AB artist’s wife, 2008 artist’s wife, 2008 BLACK, Dorrit 2008.98 2008.95AB Australia 1891–1951 Waterfall 1 (c.1932) BAYLISS, Clifford Europe 1927–29; Europe, United watercolour on paper Australia 1916 – England 1989 States 1934–35 image 41.8 x 24.4 cm England from 1935 Study for the linocut ‘The windswept sheet 43.8 x 29.0 cm Man wearing a bowler hat 1945 farm’ [recto]; (Nude woman)[verso] Gift of Madame Anne Atyeo, the brush and coloured ink and wash on c.1937 artist’s wife, 2008 white wove paper watercolour and pencil on paper 2008.99 image 76.0 x 50.5 cm image [recto] 25.5 x 36.6 cm Waterfall 2 (c.1932) sheet 76.0 x 50.5 cm sheet 25.5 x 36.6 watercolour on paper Purchased with the assistance 2007.397AB image 40.8 x 28.8 cm of James Agapitos, OAM, and sheet 43.8 x 28.8 cm Ray Wilson, OAM, 2007 BOLES, Bernard Gift of Madame Anne Atyeo, the 2007.925 Australia 1912–2001 artist’s wife, 2008 England, United States of America (Fantasy) 1945 2008.100 1946–47; England 1949–64 ink, pen and brush, watercolour, Waterfall 3 (c.1932) gouache and pencil on paper Seaside Sunday 1945 watercolour on cream paper image 50.5 x 76.0 cm gouache and watercolour on paper image 47.6 x 31.0 cm sheet 50.5 x 76.0 cm image 36.5 x 48.0 cm sheet 49.8 x 32.4 cm Purchased with the assistance sheet 36.5 x 48.0 cm Gift of Madame Anne Atyeo, the of James Agapitos, OAM, and 2007.418 artist’s wife, 2008 Ray Wilson, OAM, 2007 (The passing parade) (1939) 2008.101 2007.926 gouache, crayon, ink, pen and brush Sunset, Melbourne (c.1932) (Icarus II) 1947 on paper watercolour on paper black conté and pastel on paper image 42.2 x 68.6 cm image 31.0 x 47.8 cm image 71.2 x 50.8 cm sheet 46.0 x 71.2 cm sheet 32.4 x 49.8 cm sheet 76.2 x 50.8 cm Purchased with the assistance Gift of Madame Anne Atyeo, the Purchased with the assistance of James Agapitos, OAM, and artist’s wife, 2008 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 2008.102 Ray Wilson, OAM, 2007 2007.931 Early nude 1929 2007.927 Going for a swim 1946 watercolour on paper (Surrealist bird) 1945 gouache on thick white paper image 63.0 x 49.5 cm ink, gouache and pencil on white image 32.0 x 39.8 cm sheet 63.0 x 49.8 cm wove paper sheet 34.0 x 41.6 cm Gift of Madame Anne Atyeo, the image 72.2 x 34.4 cm Purchased with the assistance artist’s wife, 2008 sheet 76.3 x 50.6 cm of James Agapitos, OAM, and 2008.103 Purchased with the assistance Ray Wilson, OAM, 2007 2007.933
124 CANT, James (Strange shore) 1948 Australia 1911–1982 England 1912 – Australia 1981 ink, pen and brush, watercolour and England, Europe 1934–39; England Australia from 1923; England/France pencil on white wove paper 1949–55 1938–39; England 1950–51, 1957 and image 31.4 x 24.6 cm The metal minotaur 1948 1976 sheet 34.5 x 27.4 cm watercolour and wax crayon on white Tree forms: drought sketchess c.1944 Purchased with the assistance wove paper pen and ink on white wove paper of James Agapitos, OAM, and image 44.8 x 61.0 cm (sketchbook page) Ray Wilson, OAM, 2007 sheet 46.6 x 63.0 cm image 25.2 x 27.6 cm 2007.958 Purchased with the assistance sheet 27.5 x 37.6 cm FOX, Belinda of James Agapitos, OAM, and Purchased with the assistance born Australia 1975 Ray Wilson, OAM, 2007 of James Agapitos, OAM, and 2007.939 Ray Wilson, OAM, 2007 Double take 2007 2007.948 mixed media on paper CHAPMAN, Dora image 110.0 x 70.0 cm Australia 1911–1995 DURACK, Elizabeth sheet 110.0 x 70.0 cm England 1949–55 Australia 1915–2000 Gordon Darling Australia Pacific (Tango) 1948 England 1936 Print Fund, 2007 gouache and enamel on paper The south-bound planee c.1973 2007.1293 image and sheet 25.5 x 30.5 cm watercolour and gouache on paper FRANCIS, Ivor Purchased with the assistance sight 44.6 x 52.6 cm England 1906 – Australia 1993 of James Agapitos, OAM, and Gift of Dr Anna Gray, 2008 Australia from 1924 Ray Wilson, OAM, 2007 2008.275 2007.945 (Crucifixion) (c. 1950) FEINT, Adrian ink, pen and brush on cream paper (Fandango) (1948) Australia 1894–1971 image 37.2 x 24.0 cm enamel and gouache on cream wove sheet 38.0 x 25.0 cm paper The mask 1929 Gift of James Agapitos, OAM, and image 29.8 x 38.4 cm brown and black conté on thick Ray Wilson, OAM, 2007 sheet 37.6 x 47.4 cm cream wove paper 2007.862 Purchased with the assistance image 54.0 x 46.6 cm sheet 54.0 x 46.6 cm of James Agapitos, OAM, and FRIEDEBERGER, Klaus Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 born Germany 1922 Ray Wilson, OAM, 2007 2007.946 England 1939–40; Australia 1940–50; 2007.861 The flying triangles 1948 England from 1950 Untitled 1948 mixed media on paper Snow White joins up 1941 black ink on paper image and sheet 16.8 x 24.4 cm watercolour and gouache painted image 17.5 x 33.0 cm Purchased with the assistance over pencil drawing on thick white sheet 26.4 x 40.5 cm of James Agapitos, OAM, and wove paper Purchased with the assistance Ray Wilson, OAM, 2007 image 57.4 x 42.0 cm of James Agapitos, OAM, and 2007.947 sheet 63.2 x 44.0 cm Ray Wilson, OAM, 2007 Purchased with the assistance COATS, Liz 2007.956 of James Agapitos, OAM, and born New Zealand 1946 Fantasy in pink and green – The poor Ray Wilson, OAM, 2007 Water/Colour 20 2005 relations 1949 2007.963 pigments and acrylic on Chinese pen, brush and ink and watercolour (Ballet fantasy) 1942 paper on white wove paper watercolour and gouache on paper image 49.4 x 51.0 cm image 43.0 x 38.0 cm image 34.0 x 53.4 cm sheet 65.8 x 66.0 cm sheet 43.0 x 38. cm sheet 36.0 x 53.8 cm 2007.419 Purchased with the assistance Purchased with the assistance of James Agapitos, OAM, and Water/Colour 7 2005 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 pigments and acrylic on Chinese Ray Wilson, OAM, 2007 2007.957 paper 2007.964 image 49.0 x 51.0 cm sheet 66.6 x 65.8 cm 2007.420
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 125 Camp dream 1943 Purchased with the assistance sheet 35.9 x 26.6 cm gouache on thin white wove paper of James Agapitos, OAM, and Purchased with the assistance image 34.0 x 25.2 cm Ray Wilson, OAM, 2007 of James Agapitos, OAM, and sheet 34.0 x 25.2 cm 2007.984 Ray Wilson, OAM, 2007 Purchased with the assistance (A fantasy)) c.1950 2007.990 of James Agapitos, OAM, and black ink on beige paper mounted on (Female nude, back view, hands Ray Wilson, OAM, 2007 cardboard raised)) c.1950 2007.965 image 26.6 x 9.7 cm ink, pen and wash on cream paper not titled [rubbish bin and tree] 1941 sheet 28.2 x 13.0 cm image 21.5 x 12.8 cm ink and pen on paper backing 29.9 x 15.0 cm sheet 21.5 x 12.8 cm image 29.0 x 19.6 cm Purchased with the assistance Purchased with the assistance sheet 44.2 x 28.0 cm of James Agapitos, OAM, and of James Agapitos, OAM, and Purchased with the assistance Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 of James Agapitos, OAM, and 2007.985 2007.991 Ray Wilson, OAM, 2007 (Biblical male figure) 1947 (Female study #2 for ‘The 2007.966 ink, pen and wash on cream paper crucifixion’) 1952 image 22.8 x 14.0 cm crayon on beige paper FRIEND, Donald sheet 22.8 x 14.0 cm image 27.6 x 11.4 cm Australia 1915–1989 Purchased with the assistance sheet 37.8 x 27.6 cm travels Europe, Africa, SE Asia of James Agapitos, OAM, and Purchased with the assistance frequently from 1936; Australia Ray Wilson, OAM, 2007 of James Agapitos, OAM, and 1940–67; Bali 1967–80; Australia 2007.986 Ray Wilson, OAM, 2007 from 1980 Detail for ‘Laboratory for the 2007.992 The secret weapon 1942 investigation of crucifixional (Female study for ‘The crucifixion’) pen and brush and ink, coloured ink phenomena’ 1946 1952 wash, pencil, and scratching back on gouache on beige paper pencil on beige paper paper image 10.8 x 9.5 cm image 30.8 x 14.7 cm image 26.5 x 36.3 cm sheet 12.4 x 11.5 cm sheet 37.6 x 27.6 cm sheet 26.5 x 36.3 cm Purchased with the assistance Purchased with the assistance Purchased with the assistance of James Agapitos, OAM, and of James Agapitos, OAM, and of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 2007.987 2007.993 2007.968 (Cubist head studies)) c.1950 (Forest path)) c.1950 GLEESON, James pencil, ink, pen and wash on cream mixed media on cream paper born Australia 1915 paper image 15.5 x 12.4 cm England, Europe 1947–49; Europe, image 17.5 x 12.9 cm sheet 15.5 x 12.4 cm USA 1958–59 sheet 17.5 x 12.9 cm Purchased with the assistance Two dancers 1939 Purchased with the assistance of James Agapitos, OAM, and ink, pen and wash on beige paper of James Agapitos, OAM, and Ray Wilson, OAM, 2007 (sketchbook sheet) Ray Wilson, OAM, 2007 2007.994 image 25.2 x 18.6 cm 2007.988 Ladram Bay, Devon 1947 sheet 25.6 x 18.6 cm Earth and sky (c.1949) pen and ink on beige paper Purchased with the assistance brush and ink wash, pen and ink on image 9.8 x 13.3 cm of James Agapitos, OAM, and white wove paper sheet 13.3 x 13.3 cm Ray Wilson, OAM, 2007 image 13.5 x 18.2 cm Purchased with the assistance 2007.981 sheet 13.5 x 18.2 cm of James Agapitos, OAM, and (Five surreal male figure studies) Purchased with the assistance Ray Wilson, OAM, 2007 (c.1950) of James Agapitos, OAM, and 2007.995 pen and ink, watercolour, wax crayon, Ray Wilson, OAM, 2007 (Lovers in a landscape)) c.1950 gouache and varnish on white wove 2007.989 pen and ink on beige paper paper (Female nude drying her hair)) c.1950 image 26.3 x 35.5 cm image 22.3 x 13.2 cm watercolour on cream paper sheet 26.6 x 36.0 cm sheet 22.3 x 13.2 cm image 35.9 x 26.6 cm Purchased with the assistance
126 of James Agapitos, OAM, and pencil, pen and ink on beige paper Ray Wilson, OAM, 2007 of James Agapitos, OAM, and (sketchbook sheet) 2007.996 Ray Wilson, OAM, 2007 image 15.3 x 12.2 cm (Male lovers entwined)) c.1950 2007.1003 sheet 25.3 x 18.3 cm mixed media on paper (Mountains and lakes: Japanese) Purchased with the assistance image 16.0 x 13.9 cm mixed media on cream paper of James Agapitos, OAM, and sheet 16.0 x 13.9 cm image 15.5 x 12.4 cm Ray Wilson, OAM, 2007 Purchased with the assistance sheet 15.5 x 12.4 cm 2007.1009 of James Agapitos, OAM, and Purchased with the assistance Working study for “Spain” (1950) Ray Wilson, OAM, 2007 of James Agapitos, OAM, and ink and pen, pencil on paper with 2007.997 Ray Wilson, OAM, 2007 pencil grid not titled [male nude with sphere] 2007.1004 image 34.0 x 23.6 cm c.1950 (Standing male nude, hands behind sheet 37.5 x 27.6 cm pen and ink on beige paper head)) c.1950 Purchased with the assistance image 26.4 x 13.6 cm brown ink, pen and wash on paper of James Agapitos, OAM, and sheet 37.5 x 27.2 cm (sketchbook sheet) Ray Wilson, OAM, 2007 Purchased with the assistance image 25.3 x 18.3 cm 2007.1010 of James Agapitos, OAM, and sheet 25.3 x 18.3 cm Study for ‘Greece’ (1951) Ray Wilson, OAM, 2007 Purchased with the assistance brown ink, pen and wash on paper on 2007.998 of James Agapitos, OAM, and cardboard (Male profile – Jesus)) c.1950 Ray Wilson, OAM, 2007 image 16.8 x 11.5 cm ink and brush on beige paper 2007.1005 sheet 16.8 x 11.5 cm image 31.0 x 25.5 cm not titled [two head studies] c.1950 Purchased with the assistance sheet 31.8 x 25.5 cm pencil, ink and coloured ink and wash of James Agapitos, OAM, and Purchased with the assistance on beige paper Ray Wilson, OAM, 2007 of James Agapitos, OAM, and image overall 19.4 x 17.8 cm 2007.1011 Ray Wilson, OAM, 2007 sheet 20.2 x 18.1 cm Study for ‘Incident in Avignon’ (1948) 2007.999 Purchased with the assistance brown ink, pen and wash on cream (Male study #2 for ‘Tristan and Isolde’ of James Agapitos, OAM, and paper (sketchbook sheet) triptych) (1951) Ray Wilson, OAM, 2007 image 21.5 x 12.9 cm mixed media on beige paper 2007.1006 sheet 21.5 x 12.9 cm image 26.7 x 15.2 cm Scheme for ‘The island’ (1949) Purchased with the assistance sheet 26.7 x 15.2 cm charcoal on paper of James Agapitos, OAM, and Purchased with the assistance image 10.2 x 49.8 cm Ray Wilson, OAM, 2007 of James Agapitos, OAM, and sheet overall 37.3 x 50.2 cm 2007.1012 Ray Wilson, OAM, 2007 sheet folded 24.2 x 50.2 cm Study for ‘Mechanical figure in 2007.1000 Purchased with the assistance landscape’ c.1950 (Male study for ‘Tristan and Isolde’ of James Agapitos, OAM, and mixed media on paper triptych) (1951) Ray Wilson, OAM, 2007 image 24.8 x 11.5 cm pen, ink and wash on paper on 2007.1007 sheet 24.8 x 11.5 cm cardboard (Seated male nude, right hand on Purchased with the assistance image 27.4 x 14.1 cm right knee) 1973 of James Agapitos, OAM, and sheet 28.3 x 16.1 cm ink, pen and wash on cream paper Ray Wilson, OAM, 2007 backing 29.2 x 17.0 cm (sketchbook sheet) 2007.1013 Purchased with the assistance image 15.2 x 17.2 cm Study used in ‘Pretext of accident’ of James Agapitos, OAM, and sheet 18.3 x 25.3 cm 1936 Ray Wilson, OAM, 2007 Purchased with the assistance pencil on cream paper 2007.1001 of James Agapitos, OAM, and image 32.0 x 52.4 cm Mountain woman 1942 Ray Wilson, OAM, 2007 sheet 38.2 x 55.8 cm pen and ink and watercolour on white 2007.1008 Purchased with the assistance wove paper (Side study of standing male nude) of James Agapitos, OAM, and image 17.4 x 12.8 cm c.1950 Ray Wilson, OAM, 2007 sheet 17.4 x 12.8 cm 2007.1014
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 127 Study for ‘Spain’ (1951) (Two male lovers) (c.1949) Purchased with the assistance pencil and oil on artist’s board pen and ink and brush and ink, wax of James Agapitos, OAM, and image 21.7 x 15.6 cm crayon on cream wove paper Ray Wilson, OAM, 2007 sheet 21.7 x 15.6 cm image 18.2 x 13.6 cm 2007.1026 Purchased with the assistance sheet 18.2 x 13.6 cm (Four studies for illustration for of James Agapitos, OAM, and Purchased with the assistance ‘The enemy planet’, A.M. Magazine, Ray Wilson, OAM, 2007 of James Agapitos, OAM, and April 1951) 1951 2007.1015 Ray Wilson, OAM, 2007 pencil on beige paper (sketchbook Study for ‘The crucifixion’ (1952) 2007.1021 sheet) ink and pen, watercolour on paper (Two males) 1940 image overall 23.2 x 17.0 cm (sketchbook sheet) cream paper (sketchbook sheet) sheet 27.4 x 24.8 cm image 21.5 x 12.8 cm image 35.6 x 26.8 cm Purchased with the assistance sheet 21.5 x 12.8 cm sheet 36.2 x 26.8 cm of James Agapitos, OAM, and Purchased with the assistance Purchased with the assistance Ray Wilson, OAM, 2007 of James Agapitos, OAM, and of James Agapitos, OAM, and 2007.1027 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 (Two back studies of partly draped 2007.1016 2007.1022 male)) c.1950 Study for a small paintingg c.1950 (Male nude study and statue on pen, ink and wash on cream paper ink, pen and brush, gouache on paper plinth)) c.1950 image 15.2 x 11.5 cm image 21.5 x 12.8 cm pen, ink, wash and white highlight on sheet 17.6 x 11.9 cm sheet 21.5 x 12.8 cm beige paper Purchased with the assistance Purchased with the assistance image 29.6 x 10.5 cm of James Agapitos, OAM, and of James Agapitos, OAM, and sheet 37.0 x 13.8 cm Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Purchased with the assistance 2007.1028 2007.1017 of James Agapitos, OAM, and (Male nude and bushes)) c.1950 (Study for ‘Crucifixion in Spain’ #2) Ray Wilson, OAM, 2007 pencil and ink wash on cream paper c.1952 2007.1023 image 9.4 x 8.0 cm brown conté crayon on beige paper (Three male nude studies)) c.1950 sheet 10.2 x 11.4 cm image 36.4 x 25.8 cm ink, pen and red and black wash on Purchased with the assistance sheet 37.8 x 27.6 cm cream paper of James Agapitos, OAM, and Purchased with the assistance image 27.5 x 26.8 cm Ray Wilson, OAM, 2007 of James Agapitos, OAM, and sheet 28.8 x 27.0 cm 2007.1030 Ray Wilson, OAM, 2007 Purchased with the assistance (Face in a volcano)) c.1950 2007.1018 of James Agapitos, OAM, and mixed media on cardboard Study of Frank O’Keefe (c.1950) Ray Wilson, OAM, 2007 image 18.0 x 7.4 cm gouache, pen and brush and ink, wax 2007.1024 sheet 18.0 x 7.4 cm crayon on white wove paper (Three surreal drawings)) c.1950 Purchased with the assistance image 16.7 x 13.3 cm pen and red ink on three pieces of of James Agapitos, OAM, and sheet 16.7 x 13.3 cm beige paper Ray Wilson, OAM, 2007 Purchased with the assistance image 1 12.8 x 7.5 cm 2007.1031 of James Agapitos, OAM, and image 2 13.2 x 7.8 cm Study for ‘Laboratory for the Ray Wilson, OAM, 2007 image 3 14.8 x 8.2 cm Investigation of Crucifixional 2007.1019 sheet (each) 16.4 x 9.8 cm Phenomena’ 1946 [handd] 1946 (Study of reclining male nude, hands Purchased with the assistance pencil on beige paper behind head)) c.1950 of James Agapitos, OAM, and image 12.0 x 13.2 cm ink, pen, wash and body colour on Ray Wilson, OAM, 2007 sheet 12.3 x 17.8 cm cream paper (sketchbook sheet) 2007.1025.1–3 Purchased with the assistance image 12.8 x 21.5 cm (Four sketches of male figure in of James Agapitos, OAM, and sheet 12.8 x 21.5 cm landscape)) c.1950 Ray Wilson, OAM, 2007 Purchased with the assistance black crayon on creampaper 2007.1032 of James Agapitos, OAM, and (sketchbook sheet) (Study of face)) c.1950 Ray Wilson, OAM, 2007 image 31.2 x 22.4 cm pencil on beige paper 2007.1020 sheet 35.6 x 25.5 cm image 20.2 x 13.4 cm
128 sheet 25.0 x 20.2 cm sheet 27.0 x 21.0 cm Purchased with the assistance Ray Wilson, OAM, 2007 Purchased with the assistance of James Agapitos, OAM, and 2007.1040 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Study for a small painting 1950 Ray Wilson, OAM, 2007 2007.1034 pencil, ink, pen and wash on cream 2007.1046 (Figure study)) c.1950 paper (sketchbook sheet) Study for ‘The nerve garden’ (1946) ink, brush and wash on beige paper image 9.3 x 5.9 cm pen and ink on paper image 30.7 x 23.0 cm sheet 21.4 x 12.7 cm image 6.2 x 4.8 cm sheet 31.8 x 25.4 cm Purchased with the assistance sheet 15.2 x 10.1 cm Purchased with the assistance of James Agapitos, OAM, and Purchased with the assistance of James Agapitos, OAM, and Ray Wilson, OAM, 2007 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 2007.1041 Ray Wilson, OAM, 2007 2007.1035 (Study for ‘Figure in a chair’) 1938 2007.1047 Sketch for ‘Spain’ #2 triptychh c.1950 pen and brown and black ink on Study for ‘Tristan and Isolde’ #3 ink, pen and pencil on paper white laid ruled paper (1947–52) image 13.4 x 23.2 cm image 19.6 x 15.0 cm pencil on cream paper sheet 16.5 x 24.6 cm sheet 21.0 x 16.7 cm image 5.4 x 10.2 cm Purchased with the assistance Purchased with the assistance sheet 22.8 x 14.0 cm of James Agapitos, OAM, and of James Agapitos, OAM, and Purchased with the assistance Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 of James Agapitos, OAM, and 2007.1036 2007.1042 Ray Wilson, OAM, 2007 Peripheral compositionss c.1950 Study for Spain #2 – triptychh c.1952 2007.1048 ink, pen and wash on paper pencil on paper (My dream) 1939 (sketchbook sheet) image 18.5 x 14.8 cm gouache, brush and ink, pen and ink image 12.8 x 21.2 cm sheet 24.5 x 16.8 cm and metallic paint on thick cream sheet 17.2 x 24.6 cm Purchased with the assistance card Purchased with the assistance of James Agapitos, OAM, and image 35.6 x 25.7 cm of James Agapitos, OAM, and Ray Wilson, OAM, 2007 sheet 35.6 x 25.7 cm Ray Wilson, OAM, 2007 2007.1043 Purchased with the assistance 2007.1037 Study for ‘The attack’ (1942) of James Agapitos, OAM, and Studies for a paintingg c.1950 ink, pen and wash, watercolour on Ray Wilson, OAM, 2007 pen and blue and black ink on cream cream paper 2007.1053 paper (sketchbook sheet) image 15.4 x 10.2 cm (Study for ‘Facades’)) c.1950 image 20.4 x 12.0 cm sheet 16.2 x 10.4 cm ink, pen and brush and gouche on sheet 21.4 x 12.9 cm Purchased with the assistance cream paper (sketchbook sheet) Purchased with the assistance of James Agapitos, OAM, and image 14.8 x 10.2 cm of James Agapitos, OAM, and Ray Wilson, OAM, 2007 sheet 17.9 x 12.9 cm Ray Wilson, OAM, 2007 2007.1044 Purchased with the assistance 2007.1038 Study for ‘The nerve garden’ #2 of James Agapitos, OAM, and Studies for ‘Captives in a threatening (1946) Ray Wilson, OAM, 2007 landscape I’ 1944 ink, pen and brush, pencil on textured 2007.1141 pen and ink on paper cream paper not titled [headd] [recto]; [four male image 13.2 x 8.5 cm image 20.2 x 13.4 cm nude figures] [verso] C, 1950 sheet 23.5 x 29.2 cm sheet 21.8 x 15.2 cm gouache (recto), pen and inks (verso) Purchased with the assistance Purchased with the assistance on cream paper of James Agapitos, OAM, and of James Agapitos, OAM, and image recto 9.0 x 8.0 cm Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 image verso 14.4 x 10.8 cm 2007.1039 2007.1045 sheet 15.5 x 12.4 cm 3TUDIES FOR 4RISTAN )SOLDE 1947 Study for ‘The nerve garden’ #3 Purchased with the assistance pen and ink on cream paper (1946) of James Agapitos, OAM, and image 25.3 x 13.4 cm pen and ink on cream paper Ray Wilson, OAM, 2007 sheet 25.3 x 13.4 cm (sketchbook sheet) 2007.1029AB Purchased with the assistance image 20.5 x 14.0 cm
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 129 GRAHAM, Geoffrey image 25.2 x 20.2 cm The Rotary Collection of Australian Australia 1911–1986 sheet 25.2 x 20.2 cm Art Fund, 2008 England, Ireland, Europe 1935–39 Purchased with the assistance 2008.151.A–D not titled [three figures in landscape] of James Agapitos, OAM, and KING, Inge 1945 Ray Wilson, OAM, 2007 born Germany 1918 gouache over pencil on cream wove 2007.1063 England 1939–49; Europe, USA paper Untitled drawing no.2: male and 1949–50; Australia from 1951 image 20.7 x 27.4 cm female figures with horse 1945 sheet 25.4 x 31.9 cm conte, brush and ink and pencil on not titled [three birds] 1948 Purchased with the assistance smooth white wove paper brush and coloured inks, pen and of James Agapitos, OAM, and image 24.4 x 19.2 cm black ink, watercolour over pencil on Ray Wilson, OAM, 2007 sheet 25.2 x 20.2 cm white wove paper 2007.1054 Purchased with the assistance image 22.2 x 12.0 cm sheet 24.0 x 14.0 cm not titled [flight no.1] (1938–40) of James Agapitos, OAM, and Gift of James Agapitos, OAM, and watercolour and pencil on beige Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 paper 2007.1064 2007.864 image 27.4 x 21.8 cm HALLANDAL, Pam sheet 32.0 x 25.5 cm not titled [sculptural forms] 1948 born Australia 1929 Purchased with the assistance pen and brush and brown and black of James Agapitos, OAM, and Man’s head 1985 ink on grey wove paper Ray Wilson, OAM, 2007 charcoal on paper image 32.3 x 24.2 cm 2007.1055 image 83.5 x 57.0 cm sheet 33.7 x 26.0 cm sheet 104.5 x 78.4 cm Gift of James Agapitos, OAM, and not titled [flight no2] (1938–40) Gift of Anna Gray, 2008 Ray Wilson, OAM, 2007 watercolour and pencil on beige 2008.112 2007.865 paper image 28.0 x 22.6 cm HESTER, Joy KLIPPEL, Robert sheet 32.0 x 25.5 cm Australia 1920–1960 Australia 1920–2001 Purchased with the assistance Fun fair (c.1946) England, France 1947–50; USA of James Agapitos, OAM, and 1957–63, 1966–67 Ray Wilson, OAM, 2007 watercolour and gouache on paper 2007.1056 image 25.1 x 31.6 cm not titled [curved dynamic sculptural sheet 25.1 x 31.6 cm form] 1950 (Surreal drawing of figures in a forest) Gift of James Agapitos, OAM, and gouache and pen and ink on brown 1939 Ray Wilson, OAM, 2007 wove paper pen, brush and ink, watercolour and 2007.863 image 41.8 x 36.0 cm gouache on white wove paper sheet 48.0 x 36.0 cm image 20.4 x 32.9 cm JOMANTAS, Vincas Gift of James Agapitos, OAM, and sheet 20.4 x 32.9 cm Lithuania 1922 – Australia 2001 Ray Wilson, OAM, 2007 Purchased with the assistance Germany 1946–48; Australia from 2007.866 of James Agapitos, OAM, and 1949 Ray Wilson, OAM, 2007 not titled [organic and mechanical A collection of 15 drawings for 2007.1058 forms] 1947 sculptures 1990s pen, brush and ink and wash on white The promised land 1939 Gift of the artist, 2008 wove paper pencil on thin white laid paper n n image 37.8 x 27.8 cm image 30.2 x 43.6 cm 2007.1659 sheet 37.8 x 27.8 cm sheet (irregular) 31.6 x 44.4 cm Gift of James Agapitos, OAM, and Purchased with the assistance KEATING, Megan Ray Wilson, OAM, 2007 of James Agapitos, OAM, and born Australia 1971 2007.867 Ray Wilson, OAM, 2007 Night operations and white horses 2007.1059 not titled [P19, organic machine with 2005 suspended shape in electro-magnetic Untitled drawing no.1: male and acrylic paint on cut paper on four fieldd] 1949 female figures 1944 aluminium panels pen and brush and brown ink on conté, brush and ink and pencil on panel (each) 55.0 x 73.0 cm white wove paper smooth white wove paper overall 111.0 x 147.0 cm
130 image 38.2 x 30.4 cm [Amy Lambertt] 1906 Gift of James Agapitos, OAM, and sheet 41.2 x 30.4 cm conté crayon on paper Ray Wilson, OAM, 2007 Purchased with the assistance image 24.4 x 19.2 cm 2007.1312 of James Agapitos, OAM, and sheet 28.2 x 22.4 cm not titled [street scene with cathedrall] Ray Wilson, OAM, 2007 2007.1285 (1949) 2007.1068 pen and blue ink on paper LINCOLN, Kevin Drawing 2: Head 1949 image 16.2 x 10.0 cm born Australia 1941 gouache on thin cream wove paper sheet (irregular) 16.2 x 10.0 cm Europe 1986 image 32.8 x 19.2 cm Gift of James Agapitos, OAM, and sheet (irregular) 37.0 x 25.0 cm Mirrored self portrait 30 March 1982 Ray Wilson, OAM, 2007 Purchased with the assistance 1982 2007.1313 charcoal drawing on cream wove of James Agapitos, OAM, and I eat myself which obstructs to know paper Ray Wilson, OAM, 2007 myself 1949 image 79.0 x 58.0 cm 2007.1069 pen and black ink, gouache on paper sheet 85.0 x 60.0 cm not titled [P28, constructions for image 21.6 x 12.0 cm Gift of Anna Gray, 2008 ‘suspended entities’’] 1949 sheet 21.6 x 12.0 cm 2008.113 pen, brush and ink and gouache on Gift of James Agapitos, OAM, and white wove sketchbook paper MAREK, Dusan Ray Wilson, OAM, 2007 image 52.5 x 34.5 cm Czechoslovakia 1926 – Australia 1993 2007.1314 sheet 53.9 x 41.8 cm Australia 1948–54; Papua New Past the law and Gibraltar (1949) Purchased with the assistance Guinea 1954–59; Australia from 1959 pen and brown ink, gouache on paper of James Agapitos, OAM, and Start of the revolution for the law image 13.8 x 11.8 cm Ray Wilson, OAM, 2007 sheet (torn) 16.2 x 16.2 cm 2007.1070 (c.1948) pen and blue ink on paper (ruled Gift of James Agapitos, OAM, and not titled [P5, constructions relating sheet from spiral- bound sketchbook) Ray Wilson, OAM, 2007 to ‘Suspended entities’ and ‘Lethal image 17.7 x 8.8 cm 2007.1315 Machine Monster’’] 1949, sheet (torn) 17.7 x 11.4 cm MCAUSLAN, Gordon March Gift of James Agapitos, OAM, and Aotearoa New Zealand 1913 – pen and ink and watercolour on thin Ray Wilson, OAM, 2007 Australia 1996 white wove paper 2007.876 image 38.4 x 26.8 cm Australia from 1936 not titled [France] (1982) sheet 41.9 x 30.6 cm (Aunt) 1952 pencil and crayon on tracing paper Purchased with the assistance watercolour wash, ink and brush; image 61.4 x 97.4 cm of James Agapitos, OAM, and woodblock stamp, printed in black sheet 64.8 x 97.4 cm Ray Wilson, OAM, 2007 ink on white wove paper Gift of James Agapitos, OAM, and 2007.1071 image 25.7 x 19.8 cm Ray Wilson, OAM, 2007 sheet 25.7 x 19.8 cm not titled [P22, biomorphic 2007.877 construction] 1949 Purchased with the assistance pen and brush and ink on white wove not titled [two figures with buildings of James Agapitos, OAM, and paper in backgroundd] (1949) Ray Wilson, OAM, 2007 image 39.0 x 26.5 cm pen and blue ink on ruled sheet of 2007.1083 paper sheet 41.8 x 30.8 cm Murrumbidgee gums 1938 image 10.1 x 12.6 cm Purchased with the assistance watercolour (dotted) on cream paper sheet (folded in four) 10.1 x 12.6 cm of James Agapitos, OAM, and image 23.8 x 23.8 cm Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 sheet 23.8 x 23.8 cm Ray Wilson, OAM, 2007 2007.1072 Purchased with the assistance 2007.1311 of James Agapitos, OAM, and LAMBERT, George W not titled [perspectival drawing of an Ray Wilson, OAM, 2007 Russia 1873 – Australia 1930 interiorr] (1949) 2007.1084 Australia 1887–1900; England pen and blue ink on paper (ruled Shape tensions 1950 1900–01; France 1901–02; England sheet from spiral-bound sketchbook) gouache and spattered gouache on 1902–21; Australia from 1921 image 10.8 x 10.2 cm paper sheet (torn) 17.6 x 11.4 cm image 19.5 x 31.5 cm
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 131 sheet 20.6 x 33.2 cm Christ crucified 1940 collage of wood-engravings on white Purchased with the assistance collage of wood-engravings; crayon wove paper of James Agapitos, OAM, and additions on white wove paper image 9.5 x 15.5 cm Ray Wilson, OAM, 2007 image 12.7 x 9.4 cm sheet 13.5 x 19.5 cm 2007.1085 sheet 13.2 x 9.8 cm Gift of James Agapitos, OAM, and support 15.0 x 11.6 cm Ray Wilson, OAM, 2007 NOLAN, Sidney Gift of James Agapitos, OAM, and 2007.893 Australia 1917 – England 1992 Ray Wilson, OAM, 2007 A tapir ridding itself of a jaguar 1940 England and Australia from 1950 2007.887 collage of wood-engravings on white The Falls of Niagara 1940 Mountain scene in the Scottish wove paper collage of wood-engravings on paper highlands 1940 image 9.6 x 15.1 cm image 10.6 x 15.6 cm collage of wood-engravings; crayon sheet 13.5 x 19.5 cm sheet 13.5 x 19.5 cm additions on white wove paper Gift of James Agapitos, OAM, and Gift of James Agapitos, OAM, and image 14.5 x 9.4 cm Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 sheet 20.0 x 13.0 cm 2007.894 2007.881 Gift of James Agapitos, OAM, and Reindeer, or cariboos 1940 Modern bridge in Peru 1940 Ray Wilson, OAM, 2007 collage of wood-engravings on white collage of wood-engravings on paper 2007.888 wove paper sheet 13.5 x 19.5 cm The Inaja-Palm 1940 image 9.8 x 15.3 cm Gift of James Agapitos, OAM, and collage of wood-engravings on white sheet 13.5 x 19.5 cm Ray Wilson, OAM, 2007 wove paper Gift of James Agapitos, OAM, and 2007.882 image 10.3 x 9.8 cm Ray Wilson, OAM, 2007 The pampas 1940 sheet 19.5 x 14.6 cm 2007.895 collage of wood-engravings on paper Gift of James Agapitos, OAM, and Diamond washing in Brazil 1940 image 10.0 x 15.6 cm Ray Wilson, OAM, 2007 collage of wood-engravings on white sheet 13.5 x 19.5 cm 2007.889 wove paper Gift of James Agapitos, OAM, and Indians hunting buffalo 1940 image 9.8 x 15.6 cm Ray Wilson, OAM, 2007 collage of wood-engravings on white sheet 13.4 x 19.5 cm 2007.883 wove paper Gift of James Agapitos, OAM, and Scenery on the lower Amazonn c.1940 image 9.8 x 15.7 cm Ray Wilson, OAM, 2007 collage of wood-engravings on paper sheet 13.4 x 19.5 cm 2007.896 image 10.0 x 15.6 cm Gift of James Agapitos, OAM, and Herd of buffaloes crossing a stream sheet 13.5 x 19.5 cm Ray Wilson, OAM, 2007 1940 Gift of James Agapitos, OAM, and 2007.890 collage of wood-engravings on white Ray Wilson, OAM, 2007 Murder of Archbishop Sharp 1940 wove paper 2007.884 collage of wood-engravings on white image 9.8 x 15.3 cm The Puncu of Avisca 1940 wove paper pasted on thin cream sheet 13.4 x 19.5 cm collage of wood-engravings; crayon wove paper Gift of James Agapitos, OAM, and additions on white wove paper image 11.2 x 9.5 cm Ray Wilson, OAM, 2007 image 10.0 x 15.6 cm sheet 19.0 x 12.4 cm 2007.897 sheet 13.5 x 19.5 cm Gift of James Agapitos, OAM, and The coach-whip snake 1940 Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 collage of wood-engravings on white Ray Wilson, OAM, 2007 2007.891 wove paper 2007.885 Jaguar seizing a manatee 1940 image 15.1 x 10.1 cm London and the Thames from collage of wood-engravings on white sheet (irregular) 13.3 x 19.4 cm Waterloo Bridge 1940 wove paper Gift of James Agapitos, OAM, and collage of wood-engravings; crayon image 9.8 x 15.5 cm Ray Wilson, OAM, 2007 additions on white wove paper sheet 13.3 x 19.5 cm 2007.898 image 8.0 x 13.0 cm Gift of James Agapitos, OAM, and River Polochie, Guatemala, Central sheet 13.2 x 20.0 cm Ray Wilson, OAM, 2007 America 1940 Gift of James Agapitos, OAM, and 2007.892 collage of wood-engravings on white Ray Wilson, OAM, 2007 Combat between a tamanoir and wove paper 2007.886 jaguar 1940 image 9.6 x 15.2 cm
132 sheet 13.4 x 19.5 cm image 24.5 x 42.5 cm Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 sheet 26.8 x 45.6 cm Ray Wilson, OAM, 2007 2007.1096 Purchased with the assistance 2007.899 Programme printed in Wimble’s ink of James Agapitos, OAM, and Il Penseroso 1940 (1948) Ray Wilson, OAM, 2007 collage of wood-engravings on white pencil and carbon transfer drawing 2007.1102 wove paper on smooth white paper (Surreal landscape)) c.1930 image 24.6 x 18.0 cm image 22.0 x 16.4 cm watercolour and gouache over pencil sheet 32.0 x 23.0 cm sheet 22.8 x 27.6 cm with scatching back on thick cream Gift of James Agapitos, OAM, and Purchased with the assistance wove paper Ray Wilson, OAM, 2007 of James Agapitos, OAM, and image 32.6 x 32.8 cm 2007.901 Ray Wilson, OAM, 2007 sheet 32.6 x 32.8 cm Malay Proa 1940 2007.1097 Purchased with the assistance collage of wood-engravings on white not titled [bust on plinthh] [recto]; not of James Agapitos, OAM, and wove paper titled [skulll] [verso] (1948) Ray Wilson, OAM, 2007 image 9.1 x 14.0 cm pencil and carbon transfer drawing 2007.1103 sheet 12.2 x 18.4 cm and collage of cut paper, crayon and OPIE, Roy Gift of James Agapitos, OAM, and traces of watercolour (recto); pen Australia 1909 – France 1968 Ray Wilson, OAM, 2007 and ink (verso) on smooth thin white France from 1960 2007.902 paper Native 1955 Scotland’s sorrow 1940 image [recto] 23.0 x 15.0 cm ink, pen and wash, coloured pencil on collage of wood-engravings on white image (verso) 17.8 x 13.2 cm cream paper wove paper sheet 30.7 x 24.7 cm image 37.0 x 21.0 cm image 13.0 x 9.4 cm Purchased with the assistance sheet 38.0 x 27.4 cm sheet 20.1 x 13.0 cm of James Agapitos, OAM, and Gift of James Agapitos, OAM, and Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 2007.1091AB 2007.904 Helena Rubenstein (1948) Pericles [recto]; not titled [skulll] not titled [three male nude figures] pencil and carbon transfer drawing [verso] (1948) 1950 and collage of cut paper on smooth pencil and carbon transfer drawing ink, pen and wash on paper white paper on smooth white paper image A 36.0 x 25.0 cm image 21.4 x 14.5 cm image 23.0 x 17.8 cm image B 27.4 x 32.7 cm sheet 22.8 x 17.8 cm sheet 23.0 x 17.8 cm image C 36.4 x 26.6 cm Purchased with the assistance Purchased with the assistance sheet (overall) 38.0 x 56.0 cm of James Agapitos, OAM, and of James Agapitos, OAM, and sheet (folded in half) 38.0 x 28.0 cm Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Gift of James Agapitos, OAM, and 2007.1092 2007.1094AB Ray Wilson, OAM, 2007 Pericles and Orphée [recto]; not titled Pan American (1948) 2007.905.A–C pencil and carbon transfer drawing [skulll] [verso] (1948) Untitled 2 (seated female nude, hand on smooth white paper pencil and carbon transfer drawing on thigh) 1947 image 21.4 x 17.8 cm on smooth white paper ink, pen and brush on beige paper sheet 22.8 x 17.8 cm image 22.8 x 17.8 cm image 31.4 x 16.4 cm Purchased with the assistance sheet 22.8 x 17.8 cm sheet 35.2 x 28.8 cm of James Agapitos, OAM, and Purchased with the assistance Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 2007.1093 Ray Wilson, OAM, 2007 2007.1095AB 2007.906 Sydney University Dramatic Society Untitled 3 “Eve” 1950 [program cover design] (1948) O’HARRIS, Pixie ink, pen and wash on cream paper pencil and carbon transfer drawing Wales 1903 – Australia 1991 image 31.2 x 16.2 cm on smooth white paper Australia from 1921 sheet 31.8 x 16.5 cm image 21.8 x 17.4 cm Charityy c.1930 Gift of James Agapitos, OAM, and sheet 22.8 x 17.6 cm pencil and watercolour on beige Ray Wilson, OAM, 2007 Purchased with the assistance paper 2007.907
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 133 Sweet, sweet [recto]; Sophisticate (Study for “The chess game”) (recto); Purchased with the assistance [verso] 1952 not titled [structural forms] (verso) of James Agapitos, OAM, and ink, pen and brush (recto); ink, pen (1948) Ray Wilson, OAM, 2007 and coloured pencil (verso) on beige pen and ink and pencil on white wove 2007.1119 paper (sketchbook sketchbook page sheet) image [recto] 24.0 x 13.2 cm SAINTHILL, Loudon image [recto] 37.0 x 26.8 cm image [verso] 20.6 x 15.4 cm Australia 1919 – England 1969 image [verso] 34.0 x 22.0 cm sheet 24.7 x 17.6 cm England 1939–40 and from 1949 sheet 37.4 x 27.2 cm Gift of James Agapitos, OAM, and (Design for ballet) 1940 Purchased with the assistance Ray Wilson, OAM, 2007 gouache on white wove paper of James Agapitos, OAM, and 2007.912AB image 37.0 x 51.5 cm Ray Wilson, OAM, 2007 The chess game (recto); not titled sheet (sight) 37.0 x 51.5 cm 2007.1104AB [cone shape basket form] (verso) Purchased with the assistance (1948) of James Agapitos, OAM, and PROCTOR, Thea pen and ink and pencil on white wove Ray Wilson, OAM, 2007 Australia 1879–1966 sketchbook page 2007.1127 England 1903–12, 1914–21 image [recto] 16.0 x 24.7 cm The musicians (c.1940) Le baiser [The kiss] c.1908 image [verso] 15.0 x 14.8 cm ink and gouache with varnish on watercolour on silk sheet (irregular) 17.6 x 24.7 cm paper on board image 45.0 x 21.0 cm Gift of James Agapitos, OAM, and image 62.6 x 47.3 cm 2007.398 Ray Wilson, OAM, 2007 sheet 62.6 x 47.3 cm not titled [flower painting with fan 2007.913AB Purchased with the assistance and ballet slipperr] c.1932 of James Agapitos, OAM, and watercolour on silk RICHMOND, Oliffe Ray Wilson, OAM, 2007 image 52.8 x 39.6 cm Australia 1919 – England 1977 2007.1128 sheet 82.0 x 67.5 cm England from 1948 Gift of the Margaret Olley not titled [tree forms] (1950s) SEE, Pamela Mei-Leng Foundation, 2007 coloured ink wash and pen and ink born Australia 1980 2007.943 on white wove paper Cross pollination 2005–2006 not titled [flower painting with fan, image 27.5 x 27.7 cm cut paper mask and handkerchieff] c.1932 sheet 29.2 x 32.2 cm overall (variable) 350.0 x 600.0 cm watercolour on silk Gift of James Agapitos, OAM, and The Rotary Collection of Australian image 52.4 x 39.2 cm Ray Wilson, OAM, 2007 Art Fund, 2008 sheet 82.0 x 67.5 cm 2007.919 2008.93.A–O Gift of the Margaret Olley ROBERTS, Douglas Foundation, 2007 SIMPKINSON DE WESSELOW, Australia 1919–1976 2007.944 Francis (Study for ‘The ack-ack gun’) England 1819–1906 PURVES SMITH, Peter (c. 1944) Australia 1844–1849 Australia 1912–1949 pencil with scratching back on cream On the road to Sassafras Valley Europe 1934–37, Australia 1937, wove paper Hobarton 1847 Africa, Europe, America, India, image 34.4 x 26.2 cm watercolour and pencil on smooth Burma 1937–46 sheet 38.0 x 27.0 cm cream paper Woman eating duck 1948 Purchased with the assistance image and sheet 27.4 x 38.4 cm gouache, watercolour, pen and ink of James Agapitos, OAM, and 2007.1298 and pencil on thin white wove paper Ray Wilson, OAM, 2007 on card 2007.1118 SPOONER, John born Australia 1946 image 47.5 x 62.6 cm Study for the ‘The dead animal’ sheet 48.0 x 62.6 (c. 1944) A collection of 44 pen and ink Purchased with the assistance pencil with scratching back on cream drawings 1987–2006 of James Agapitos, OAM, and wove paper Gift of the artist, 2008 Ray Wilson, OAM, 2007 image 33.5 x 26.4 cm 2008.18–2008.60 2007.1112 sheet 38.0 x 27.0 cm
134 City (1944) Conversation piece [fan and feett] Australia 1918–2001 watercolour, gouache and brush and 1987 United Kingdom 1938–49; United ink on cream wove paper acrylic, ink, charcoal and graphite on Kingdom, Europe 1961–62 image 20.2 x 25.0 cm thick white paper Study for sun figure 1 1989 sheet 20.2 x 25.0 cm image 109.4 x 175.8 cm pastel over pencil on white wove Gift of James Agapitos, OAM, and sheet 109.4 x 175.8 cm Arches paper Ray Wilson, OAM, 2007 2007.359 image 28.4 x 38.0 cm 2007.921 Amendments 1993 sheet 28.4 x 38.0 cm Figure 1948 gouache on 3 colour photographs on Gift of Christopher and Philip gouache and pastel on white wove 3 sheets of Kodak Professional Paper Constable in memory of their mother paper sheet (each) 74.0 x 50.0 cm Esther Constable, 2007 image 52.5 x 37.5 cm 2007.360.1–3 2007.373 sheet 52.5 x 37.5 cm ZIKARAS, Teisutis Burnt hillside 1990 Purchased with the assistance born Lithuania 1922 – died Australia pastel and charcoal on brown laid of James Agapitos, OAM, and Germany 1946–48; Australia from paper Ray Wilson, OAM, 2007 1949; UK, Europe, USA 1975 image 28.4 x 56.0 cm 2007.1137 sheet 28.4 x 56.0 cm Not titled [family with one childd] VALAMANESH, Hossein Gift of Christopher and Philip 1976 born Iran 1949 Constable in memory of their mother brush and black ink on paper Australia from 1973 Esther Constable, 2007 image 69.0 x 39.0 cm 2007.374 Practice 2006 sight 71.4 x 50.8 cm saffron, ground with salt in water, in frame 77.4 x 56.6 cm THAKE, Eric a mortar and pestle on twenty sheets Gift of Tom Trauer, 2008 Australia 1904–1982 of paper 2008.324 Happy landing (The happy father) sheet (each) 94.0 x 75.5 cm PAINTING 1939 overall 375.0 x 375.0 cm 2007.1284 gouache over pencil on white wove ATYEO, Sam paper WALKER, John R Australia 1910 – France 1990 image 28.8 x 39.2 cm born Australia 1957 France from 1936; Australia 1945–46, sheet 41.0 x 49.6 cm 1948–49 Purchased with the assistance Dying Cow 2005 of James Agapitos, OAM, and gouache on white Canson Montval Equinoxx c.1980 Ray Wilson, OAM, 2007 paper synthetic polymer paint over pencil 2007.1135 image 41.4 x 75.2 cm on canvas sheet 55.0 x 75.2 cm 190.5 x 144.2 cm TOMESCU, Aida 2007.421 Gift of Madame Anne Atyeo, the artist’s wife, 2008 born Romania 1955 Cow Still Birth 2005 2008.104 Australia from 1980 gouache on white Canson Montval Phosphor II 2005 paper Banderolee c.1980 pastel on paper image 48.0 x 75.2 cm synthetic polymer paint over pencil image 120.0 x 80.0 cm sheet 55.0 x 75.2 cm on canvas 2007.1286 2007.422 192.3 x 145.5 cm Gift of Madame Anne Atyeo, the Phosphor III 2005 WATT, David artist’s wife, 2008 pastel on paper Scotland 1952 – Australia 1998 2008.105 image 120.0 x 80.0 cm Australia from 1966 2007.1287 BOLES, Bernard Conversation piece [blow torch and Australia 1912–2001 TUCKER, Albert lighterr] 1987 England, United States of America Australia 1914–1999 acrylic, ink, charcoal and graphite on 1946–47; England 1949–64 England, Europe, United States of thick white paper America 1947–60 image 109.6 x 175.0 cm Memory of a desert melonn c.1948 sheet 109.6 x 175.0 cm oil on plywood 2007.358 30.6 x 39.8 cm
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 135 Purchased with the assistance 35.7 x 30.8 cm of James Agapitos, OAM, and of James Agapitos, OAM, and Gift of Ron Radford 2008, in Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 celebration of the NGA’s 25th 2007.959 2007.932 Anniversary Growth 1941 2008.110 oil on canvas CANT, James 49.6 x 38.8 cm Australia 1911–1982 CULLITON, Lucy Purchased with the assistance England, Europe 1934–39; England born Australia 1966 of James Agapitos, OAM, and 1949–55 Hand knit toy 2007 Ray Wilson, OAM, 2007 Red cliffs, Port Willunga 1947 oil on canvas 2007.960 enamel on board 135.0 x 135.0 cm Weekend, Normanvillee c.1940 38.5 x 50.8 cm 2007.396 oil on canvas Gift of James Agapitos, OAM, and 34.2 x 27.2 cm Ray Wilson, OAM, 2007 de CLARIO, Domenico Purchased with the assistance 2007.858 born Italy 1947 Australia from 1956 of James Agapitos, OAM, and The new river 1952 Ray Wilson, OAM, 2007 oil on canvas Orbis Tertius: the Equinox of the Five 2007.961 39.1 x 50.8 cm Moons above the sky of Tion 1988 The potter 1943 Gift of James Agapitos, OAM, and enamel paint and found objects on oil on canvas Ray Wilson, OAM, 2007 plywood 65.5 x 45.0 cm 2007.859 260.0 x 122.0 x 21.0 cm Gift of Emmanuel Hirsh in memory Purchased with the assistance The fig trees 1932 of Etta Hirsh, 2007 of James Agapitos, OAM, and oil on canvas on board 2007.377.1–5 Ray Wilson, OAM, 2007 40.0 x 33.6 cm 2007.962 Purchased with the assistance ELLYARD, Heather of James Agapitos, OAM, and born USA 1939 FRIEND, Donald Ray Wilson, OAM, 2007 Australia from 1970 Australia 1915–1989 2007.936 travels Europe, Africa, SE Asia inventories and commentaries 2006 frequently from 1936; Australia The lonely coast 1939 oil on paper on 60 canvas boards oil on canvas 1940–67; Bali 1967–80; Australia each 29.6 x 29.6 cm from 1980 35.6 x 45.6 cm Gift of Emmanuel Hirsh in memory Purchased with the assistance of Etta Hirsh, 2007 Mr Smythe’s carriage 1948 of James Agapitos, OAM, and 2007.378.1–60 oil on canvas on board Ray Wilson, OAM, 2007 29.0 x 36.5 cm 2007.937 FEINT, Adrian Purchased with the assistance Australia 1894–1971 of James Agapitos, OAM, and CHAPMAN, Dora Ray Wilson, OAM, 2007 The lighthouse 1943 Australia 1911–1995 2007.967 England 1949–55 oil on canvas 44.0 x 59.0 cm not titled [Cat attacking birdd] 1949 GASCOIGNE, Rosalie Purchased with the assistance Aotearoa New Zealand 1917 – oil and pencil on canvas on cardboard of James Agapitos, OAM, and image 22.0 x 37.5 cm Australia 1999 Ray Wilson, OAM, 2007 Australia from 1943 canvas 24.0 x 39.8 cm 2007.955 Gift of James Agapitos, OAM, and Earth 1999 Ray Wilson, OAM, 2007 FRANCIS, Ivor ten sawn builders form-boards 2007.860 England 1906 – Australia 1993 installation (variable) Australia from 1924 Gift of Ben Gascoigne AO and family, CROSSLAND, J M 2008 Investigation, scientific or otherwise, England 1799 – Australia 1858 2008.7.1–10 Australia from 1851 of matter without form 1943 oil on canvas Staffordshire bull terrier belonging to GLEESON, James 69.5 x 94.0 cm born Australia 1915 the Rev. John Gower 1851 Purchased with the assistance oil on canvas England, Europe 1947–49; Europe, USA 1958–59
136 oil on canvas not titled [head studyy] c.1945 lady-mountain 1939 116.0 x 177.5 cm oil on canvas oil on canvas Purchased with the assistance 6.8 x 4.7 cm 79.0 x 63.3 cm of James Agapitos, OAM, and Purchased with the assistance Purchased with the assistance Ray Wilson, OAM, 2007 of James Agapitos, OAM, and of James Agapitos, OAM, and 2007.976 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Study for ‘Cathedral’ c.1944 2007.1033 2007.969 oil on canvas on composition board The fortresss c.1949 Perseus 1940 27.8 x 17.5 cm oil on canvas on board oil on canvas on board Purchased with the assistance 19.2 x 24.2 cm 50.0 x 36.2 cm of James Agapitos, OAM, and Purchased with the assistance Purchased with the assistance Ray Wilson, OAM, 2007 of James Agapitos, OAM, and of James Agapitos, OAM, and 2007.977 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 The guardian of the rocks (The 2007.1049 2007.970 Guardian of E) 1955 Arm banner 1940 The infernal machine 1948 oil on board oil on canvas oil on canvas 19.5 x 24.8 cm 50.0 x 35.5 cm 25.5 x 20.3 cm Purchased with the assistance Purchased with the assistance Purchased with the assistance of James Agapitos, OAM, and of James Agapitos, OAM, and of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 2007.978 2007.1050 2007.971 The personal contortion 1943 Pretext of accident 1944 Nostalgia 1941 oil on canvas oil on canvas oil on canvas on board 98.0 x 77.5 cm 75.5 x 75.5 cm 44.8 x 39.6 cm Purchased with the assistance Purchased with the assistance Purchased with the assistance of James Agapitos, OAM, and of James Agapitos, OAM, and of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 2007.979 2007.1051 2007.972 Picasso-esque female head (Woman Neo-organic figuration describing the The harbourr c.1948 in hat)) c.1939 inclination of entities 1939 oil on canvas oil on board oil on canvas 17.8 x 25.5 cm 44.5 x 35.0 cm 88.0 x 72.5 cm Purchased with the assistance Purchased with the assistance Purchased with the assistance of James Agapitos, OAM, and of James Agapitos, OAM, and of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 2007.973 2007.980 2007.1052 Spain 1951 Fête champêtre, a lethal regulation GRAHAM, Geoffrey oil on canvas 1944 Australia 1911–1986 67.0 x 47.0 cm oil on canvas England, Ireland, Europe 1935–39 Purchased with the assistance 76.5 x 76.5 cm of James Agapitos, OAM, and Purchased with the assistance Dreams beyond avarice 1939 Ray Wilson, OAM, 2007 of James Agapitos, OAM, and oil on canvas 2007.974 Ray Wilson, OAM, 2007 34.0 x 44.0 cm Purchased with the assistance Temptation of St Anthony 1949 2007.982 of James Agapitos, OAM, and oil on canvas on board The nerve garden 1946 Ray Wilson, OAM, 2007 50.0 x 42.0 cm oil on canvas on composition board 2007.1057 Purchased with the assistance 96.0 x 127.0 cm of James Agapitos, OAM, and Purchased with the assistance HALL, Oswald Ray Wilson, OAM, 2007 of James Agapitos, OAM, and Australia 1917–1991 2007.975 Ray Wilson, OAM, 2007 2007.983 From forged dawns 1941 Funeral procession in a wounded oil on canvas on board landscape 1945 38.0 x 45.6 cm
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 137 Purchased with the assistance Australia 1887–1900; England Mother and childd c.1951 of James Agapitos, OAM, and 1900–01; France 1901–02; England oil on plywood Ray Wilson, OAM, 2007 1902–21; Australia from 1921 8.8 x 20.6 cm 2007.1060 Michelago landscape 1923 Gift of James Agapitos, OAM, and Blood over mudd c.1941 oil on wood panel Ray Wilson, OAM, 2007 oil on cotton gauze on plywood 33.5 x 42.5 cm 2007.874 27.5 x 33.6 cm Gift of Philip Bacon AM, 2007 My wifee c.1952 Purchased with the assistance 2007.644 oil on plywood of James Agapitos, OAM, and 36.0 x 29.0 cm Ray Wilson, OAM, 2007 LYNN, Elwyn Gift of James Agapitos, OAM, and 2007.1061 Australia 1917–1997 Ray Wilson, OAM, 2007 Europe, USA 1958–59, Surreal landscape with mother and 2007.875 childd c.1940 Blake’s god and the people 1950 not titled [girl with mirrorr] 1950 oil on canvas on composition board oil on board oil on glass 32.4 x 38.6 cm 46.8 x 75.4 cm 10.5 x 8.0 cm Purchased with the assistance Purchased with the assistance Gift of James Agapitos, OAM, and of James Agapitos, OAM, and of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 2007.878 2007.1074 2007.1062 The breeze in the bay 1951 oil and pen and ink on cardboard HECKROTH, Hein MAREK, Dusan 16.5 x 19.6 cm Germany 1910 – The Netherlands Czechoslovakia 1926 – Australia 1993 Purchased with the assistance 1970 Australia 1948–54; Papua New of James Agapitos, OAM, and England 1935–1940; Australia Guinea 1954–59; Australia from 1959 Ray Wilson, OAM, 2007 1940–41; England from 1941 Brickk c.1968 2007.1076 Australia 1941 oil on brick Helenine 1951 oil on board 11.0 x 22.5 cm oil with pencil on cardboard 47.0 x 59.0 cm Gift of James Agapitos, OAM, and 16.8 x 20.0 cm Purchased with the assistance Ray Wilson, OAM, 2007 Purchased with the assistance of James Agapitos, OAM, and 2007.868 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Gibraltar 1948 Ray Wilson, OAM, 2007 2007.1065 oil with pencil on cardboard 2007.1077 Surreal landscape [recto]; seated 16.0 x 32.0 cm Prisonerr c.1950 woman [verso] 1940 Gift of James Agapitos, OAM, and oil on canvas oil with scrafitto on board Ray Wilson, OAM, 2007 51.0 x 41.0 cm 50.0 x 44.2 cm 2007.870 Purchased with the assistance Purchased with the assistance Hearing musicc c.1952 of James Agapitos, OAM, and of James Agapitos, OAM, and oil on panel Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 12.0 x 43.0 cm 2007.1078 2007.1066AB Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Analysis of substance 1952 HICKEY, Dale 2007.871 oil on canvas born Australia 1937 36.5 x 88.2 cm Man and woman on the beachh c.1951 United Kingdom, Europe, United Purchased with the assistance oil on wood panel States 1971, 1977 of James Agapitos, OAM, and 4.2 x 21.0 cm Untitled 1985/87 Ray Wilson, OAM, 2007 Gift of James Agapitos, OAM, and 2007.1079 oil and enamel on canvas Ray Wilson, OAM, 2007 183.0 x 366.0 cm 2007.872 Gravitation – The return of Christ Gift of Emmanuel Hirsh in memory 1949 Mir 1950 of Etta Hirsh, 2007 oil on panel with inset mirror oil on glass 2007.376 35.0 x 81.0 cm 10.7 x 8.2 cm Purchased with the assistance LAMBERT, George W Gift of James Agapitos, OAM, and of James Agapitos, OAM, and Russia 1873 – Australia 1930 Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 2007.873 2007.1080
138 [recto]; Program [verso] not titled [abstract composition] 1939 Ray Wilson, OAM, 2007 1948–1949 oil on artist’s board 2007.1099 oil and enamel with pen and ink on 61.0 x 45.8 cm Drought 1953 two-sided panel Purchased with the assistance enamel and oil on composition board 28.5 x 51.5 cm of James Agapitos, OAM, and 91.1 x 121.4 cm Purchased with the assistance Ray Wilson, OAM, 2007 Purchased with the assistance of James Agapitos, OAM, and 2007.1090 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 MCCUBBIN, Frederick 2007.1075AB 2007.1100 Australia 1855–1917 Orphée 1948 MCAUSLAN, Gordon Violet and gold 1911 enamel and silver foil on composition Aotearoa New Zealand 1913 – oil on canvas board Australia 1996 87.0 x 144.5 cm 77.5 x 107.5 cm Australia from 1936 Purchased with the generous Purchased with the assistance Night out 1953 assistance of the Hon. Mrs Ashley of James Agapitos, OAM, and egg tempera and oil on aluminium Dawson-Damer, John Wylie, AM, and Ray Wilson, OAM, 2007 35.5 x 28.0 cm Myriam Wylie, 2008 2007.1101 Gift of James Agapitos, OAM, and 2007.1660 Ray Wilson, OAM, 2007 At the falling of the year 1886 PERCEVAL, John 2007.879 oil on canvas Australia 1923–2000 30.6 x 15.1 cm England 1963–65 MCCLINTOCK, Herbert 2008.111 Australia 1906–1985 Boys on stilts 1943 oil and tempera on board Strange interlude 1940 NICHOLAS, William 50.3 x 60.5 cm oil on canvas on board England 1807 – Australia 1854 Purchased with the assistance 70.8 x 48.3 cm Australia from 1836 of James Agapitos, OAM, and Purchased with the assistance Portrait of a woman 1852 Ray Wilson, OAM, 2007 of James Agapitos, OAM, and oil on canvas 2007.1105 Ray Wilson, OAM, 2007 96.5 x 71.0 cm Setting moon surprised by dawn 1944 2007.1086 Gift of Chris Deutscher, 2007 oil on canvas on board Strange oversight 1940 2007.941 51.5 x 59.0 cm oil on canvas on composition board Purchased with the assistance 61.0 x 45.0 cm NOLAN, Sidney of James Agapitos, OAM, and Purchased with the assistance Australia 1917 – England 1992 Ray Wilson, OAM, 2007 of James Agapitos, OAM, and England and Australia from 1950 2007.1106 Ray Wilson, OAM, 2007 Clay horses 1953 2007.1087 enamel and oil on composition board Floating mask 1 1943 oil, tempera, resin, enamel on Approximate portrait in a drawing 91.0 x 121.0 cm composition board room 1938–39 Gift of James Agapitos, OAM, and 58.8 x 51.2 cm oil and collage on canvas on board Ray Wilson, OAM, 2007 Gift of Denis Savill, 2008 75.3 x 53.3 cm 2007.900 2008.190 Purchased with the assistance Girl with a curly linee c.1945 of James Agapitos, OAM, and enamel and oil on composition board PHILPOT, Ernest Ray Wilson, OAM, 2007 61.0 x 91.5 cm England 1906 – Australia 1985 2007.1088 Purchased with the assistance Australia from 1913 of James Agapitos, OAM, and Three faces 1940 The judgement of Pariss c.1955 Ray Wilson, OAM, 2007 oil on canvas on board sprayed enamel paint with scrafitto 2007.1098 50.0 x 42.5 cm on composition board Purchased with the assistance Still life with carcase 1953 92.0 x 118.0 cm of James Agapitos, OAM, and enamel and oil on composition board Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 91.4 x 121.5 cm Ray Wilson, OAM, 2007 2007.1089 Purchased with the assistance 2007.910 of James Agapitos, OAM, and
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 139 not titled [bombing raidd] 1941 Ray Wilson, OAM, 2007 Surreal landscapee c.1944 oil on canvas 2007.920 oil on hessian 74.5 x 59.2 cm Hylas re-arisen 1944 43.5 x 59.5 cm Purchased with the assistance oil on canvas Purchased with the assistance of James Agapitos, OAM, and 88.2 x 56.2 cm of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Purchased with the assistance Ray Wilson, OAM, 2007 2007.1107 of James Agapitos, OAM, and 2007.1122 Ray Wilson, OAM, 2007 Landscape, Flinders Ranges 1951 PLATE, Carl 2007.1113 oil on cardboard Australia 1909–1977 55.0 x 75.0 cm United States of America, Mexico, The lament 1944 Purchased with the assistance England, Europe, Russia 1935–40; oil on hessian on board of James Agapitos, OAM, and England, Europe 1959; 61.0 x 45.8 cm Ray Wilson, OAM, 2007 United States of America 1962; Purchased with the assistance 2007.1123 Europe 1965, 1968, 1970 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 Retrospection 1932 ROBERTS, Tom 2007.1114 oil on plywood England 1856 – Australia 1931 33.5 x 23.0 cm Ruins, Yunta 1944 Australia from 1869; England, Europe Purchased with the assistance oil on hessian on composition board 1881–85, 1901–23 45.0 x 59.6 cm of James Agapitos, OAM, and Harbourscapee c.1896 Purchased with the assistance Ray Wilson, OAM, 2007 oil on cedar panel of James Agapitos, OAM, and 2007.1108 6.0 x 11.1 cm Ray Wilson, OAM, 2007 Bewildered beasts 1949 Gift of Dr Joseph Brown AO OBE, 2007.1115 oil on board 2008 49.2 x 59.0 cm Wreck and skeletonn c.1948 2008.6 Purchased with the assistance oil on canvas of James Agapitos, OAM, and 45.2 x 59.2 cm ROBERTSHAW, Freda Ray Wilson, OAM, 2007 Purchased with the assistance Sydney 1916 – Australia 1997 2007.1109 of James Agapitos, OAM, and Compositionn c.1947 Ray Wilson, OAM, 2007 Paddy melonss c.1944 oil on canvas on board 2007.1116 oil with scrafitto on cardboard 40.0 x 30.0 cm 41.0 x 26.0 cm not titled [two embracing figures] Purchased with the assistance Purchased with the assistance 1944 of James Agapitos, OAM, and of James Agapitos, OAM, and oil on hessian Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 62.2 x 46.3 cm 2007.1125 2007.1110 Purchased with the assistance of James Agapitos, OAM, and ROGGENKAMP, Joy POWER, John Wardell Ray Wilson, OAM, 2007 Australia 1928–1999 Australia 1881 – England 1943 2007.1117 Story Bridge 1957 England from 1906; France 1920–22 The Ack-Ack gun 1944 oil on composition board A wreck on the shoree c.1936 oil on hessian on board 67.0 x 90.0 cm oil on canvas 61.0 x 48.0 cm 2008.78 41.0 x 61.0 cm Purchased with the assistance Gift of James Agapitos, OAM, and of James Agapitos, OAM, and RUDNER, Vera Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 born Germany 1922 2007.911 2007.1120 Australia from 1938 The dead animal 1944 Kaleidoscopia 1942 ROBERTS, Douglas oil on hessian on board oil on canvas on board Australia 1919–1976 61.5 x 46.5 cm 50.1 x 36.2 cm Farmer and family 1944 Purchased with the assistance Gift of James Agapitos, OAM, and oil on canvas of James Agapitos, OAM, and Ray Wilson, OAM, 2007 60.2 x 60.2 cm Ray Wilson, OAM, 2007 2007.924 Gift of James Agapitos, OAM, and 2007.1121
140 e c.1948 STAUNTON, Madonna of James Agapitos, OAM, and oil on canvas on board born Australia 1938 Ray Wilson, OAM, 2007 36.5 x 28.5 cm Curtain 1996 2007.1136 Purchased with the assistance synthetic polymer paint, apron on WATSON, Percy of James Agapitos, OAM, and paper Australia 1919–1995 Ray Wilson, OAM, 2007 91.0 x 65.0 cm 2007.1126 2007.394 Landscape venturee c.1951 oil on composition board SAINTHILL, Loudon STEUART, Ronald 50.6 x 71.2 cm Australia 1919 – England 1969 Australia 1898–1988 Purchased with the assistance England 1939–40 and from 1949 (Image)) c.1950 of James Agapitos, OAM, and (Sphinx)) c.1948 oil with pen and ink on composition Ray Wilson, OAM, 2007 oil on composition board board 2007.1139 91.2 x 71.0 cm 50.0 x 60.5 cm Spheres and pyramids (Obelisks) Purchased with the assistance Purchased with the assistance 1951 of James Agapitos, OAM, and of James Agapitos, OAM, and oil on board Ray Wilson, OAM, 2007 Ray Wilson, OAM, 2007 71.0 x 60.0 cm 2007.1129 2007.1132 Purchased with the assistance of James Agapitos, OAM, and SANSOM, Gareth Miragee c.1950 Ray Wilson, OAM, 2007 born Australia 1939 oil on canvas on cardboard 2007.1140 USA, UK, Europe 1967; The 54.0 x 55.4 cm Purchased with the assistance Netherlands 1982 PHOTOGRAPHY of James Agapitos, OAM, and The great democracy 1968 Ray Wilson, OAM, 2007 oil, enamel, synthetic polymer paint, DUPAIN, Max 2007.1133 collage and pencil on composition Australia 1911–1992 board TAYLOR, Howard Surreal face of a woman 1938 180.0 x 180.0 cm Australia 1918–2001 gelatin silver photograph Gift of Emmanuel Hirsh in memory United Kingdom 1938–49; United image 45.9 x 35.5 cm of Etta Hirsh, 2007 Kingdom, Europe 1961–62 sheet 46.8 x 35.5 cm 2007.375 support 60.8 x 50.4 cm At Shannon Dam 1998 Purchased with the assistance oil on plywood SMART, Jeffrey of James Agapitos, OAM, and 183.0 x 91.0 cm born Australia 1921 Ray Wilson, OAM, 2007 Gift of Christopher and Philip United States of America and Europe 2007.949 1948–50, Europe 1962–65, Italy from Constable in memory of their mother Two forms 1939 1965 Esther Constable, 2007 2007.368 gelatin silver photograph Strange street 1955 image 50.8 x 40.2 cm oil on board TUCKER, Albert Purchased with the assistance 30.0 x 40.0 cm Australia 1914–1999 of James Agapitos, OAM, and Purchased with the assistance England, Europe, United States of Ray Wilson, OAM, 2007 of James Agapitos, OAM, and America 1947–60 2007.950 Ray Wilson, OAM, 2007 Cafe (Caffè) 1954 Two rayographss c.1936 2007.1130 oil on composition board gelatin silver photographs Playground (Children playing) 1951 63.5 x 81.0 cm left 38.0 x 31.4 cm oil on canvas Gift of James Agapitos, OAM, and right 40.2 x 30.1 cm 60.0 x 76.0 cm Ray Wilson, OAM, 2007 support 56.8 x 76.1 cm Purchased with the assistance 2007.922 Purchased with the assistance of James Agapitos, OAM, and Clown 1943 of James Agapitos, OAM, and Ray Wilson, OAM, 2007 oil on plywood Ray Wilson, OAM, 2007 2007.1131 56.5 x 76.0 cm 2007.951 Purchased with the assistance
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 141 Rayograph with waterr c.1936 Filtered light 1952 Alphatopo 2007 gelatin silver photograph gelatin silver photograph screenprints, printed in colour, from image 36.4 x 28.2 cm Image 42.3 x 35.0 cm multiple stencils on paper support 47.7 x 32.0 cm Gift of Barbara Robertson, 2008 book (closed) 32.4 x 24.0 x 2.0 cm Purchased with the assistance 2008.11 case 34.4 x 24.6 x 3.2 cm of James Agapitos, OAM, and Gordon Darling Australia Pacific Ray Wilson, OAM, 2007 PRINT Print Fund, 2008 2007.952 2008.148 ADAMS, Tate The bride 1936 born Ireland 1922 Turn 2007 gelatin silver photograph Australia from 1952; England screenprints, printed in colour, from image 45.6 x 32.2 cm 1956–58 multiple stencils on thin white wove sheet 46.9 x 32.9 cm and clear paper Purchased with the assistance Connemara girl 1955 book (closed) 24.7 x 17.6 x 2.2 cm of James Agapitos, OAM, and lithograph, printed in colour, from case 26.0 x 18.6 x 3.4 cm Ray Wilson, OAM, 2007 multiple stones on white wove paper Gordon Darling Australia Pacific 2007.953 image (sight) 30.2 x 22.5 cm Print Fund, 2008 sheet (sight) 31.0 x 22.5 cm 2008.149 Doll’s head and goat’s skulll c.1937 2008.84 gelatin silver photograph Sisyphus goes home 2007 image 24.1 x 26.9 cm AMOR, Rick screenprints, printed in colour, from sheet 25.1 x 28.0 cm born Australia 1948 multiple stencils on thin white wove Purchased with the assistance paper A collection of 298 prints 1968–2005 of James Agapitos, OAM, and book (closed) 18.0 x 14.6 x 2.2 cm Gift of the artist, 2007 Ray Wilson, OAM, 2007 Gordon Darling Australia Pacific n n 2007.954 Print Fund, 2008 2007.857 2008.150 PAAUWE, Deborah AMOR, Rick born United States of America 1972 BAYLISS, Clifford born Australia 1948 Australia from 1985 Australia 1916 – England 1989 AUSTRALIAN PRINT WORKSHOP England from 1935 From the waist down 1998 (print workshop) Type C colour photograph established Australia 1989 War Chieff c.1930 image 75.0 x 75.0 cm linocut, printed in colour, from three Interview 2004 Gift of Paul Greenaway OAM, 2008 blocks on cream paper subsequently lithograph, printed in colour, from 2008.12 laid on card two stones (black and yellow) on image 16.0 x 12.0 cm medium-weight white wove ROBERTSON, Eric sheet 17.3 x 12.0 cm Arches paper Australia 1889–1955 2007.1521 image 45.7 x 37.4 cm View of General Post Office through sheet 76.6 x 56.6 cm Dakotaa c.1930 fog, Adelaidee c.1940s Gift of the Australian Print linocut, printed in colour, from five gelatin-silver photograph Workshop, 2007 blocks on cream paper subsequently Image 34.5 x 30.3 cm 2007.671 laid on card Sheet 37.8 x 30.3 cm image 15.8 x 13.6 cm Gift of Barbara Robertson, 2008 ASHBY, Lyn sheet 18.6 x 14.6 cm 2008.8 born England 1953 2007.1522 Not titled (Tree study) early 1950s Australia from 1960 BLACK, Margaret (print after) gelatin silver photograph Lost and found 2007 died Australia Image 33.3 x 26.3 cm screenprints, printed in colour, from active by 1859 Sheet 37.7 x 30.0 cm multiple stencils on thin white wove COGNE, Francois (lithographer) Gift of Barbara Robertson, 2008 paper France 1829–1883 2008.9 book (closed) 11.0 x 15.0 x 1.4 cm working Australia 1856–64 A tree of evil 1954 Gordon Darling Australia Pacific HAMEL, Julius (publisher) gelatin silver photograph, pigment Print Fund, 2008 Germany 1812 – Australia 1894 Image 42.3 x 34.0 cm 2008.147 Australia from 12 November 1852 Gift of Barbara Robertson, 2008 (Great Britain) 2008.10
142 1863 ATELIER LACOURIERE ET not titled [hand and leaff] 1976 lithograph, printed in black ink, from FRELAUT (print workshop) soft-ground etching, printed in one stone; blue tint stone on off-white France 1957–2006 colour, from multiple plates on white wove paper not titled [landscape] 1975 wove BFK Rives paper image 36.6 x 65.4 cm monoprint with collage on thin plate-mark 33.0 x 35.6 cm sheet 48.6 x 75.6 cm Japanese-style paper mounted onto sheet 54.2 x 53.6 cm 2007.1528 thick white card Gift of Peter Cameron, 2007 image 69.4 x 49.6 cm 2007.1386 BRASH, Barbara sheet 73.2 x 53.0 cm Australia 1925–2002 CAMPBELL, Oswald Rose (print Gift of Peter Cameron, 2007 after) Vic and Bob – beachcombers 2007.1380 screenprint, printed in colour, from Channel Islands 1820 – Australia 1887 not titled [oak leaff] 1976 multiple stencils on paper arrived Australia c.1850 soft-ground etching, printed in image 31.4 x 32.8 cm Christmas in the bush: an Australian colour, from multiple plates on white sheet (sight) 33.0 x 34.0 cm homestead 1867 wove BFK Rives paper 2007.410 wood-engraving, printed in colour, plate-mark 24.8 x 34.4 cm from multiple blocks on paper sheet 42.0 x 49.1 cm BUTTON, Henry image 32.6 x 44.2 cm Gift of Peter Cameron, 2007 England 1829 – Australia 1914 sheet 42.2 x 51.0 cm 2007.1381 Australia from 1837 2007.409 Certificate for the independent Order not titled [yellow circle] 1977 of Rechabites 1903 soft-ground etching, printed in CANT, James lithograph, printed in colour, from colour, from multiple plates on white Australia 1911–1982 multiple stones on thin yellowing wove BFK Rives paper England, Europe 1934–39; England wove paper plate-mark 29.6 x 24.1 cm 1949–55 image 44.2 x 31.6 cm sheet 32.8 x 28.4 cm Six signed artist’s prints. Introduction sheet 54.4 x 37.7 cm Gift of Peter Cameron, 2007 by Clive Turnbull 1948 Gift of John McPhee, 2008 2007.1382 cliche-verre, printed in blue pigment, 2008.273 not titled [fishh] c.1976 each from one paper plate; letterpress Certificate for the independent Order etching, printed in black ink, from text on thin buff of Rechabitess 1889 one plate on white wove BFK Rives wove paper lithograph, printed in colour, from paper folio (closed) 34.8 x 30.3 cm multiple stones on thin yellowing plate-mark 21.6 x 18.4 cm Purchased with the assistance wove paper sheet 32.8 x 28.4 cm of James Agapitos, OAM, and image 44.2 x 31.6 cm Gift of Peter Cameron, 2007 Ray Wilson, OAM, 2007 sheet 50.2 x 38.2 cm 2007.1383 2007.938.1–7 Gift of John McPhee, 2008 not titled [brown and green shapes] CHEVALIER, Nicholas 2008.274 1977 Russia 1828 – England 1902 soft-ground etching, printed in brown working Australia 1854–67, New CALVERT, Samuel and green ink, from two plates on Zealand 1854–69, England from 1870 England 1828–1913 white wove BFK Rives paper TROEDEL, Charles (printer) working Australia 1848–88, plate-mark 28.6 x 35.2 cm Germany 1835 – Australia 1906 1894–c.1905 sheet 49.8 x 65.2 cm Australia from 1860 A Christmas scene on the Yarra 1866 Gift of Peter Cameron, 2007 from Illustrated Melbourne Post 2007.1384 N Chevalier’s album of wood-engraving, printed in black ink, not titled [green shapes] 1977 chromolithographs 1865 from one block on paper soft-ground etching, printed in green lithographs, printed in colour, each image (sight) 37.0 x 50.0 cm ink, from one plate on white wove from multiple stones on paper on sheet (sight) 37.0 x 50.0 cm BFK Rives paper thin white card 2007.408 plate-mark 35.0 x 32.6 cm folio (closed) 54.6 x 42.4 x 2.0 cm sheet 65.2 x 50.1 cm 2007.1297.1–12 CAMERON, Dorothy Gift of Peter Cameron, 2007 Australia 1917–2002 2007.1385 France 1970s
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 143 COUNIHAN, Noel closed active Australia 1988–92 Gift of Gregor Cullen, 2008 Australia 1913–1986 THEATRE SOUTH (client) 2008.257 Aotearoa New Zealand 1939–40; Golden Valley 1988 CULLEN, Gregor (designer) England, Europe 1949–52 screenprint, printed in colour, from born Australia 1954 Petty sessions 1958 six stencils on white paper CULLAGRAFFIX (design studio) screenprint, printed in black and image 76.2 x 48.6 cm closed active Australia 1988–92 purple ink, from two photo-stencils sheet 78.0 x 51.1 cm CULLEN, Gregor (printer) on cream wove paper Gift of Gregor Cullen, 2008 born Australia 1954 image 16.2 x 20.6 cm 2008.267 WOLLONGONG CITY GALLERY sheet 16.2 x 20.6 cm (client) Gordon Darling Australia Pacific CULLEN, Gregor (designer) Print Fund, 2007 born Australia 1954 Illawarra artist bicentennial 1988 2007.1299 CULLAGRAFFIX (design studio) screenprint, printed in colour, from closed active Australia 1988–92 six stencils on white paper CROOKE, Ray CULLEN, Gregor (printer) image 88.3 x 50.4 cm born Australia 1922 born Australia 1954 sheet 91.0 x 53.1 cm Island woman II 1968 LIVERPOOL CITY COUNCIL Gift of Gregor Cullen, 2008 monotype, printed in black ink, from (client) 2008.263 one plate on thick fibrous off-white Powerhouse regional arts centre 1990 CULLEN, Gregor (designer and wove paper screenprint, printed in colour, from printer) image 14.2 x 20.2 cm eight stencils on white paper born Australia 1954 sheet 15.0 x 20.8 cm image 88.4 x 52.0 cm CULLAGRAFFIX (design studio) 2007.363 sheet 91.0 x 54.5 cm closed active Australia 1988–92 Gift of Gregor Cullen, 2008 Island woman III 1968 SLOUGH, Stuart (printer) 2008.260 monotype, printed in black ink, from THEATRE SOUTH (client) one plate on thick fibrous off-white CULLEN, Gregor (designer) Mother courage 1992 wove paper born Australia 1954 screenprint, printed in colour, from image 14.1 x 18.8 cm CULLAGRAFFIX (design studio) three stencils on shiny white paper sheet 14.5 x 19.2 cm closed active Australia 1988–92 image 84.9 x 57.0 cm 2007.364 CULLEN, Gregor (printer) sheet 88.4 x 59.6 cm CULLEN, Gregor (designer) born Australia 1954 Gift of Gregor Cullen, 2008 born Australia 1954 SCHOOL OF CREATIVE ARTS 2008.265 CASULA POWER HOUSE (designer) (client) CULLEN, Gregor (designer) CULLEN, Gregor (printer) By popular demand 1989 born Australia 1954 born Australia 1954 screenprint, printed in colour, from CULLEN, Gregor (printer) CASULA POWER HOUSE (printer) eight stencils on white paper born Australia 1954 LIVERPOOL CITY COUNCIL image 81.2 x 51.8 cm CLASS CONSCIOUS SUSHI (client) sheet 83.8 x 54.4 cm (print workshop) Gift of Gregor Cullen, 2008 The Powerhouse youth theatre 1991 PROJECT CONTEMPORARY ART 2008.259 screenprint, printed in colour, from SPACE (client) nine stencils on white paper CULLEN, Gregor (designer) Onistkulture 1995 image 84.9 x 56.8 cm born Australia 1954 screenprint, printed in colour, from sheet 87.8 x 60.0 cm CULLAGRAFFIX (design studio) three stencils on white paper Gift of Gregor Cullen, 2008 closed active Australia 1988–92 image 70.0 x 50.0 cm 2008.256 CULLEN, Gregor (printer) sheet 73.8 x 53.8 cm CULLEN, Gregor (designer and born Australia 1954 Gift of Gregor Cullen, 2008 printer) THEATRE SOUTH (client) 2008.253 born Australia 1954 Slacky flat 1989 CULLEN, Gregor (designer) CULLAGRAFFIX (design studio) screenprint, printed in colour, from born Australia 1954 closed active Australia 1988–92 eight stencils on white paper CULLEN, Gregor (printer) CULLAGRAFFIX (printer) image 77.0 x 52.0 cm born Australia 1954 sheet 79.6 x 54.4 cm
144 CULLEN, Gregor (designer) CULLEN, Gregor (designer) COMMITTEE (client) born Australia 1954 born Australia 1954 Free at last 1994 CULLEN, Gregor (printer) REDBACK GRAPHIX (design screenprint, printed in colour, from born Australia 1954 studio) three stencils on white paper SOUTH COAST LABOUR Australia 1979–1994 image 60.6 x 42.2 cm COUNCIL (client) CULLEN, Gregor (printer) sheet 65.0 x 46.2 cm Chris Hani 1994 born Australia 1954 Gift of Gregor Cullen, 2008 screenprint, printed in colour, from REDBACK GRAPHIX 2008.254 six stencils on white paper (print workshop) image 88.6 x 60.4 cm Australia 1979–1994 CULLEN, Gregor (designer) sheet 91.0 x 63.0 cm WOLLONGONG CITY GALLERY born Australia 1954 Gift of Gregor Cullen, 2008 (client) CULLEN, Gregor (printer) 2008.262 Women and arts festival 1982 born Australia 1954 screenprint, printed in colour, from SCHOOL OF CREATIVE ARTS CULLEN, Gregor (designer) three stencils on white paper (print workshop) born Australia 1954 image 73.4 x 48.2 cm The tempest 1992 CULLEN, Gregor (printer) sheet 78.6 x 50.8 cm screenprint, printed in colour, from born Australia 1954 Gift of Gregor Cullen, 2008 five stencils on white paper THEATRE SOUTH (client) 2008.268 image 89.0 x 63.2 cm Windy Gully 1986 sheet 91.0 x 65.0 cm screenprint, printed in colour, from CULLEN, Gregor (designer and Gift of Gregor Cullen, 2008 eight stencils on white paper printer) 2008.258 image 65.4 x 92.4 cm born Australia 1954 sheet 76.3 x 102.0 cm SLAG GRAFFIX (print workshop) CULLEN, Gregor (designer) Gift of Gregor Cullen, 2008 ILLAWARRA RESIDENTS AGAINST born Australia 1954 2008.261 TOXIC ENVIRONMENTS (client) CULLEN, Gregor (printer) Contaminated heartland politics 1997 born Australia 1954 CULLEN, Gregor (designer) screenprint, printed in colour, from SCHOOL OF CREATIVE ARTS born Australia 1954 five stencils on white paper (client) CULLEN, Gregor (printer) image 52.2 x 42.2 cm Drawing on the Illawarra 1994 born Australia 1954 sheet 99.8 x 70.2 cm screenprint, printed in colour, from WOLLONGONG CITY GALLERY Gift of Gregor Cullen, 2008 four stencils on white paper (client) 2008.266 image 85.8 x 60.4 cm Bert Flugelman 1995 sheet 91.0 x 65.1 cm screenprint, printed in colour, from DE MEDICI, eX Gift of Gregor Cullen, 2008 three stencils on white paper born Australia 1959 2008.264 image 70.0 x 50.0 cm ATKINS, Ros (printer) sheet 91.0 x 65.0 cm born Australia 1957 CULLEN, Gregor (designer) Gift of Gregor Cullen, 2008 AUSTRALIAN PRINT WORKSHOP born Australia 1954 2008.255 (workshop) CULLEN, Gregor (printer) established Australia 1989 born Australia 1954 CULLEN, Gregor (designer) United spectres #3 2006 SLOUGH, Stuart (printer) born Australia 1954 etching, printed in black ink, from six WOLLONGONG CITY GALLERY IVAN DOUGHERTY GALLERY plates on paper (client) (client) image (each) 121.6 x 41.0 cm New Wollongong City Gallery 1991 established Australia 1977 sheet (each) 134.0 x 47.2 cm screenprint, printed in colour, from It’s about time 1995 sheet (overall) 268.0 x 141.6 cm eight stencils on white paper screenprint, printed in colour, from Gift of the artist, 2008 image 85.4 x 60.8 cm three stencils on white paper 2008.16 sheet 102.0 x 76.0 cm image 70.0 x 50.0 cm Gift of Gregor Cullen, 2008 sheet 102.0 x 76.0 cm DE SAINSON, Louis (print after) 2008.251 Gift of Gregor Cullen, 2008 France 1801–1887 2008.250 Australia and Pacific 1826–29
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 145 BELIN, A (lithographer) Vue d’Elisabeth-town. Ile Van- image 22.2 x 32.8 cm active France 1830s Diemen. c.1833 sheet 34.0 x 49.7 cm SAINT-AULAIRE, Felix Achille from Voyage de la corvette 2007.1536 (lithographer) l’Astrolabe. Atlas historique J. Tastu: born France 1801 Paris 1833 DE SAINSON, Louis (print after) active France c.1833 lithograph, printed in black ink, from France 1801–1887 TASTU, J (publisher) one stone on white wove paper Australia and Pacific 1826–29 active France c.1833 image 18.6 x 30.2 cm LEBORNE, Louis (lithographer) France 1796–1863 Vue de la rade de Hobart-town. Ile sheet 31.0 x 43.6 cm active France 1830s Van-Diemenn c.1833 2007.1534 BICHEBOIS, Louis-Philippe from Voyage de la corvette DE SAINSON, Louis (print after) Alphonse (lithographer) l’Astrolabe. Atlas historique J. Tastu: France 1801–1887 France 1801–1850 Paris 1833 Australia and Pacific 1826–29 active France 1830s lithograph, printed in black ink, from LEBORNE, Louis (lithographer) TASTU, J (publisher) one stone on white wove paper France 1796–1863 active France c.1833 image 22.2 x 32.8 cm active France 1830s sheet 34.3 x 51.4 cm Moulins a Blé dans les environs BICHEBOIS, Louis-Philippe 2007.1539 d’Hobart-townn c.1833 Alphonse (lithographer) from Voyage de la corvette DE SAINSON, Louis (print after) France 1801–1850 l’Astrolabe. Atlas historique J. Tastu: France 1801–1887 active France 1830s Paris 1833 Australia and Pacific 1826–29 TASTU, J (publisher) lithograph, printed in black ink, from BICHEBOIS, Louis-Philippe active France c.1833 one stone on white wove paper Alphonse (lithographer) Vue d’une habitation a New-Town. Ile image 20.1 x 33.5 cm France 1801–1850 Van-Diemenn c.1833 sheet 34.5 x 52.8 cm active France 1830s from Voyage de la corvette 2007.1547 HOSTEIN, Edouard Jean Marie l’Astrolabe. Atlas historique J. Tastu: (lithographer) Paris 1833 DE SAINSON, Louis (print after) France 1804–1886 lithograph, printed in black ink, from France 1801–1887 active France 1830s one stone on white wove paper Australia and Pacific 1826–29 TASTU, J (publisher) image 23.1 x 31.5 cm LEBORNE, Louis (lithographer) active France c.1833 sheet 34.5 x 48.2 cm France 1796–1863 active France 1830s Hobart-town Vue prise d’un ravin au 2007.1535 TASTU, J (publisher) Nord. Van Diemenn c.1833 DE SAINSON, Louis (print after) active France c.1833 from Voyage de la corvette France 1801–1887 l’Astrolabe. Atlas historique J. Tastu: Vue d’une habitation a new-town Australia and Pacific 1826–29 Paris 1833 c.1833 LEBORNE, Louis (lithographer) lithograph, printed in black ink, from lithograph, printed in black ink, from France 1796–1863 one stone on white wove paper one stone on white wove paper active France 1830s image 21.1 x 33.5 cm image 23.2 x 31.1 cm BICHEBOIS, Louis-Philippe sheet 34.4 x 51.6 cm sheet 34.0 x 52.8 cm Alphonse (lithographer) 2007.1538 2007.1545 France 1801–1850 DE SAINSON, Louis (print after) active France 1830s DE SAINSON, Louis (print after) France 1801–1887 TASTU, J (publisher) France 1801–1887 Australia and Pacific 1826–29 active France c.1833 Australia and Pacific 1826–29 HOSTEIN, Edouard Jean Marie Vue des défrichemens. Au pied du LEMERCIER, Alfred Leon (lithographer) Mont Wellington. Ile Van Diemen (lithographer) France 1804–1886 c.1833 HOSTEIN, Edouard Jean Marie active France 1830s from Voyage de la corvette (lithographer) LEMERCIER, Alfred Leon l’Astrolabe. Atlas historique J. Tastu: France 1804–1886 (lithographer) Paris 1833 active France 1830s TASTU, J (publisher) lithograph, printed in black ink, from TASTU, J (publisher) active France c.1833 one stone on white wove paper active France c.1833
146 TASTU, J (publisher) Open day Megalo Kingston, town. Van-Diemenn c.1833 active France c.1833 19th November 2000 2000 from Voyage de la corvette Eglise d’Elisabeth-town. Ile Van screenprint, printed in colour, from l’Astrolabe. Atlas historique J. Tastu: Diemenn c.1833 three screens on white wove paper Paris 1833 from Voyage de la corvette image 64.2 x 41.0 cm lithograph, printed in black ink, from l’Astrolabe. Atlas historique J. Tastu: sheet 65.0 x 42.0 one stone on white wove paper Paris 1833 Gift of the artist, 2007 image 24.6 x 37.6 cm lithograph, printed in black ink, from 2007.661 sheet 34.2 x 50.5 cm one stone on white wove paper FOX, Belinda 2007.1527 image 20.0 x 28.1 cm born Australia 1975 sheet 34.2 x 44.8 cm DE SAINSON, Louis (print after) 2007.1548 Hide and seek I c.2006 France 1801–1887 etching, printed in black ink, from Australia and Pacific 1826–29 DE SAINSON, Louis (print after) one plate; embossing and hand- LEMERCIER, Alfred Leon France 1801–1887 coloured on thick off-white (lithographer) Australia and Pacific 1826–29 wove paper KOEPPELIN (lithographer) NOËL, Alexis (lithographer) image 78.2 x 43.8 cm active France 1830s TASTU, J (publisher) sheet 78.2 x 43.8 cm TASTU, J (publisher) active France c.1833 Gordon Darling Australia Pacific active France c.1833 Hobart-town. Vue de Cote des Print Fund, 2007 Vue d’Hobart-townn c.1833 Casernes. Ile Van-Diemenn c.1833 2007.1294 from Voyage de la corvette from Voyage de la corvette Hide and seek II variation 2006 l’Astrolabe. Atlas historique J. Tastu: l’Astrolabe. Atlas historique J. Tastu: etching and linocut, printed in Paris 1833 Paris 1833 black ink, from one plate and block; lithograph, printed in black ink, from lithograph, printed in black ink, from embossing and one stone on white wove paper one stone on white wove paper hand-colouring on thick off-white image 25.8 x 42.9 cm image 24.5 x 40.6 cm wove paper sheet 34.5 x 52.9 cm sheet 34.4 x 52.6 cm image 78.5 x 43.8 cm 2007.1542 2007.1546 sheet 78.5 x 43.8 cm Gordon Darling Australia Pacific DE SAINSON, Louis (print after) DE SAINSON, Louis (print after) Print Fund, 2007 France 1801–1887 France 1801–1887 2007.1295 Australia and Pacific 1826–29 Australia and Pacific 1826–29 LEMERCIER, Alfred Leon SAINT-AULAIRE, Felix Achille FRANSELLA, Graham (lithographer) (lithographer) born England 1950 SORRIEUX, Frederic (lithographer) born France 1801 Australia from 1975 active France 1830s active France c.1833 AUSTRALIAN PRINT WORKSHOP TASTU, J (publisher) TASTU, J (publisher) (print workshop) active France c.1833 active France c.1833 established Australia 1989 New-Townn c.1833 Vue de Hobart-town. Prise de la rade. Reflection 2004 from Voyage de la corvette Ile Van-Diemenn c.1833 lithograph, printed in red and black l’Astrolabe. Atlas historique J. Tastu: from Voyage de la corvette ink, from two stones on white wove Paris 1833 l’Astrolabe. Atlas historique J. Tastu: paper lithograph, printed in black ink, from Paris 1833 image (irregular) 37.0 x 43.0 cm one stone on white wove paper lithograph, printed in black ink, from sheet 76.6 x 57.0 cm image 22.6 x 30.0 cm one stone on white wove paper Gift of the Australian Print sheet 34.0 x 49.7 cm image 19.7 x 35.6 cm Workshop, 2007 2007.1544 sheet 34.0 x 52.0 cm 2007.688 2007.1541 DE SAINSON, Louis (print after) FRAZER, David France 1801–1887 DEVERSON, Clint born Australia 1966 Australia and Pacific 1826–29 born Australia 22 February 1977 A collection of 30 linocut bookplates NOËL, Alexis (lithographer) Megalo Access Arts Inc 2000–2001 BELIN, A (lithographer) established 1980 Gift of David De Campo, 2007 active France 1830s 2007.1350–2007.1379
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 147 GILL, S T two stencils on thin buff wove paper A collection of 117 etchings and England 1818 – Australia 1880 image 37.0 x 53.4 cm lithographs 1994–2007 Australia from 1839 sheet 52.0 x 66.6 cm Gift of Ross Griffith, 2008 ALLAN & WIGLEY (printer) Gordon Darling Australia and Pacific 2008.460–2008.576 closed active Australia 1853–68 Print Fund, 2008 MADER, F (publisher) 2008.82 GRIFFITH, Pamela born Australia 1943 Kangaroo Hunting Nos 1–33 c.1860 GLOVER, Henry Europe 1972–73, 1981–82 lithographs, printed in colour, England 1827 – Australia 1904 KINGSTON, Peter each from two stones (black image Australia from 1848 born Australia 1943 and text, buff tint stone) on paper EDGAR RAY & CO (publisher) DJANDJOMERR, Tim subsequently laid down on thin card established 1857 – closed Australia sheet 37.6 x 53.0 cm On the occasion of APEC Australia Printers and Publishers. [F.9397] 1859 2007.365.1–3 2007 Sydney 2007 12 hours road scraping in Melbourne: folio GILL, S T scraped from the streets and sketched folio (closed) 63.8 x 47.4 cm England 1818 – Australia 1880 on stone 1857 Gift of APEC Australia 2007, 2008 Australia from 1839 lithographs, printed in black ink, each 2008.459.1–3 DE GRUCHY & LEIGH (printer) from one stone on thin buff wove Australia 1858 – AustraIia 1866 paper HARRIS, Brent born Aotearoa New Zealand 1956 A city of Melbourne solicitor 1866 book (closed) 13.8 x 22.0 cm Australia from 1981 chalk-lithograph, printed in black ink, 2007.366.1–12 from one stone on buff wove paper To the river 2004 GLOVER, Henry image 28.2 x 21.8 cm lithograph, printed in colour, from England 1827 – Australia 1904 sheet 39.6 x 29.4 cm multiple blocks on thick off-white Australia from 1848 2007.1523 wove paper ROBINSON (printer) image 33.2 x 35.6 cm On the Board of Works 1866 active Australia 1858 sheet 54.8 x 58.0 cm chalk-lithograph, printed in black ink, YORKE, Chas (publisher) Gift of the artist, 2008 from one stone on buff wove paper active Australia 1858 2008.454 image 27.5 x 21.3 cm Old Stylee c.1858 sheet 42.5 x 31.2 cm chalk-lithograph, printed in black ink, HARRIS, Brent 2007.1525 from one stone; hand-coloured on born Aotearoa New Zealand 1956 Australia from 1981 GLEESON, James white wove paper KING, Martin (printer) born Australia 1915 image 32.3 x 23.7 cm born Australia 1957 England, Europe 1947–49; Europe, text 44.2 x 28.3 cm USA 1958–59 2007.1526 Heritage (Lithographic diptych) 2004 offset-lithograph, printed in colour, not titled [signed monotype] c.1950 GLOVER, John from four plates on paper monotype, printed in colour, from England 1767 – Australia 1849 image (each) 65.0 x 60.0 cm one plate on medium brown laid Ford Australia from 1831 sheet (each) 105.8 x 75.0 cm 428 Mill paper Blasted oakk c.1797 Gift of the artist, 2008 image (irregular) 27.8 x 21.0 cm softground etching, printed in black 2008.448.A–B sheet 28.4 x 22.2 cm ink, from one plate on thin cream Purchased with the assistance laid paper HARRIS, Brent of James Agapitos, OAM, and plate-mark 27.6 x 25.2 cm born Aotearoa New Zealand 1956 Ray Wilson, OAM, 2007 sheet 41.8 x 33.2 cm Australia from 1981 2007.1002 Gift of John McPhee, in honour of RAWLING, Larry (printer) born Australia 1938 GLEGHORN, Thomas Gina and Ted Gregg of Hobart and GRANT, Mark (publisher) born England 1925 Sydney, 2008 Australia from 1928; UK, Europe 2008.272 Otherness- series 1992 1962–63, 1970 screenprints, printed in colour, from GRIFFITH, Pamela multiple stencils on Arches Satine Mediaeval landscape 1963 born Australia 1943 water colour 300 gsm paper screenprint, printed in colour, from Europe 1972–73, 1981–82 image (each) 38.0 x 31.5 cm
148 Gift of the artist, 2008 The river 1940–50s Gift of the artist, 2008 2008.449 etching, printed in black ink, from 2008.447.1–3 Grotesquerie 2002 one plate on thin cream wove paper Swamp no.8 2001 woodcut, printed in colour, from one plate mark 13.0 x 20.0 cm screenprint, printed in colour, from interlocking block on Japanese paper sheet 25.0 x 18.0 cm two stencils on Arches Satine water image 63.5 x 50.0 cm 2007.413.1 colour 300 gsm paper sheet 79.0 x 65.2 cm The river 1940–50s image 152.0 x 61.0 cm Gift of the artist, 2008 etching, printed in black ink, from sheet 175.2 x 81.0 cm 2008.450 one plate on thin cream wove paper Gift of the artist, 2008 Grotesquerie (no.11) 2002 plate mark 13.0 x 20.0 cm 2008.456 woodcut, printed in colour, from one sheet 20.4 x 28.0 cm Swamp no.6 2001 interlocking block on Japanese paper 2007.413.2 screenprint, printed in colour, from image 63.5 x 50.00 cm JACKS, Robert two stencils on Arches Satine water sheet 80.0 x 65.4 cm born Australia 1943 colour 300 gsm paper Gift of the artist, 2008 image 152.0 x 75.0 cm 2008.451 Two four-part drawings 1977 stamped drawing, in green ink on off- sheet 175.8 x 95.0 cm The Untimely (no.7) 1998 white wove paper Gift of the artist, 2008 woodcut, printed in colour, from one book (closed) 15.2 x 11.4 cm 2008.457 interlocking block on Japanese paper Gift of the artist, 2007 On Becoming (Yellow no.3) 1996 image 60 x 45.5 cm 2007.354 screenprint, printed in colour on sheet 74.3 x 53.5 cm Arches Satine 300 gsm paper Gift of the artist, 2008 JAKUPA JR, Pax image 95.0 x 51.4 cm 2008.452 born Papua New Guinea 1978 sheet 122.0 x 77.5 cm The Untimely (no.3) 1998 KING, Martin (printer) Gift of the artist, 2008 woodcut, printed in colour, from one born Australia 1957 2008.458 interlocking block on Japanese paper AUSTRALIAN PRINT WORKSHOP image 60 x 45.5 cm (print workshop) HARRIS, Brent sheet 74.3 x 53.5 cm established Australia 1989 born Aotearoa New Zealand 1956 Gift of the artist, 2008 Australia from 1981 Mask 2005 2008.455 Valentine Printing (printer) etching, printed in red and yellow ink, from two plates on paper GRANT, Mark (publisher) HOLDEN, Patti image 44.0 x 31.0 cm On Becoming (Yellow no.1) 1998 born Australia 19 December 1926 sheet 57.0 x 38.0 cm screenprint, printed in colour on Self portrait 2004 Gordon Darling Australia Pacific artist’s edition on Magnani Litho linocut, printed in colour, from Print Fund, 2007 1310, 310 gsm multiple blocks on white wove BFK 2007.403 image 42.2 x 56 cm Rives paper Bun b’long tumbuna 2005 sheet 49.5 x 69 cm image 30.4 x 20.0 cm etching, printed in black and yellow Gift of the artist, 2008 sheet 37.7 x 27.5 cm ink, from two plates on paper 2008.453 Gordon Darling Australia Pacific image 31.0 x 44.0 cm Print Fund, 2007 HARRIS, Brent (printer) sheet 38.0 x 57.0 cm 2007.1291 born Aotearoa New Zealand 1956 Gordon Darling Australia Pacific Australia from 1981 HUNTER, William Print Fund, 2007 WESTCOTT, Kim (printer) Isle of Man 1899 – Australia 1963 2007.404 born Australia 1968 Australia by 1910 United States 1993–95 KLUGE-POTT, Hertha Moon radiance, Hampton 1940–1960 GRANT, Mark (publisher) born Germany 1934 etching, printed in black ink, from Australia from 1958 Grotesquerie (le regarder) 2001 one plate; hand-coloured on paper Melaleuka 2005 woodcut, printed in colour, from one image 20.4 x 19.2 cm etching and drypoint, printed in black interlocking block on Japanese paper sheet (sight) 23.0 x 20.0 cm ink with plate tone, from one plate on image 63.5 x 50.00 cm 2007.411 sheet 79.4 x 65.0 cm thick off-white wove
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 149 BFK Rives paper Arches 88 paper MARSDEN, David plate-mark (each) 44.7 x 49.5 cm image 71.8 x 52.0 cm born Australia 1949 sheet (each) 54.0 x 60.0 cm sheet 76.6 x 57.4 cm One x Four 1997 Gordon Darling Australia Pacific Gordon Darling Australia Pacific lithographs, printed in black ink, Print Fund, 2008 Print Fund, 2008 each from one stone on thick mottled 2008.152.1–4 2008.79.1 cream paper Euphemisms for a riotous suburb 2 sheet 57.0 x 44.4 cm KOGAN, Danial c.2007 Gift of Denise Campbell, Bea Childproof 1993 screenprint, printed in colour, from Maddock, David Marsden and Penny linocuts, printed in black ink, each multiple photo-stencils; additions in Mason, 2007 from one block; chine colle addtions, gouache and graphite; 2007.1316.1–4 red ink, ; gold leaf, on off-white wove medium weight shellac on four types of hand-made Arches 88 paper MAGUIRE, Marian paper (Kardi from India and Nepalese image 71.8 x 52.0 cm born Aotearoa New Zealand 1962 paper) sheet 76.6 x 57.4 cm PAPERGRAPHICA (publisher) sheet (each) 56.0 x 78.8 cm Gordon Darling Australia Pacific established Aotearoa New Zealand Purchased with the generous Print Fund, 2008 1995 assistance of Vicki Vidor OAM, 2008 2008.79.2 The Odyssey adapted 2006 2008.276.1–28 Euphemisms for a riotous suburb i screenprints, printed in black ink, from one stencil on medium white LAUVERGNE, Barthelemy (print (white) 2006 laid paper after) off-set lithograph, printed in black book (closed) 19.8 x 15.0 cm France 1805–1875 ink, from one plate; pen and ink Gift of the artist, 2008 BICHEBOIS, Louis-Philippe additions on smooth white 2008.270 Alphonse (lithographer) archival lithographic paper France 1801–1850 image 69.2 x 50.3 cm The Iliad abbreviated 2003 active France 1830s sheet 86.8 x 59.2 cm screenprints, printed in black ink, BENARD & BICHEBOIS Gordon Darling Australia Pacific from one stencil on medium white (lithographer) Print Fund, 2008 wove paper TASTU, J (publisher) 2008.79.3 book (closed) 14.0 x 10.4 cm active France c.1833 Gift of the artist, 2008 MACDONALD, Fiona 2008.271 Vue de midway-house. Sur le chemin born Australia 1956 d’Elisabeth-town. Ile Van-Diemen COLLEGE OF FINE ART DIGITAL MAGUIRE, Tim c.1833 LAB (print workshop) born England 1958 from Voyage de la corvette Movement 2007 Australia 1959–93; Germany 1984–85; l’Astrolabe. Atlas historique J. Tastu: digital print, printed in colour on France and England from 1993 Paris 1833 Hahnemühle 285 gsm photo rag Folio of seven monoprints 1982 lithograph, printed in black ink, from paper monoprints one stone on white wove paper image 59.1 x 67.5 cm folio (closed) 69.0 x 57.0 cm image 20.9 x 32.7 cm sheet 75.5 x 90.8 cm case 71.4 x 59.0 cm sheet 34.3 x 49.2 cm Gordon Darling Australia Pacific Gift of Sarah Miller and Derek 2007.1537 Print Fund, 2008 Kreckler, 2008 LEWIS, Ruark 2008.80 2008.269.1–8 born Australia 1960 MADDOCK, Bea MANIFOLD, Marion France 1991 born Australia 1934 born Australia 1954 BIG FAG PRESS (print workshop) England, Europe 1959–61, Canada established Australia 2005 Rosy dreams: from the verandah of 1978 Purrumbete 2007 Euphemisms for a riotous suburb 1 MASON, Penny linocut, printed in black ink, from 2007 born Australia 12 April 1950 one block; fabric collage addition on screenprint, printed in colour, from CAMPBELL, Denise white wove BFK Rives paper multiple photo-stencils; additions in born Australia 1952 image (overall) 61.8 x 99.2 cm gouache and graphite; nd 1974–75, 1080–81, England sheet (overall) 76.0 x 113.2 cm on off-white wove medium weight 1983–84
150 Behind the mask 1996–97 from multiple stones on Velin Arches 2008.14.A–B computer-generated book paper Spring: Purrumbete from across the book (closed) 21.3 x 29.8 x 0.8 cm folio (closed) 62.0 x 46.8 cm lake 2007 Gordon Darling Australia and Pacific Gift of anonymous donor linocut, printed in black and red ink, Print Fund, 2008 2008.13.1–4 from two blocks on BFK Rives 2008.81 NEESON, John P image 70.2 x 113.4 cm MCGILL, Clyde born Australia 1948 sheet 76.4 x 113.4 cm born 1949 Gift of the artist, 2007 Gunns series, 1–4 1996 2008.15.A–B Hiroshima notes 2006 etching, aquatint and open bite, resist medium (wax) wash on thin printed in colour, from multiple MASON, Penny Japanese-style paper and brown wove plates on thick off-white laid paper born Australia 12 April 1950 paper plate-mark (each) 50.0 x 51.0 cm Imagining Here 2005 book (closed) 22.0 x 31.0 x 0.9 cm sheet (each) 71.0 x 62.0 cm lithograph, printed in colour, from Gordon Darling Australia Pacific Gift of the artist, 2008 multiple stones on thick off-white Print Fund, 2007 2008.432.1–4 laid paper 2007.405 Blood [1–99] 1997 image 32.5 x 44.5 cm Borders (and burning boats) 2006 from Warrior x 9 sheet 49.5 x 63.5 cm etching and screenprint, printed in etching and open-bite, printed in 2007.399 colour with plate tone, on multiple colour, from multiple plates on thick Imagining here 2005 plates and stencils; also white wove paper lithograph, printed in colour, from glue and waxed paper collage on plate-mark (each) 35.2 x 35.8 cm multiple stones on thick off-white paper, card and fabric sheet (each) 70.4 x 49.6 cm laid paper book (closed) 31.0 x 44.8 x 1.0 cm Gift of the artist, 2008 image 38.0 x 46.0 cm Gordon Darling Australia Pacific 2008.434.1–9 sheet 50.0 x 62.2 cm Print Fund, 2007 Neri wall- wind blows around him- 2007.400 2007.406 broken wings 1993 etching, aquatint and open-bite, The illusion of I 2005 MCMAHON, Marie (designer) printed in colour, from multiple lithograph, printed in colour, from born Australia 11 September 1953 plates on thick off-white laid paper multiple stones on thick off-white REDBACK GRAPHIX (design plate-mark 49.6 x 50.2 cm laid paper studio) sheet 70.6 x 65.8 cm image 49.0 x 36.5 cm Australia 1979–1994 Gift of the artist, 2008 sheet 67.0 x 49.8 cm MCMAHON, Marie (printer) 2008.435 2007.434 born Australia 11 September 1953 REDBACK GRAPHIX Harvest wall- right become wrong MAURIN, A (print after) (print workshop) 1999 active 1833 Australia 1979–1994 etching, aquatint and open-bite, LEMERCIER, Alfred Leon JOBS FOR WOMEN ACTION printed in colour, from multiple (lithographer) COMMITTEE (client) plates on thick white wove paper TASTU, J (publisher) plate-mark 50.4 x 50.8 cm Rosie the riveter 1981 active France c.1833 sheet 73.8 x 60.0 cm screenprint, printed in colour, from JSC Dumont D’Urvillee c.1833 Gift of the artist, 2008 multiple stencils from Voyage de la corvette 2008.436 image 73.6 x 48.8 cm l’Astrolabe. Atlas historique J. Tastu: sheet 76.0 x 50.8 cm Emotional weather report. Too damn Paris 1833 Gift of Gregor Cullen, 2008 good 1993 lithograph, printed in black ink, from 2008.252 etching and open bite, printed in one stone on white wove paper colour, from multiple plates on thick image 27.6 x 24.5 cm MURPHY, Idris white wove Arches paper sheet 51.6 x 34.0 cm born Australia 1949 plate-mark 50.0 x 49.8 cm 2007.1543 ATELIER CHAMPFLEURY sheet 76.0 x 56.4 cm (print workshop) Gift of the artist, 2008 MCCORMACK, Christine 2008.437 born Australia 1953 The Eucumbene suite 1987 CTHONIC PRESS (printer) lithographs, printed in colour, each
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 151 Neri wall. You laugh so hard 1993 Gift of the artist, 2008 TASTU, J (publisher) etching and open bite, printed in 2008.443 active France c.1833 colour, from multiple plates on thick Barbed blood 1984 Indigenes des deux sexes. Van- white wove BFK Rives paper from Warrior x 9 Diemenn c.1833 plate-mark 50.4 x 50.2 cm etching and open bite, printed in from Voyage de la corvette sheet 72.2 x 56.8 cm colour, from multiple plates on thick l’Astrolabe. Atlas historique J. Tastu: Gift of the artist, 2008 off-white wove Arches paper Paris 1833 2008.438 plate-mark 50.0 x 50.0 cm lithograph, printed in black ink, from Stoneflower. Western region of my sheet 75.4 x 56.6 cm one stone on white wove paper M.H.- real cold feet 1991 Gift of the artist, 2008 image 21.3 x 32.0 cm etching and open bite, printed in 2008.444 sheet 34.4 x 52.8 cm colour, from multiple plates on thick Wild dead things 1985 2007.1540 off-white wove Arches paper from Warrior x 9 PARR, Mike plate-mark 50.2 x 50.0 cm etching and open bite, printed in born Australia 1945 sheet 75.8 x 56.4 cm colour, from multiple plates on thick LOANE, John (printer) Gift of the artist, 2008 off-white laid paper born Australia 1950 2008.439 plate-mark 50.6 x 50.0 cm VIRIDIAN PRESS (print workshop) Emotional weather report. Sound sheet 75.3 x 56.0 cm established Australia 1988 of thunder- how far off I sat and Gift of the artist, 2008 wondered 1991 2008.445 Dirty manna 2000 woodcuts, printed in red ochre ink, etching and open bite, printed in Easy when you’re dreaming 1984 each from one ply-wood block on 14 colour, from multiple plates on thick etching and aquatint, printed in sheets of Velin Arches off-white wove Arches paper colour, from multiple plates on thick 400 gsm paper plate-mark 50.2 x 50.0 cm off-white wove Arches paper image (each) 120.0 x 90.0 cm sheet 76.0 x 56.2 cm plate-mark 49.8 x 71.0 cm sheet (each) 120.0 x 90.0 cm Gift of the artist, 2008 sheet 57.0 x 76.0 cm overall 239.0 x 360.0 cm 2008.440 Gift of the artist, 2008 Gift of Linda Gregoriou and Dale Emotional weather report. Abstract 2008.446 Jones-Evans, 2008 threats too noble to ignore 1991 2008.92.A–N etching and open bite, printed in NEILSON, Marina colour, from multiple plates on thick born Australia 1970 Polish mud 1995 off-white wove Arches paper Looking at you looking at me 2007 drypoint and lift-ground aquatints, plate-mark 50.2 x 49.8 cm etching, printed in black ink, from printed in colour, each from 2 copper sheet 75.8 x 56.0 cm one plate on Hahnemühle paper plates on 12 sheets Gift of the artist, 2008 image 44.4 x 29.6 cm white wove Hahnemühle 350 gsm 2008.441 sheet 53.6 x 39.0 cm stained paper image (each) 107.2 x 78.6 cm So long old friend 1983 Gordon Darling Australia Pacific sheet (each) 107.2 x 78.6 cm from Warrior x 9 Print Fund, 2007 Gift of Mike Parr and John Loane, etching and open bite, printed in 2007.1289 2008 colour, from multiple plates on thick The trouble with my bear is … 2007 2008.114.A–L off-white wove Arches paper etching, printed in black ink, from plate-mark 56.7 x 50.0 cm one plate on Hahnemühle paper Stick into eye 1993 sheet 76.0 x 57.2 cm image 44.2 x 39.6 cm etching and aquatints, printed in Gift of the artist, 2008 sheet 53.8 x 39.0 cm colour, each from two plates on 12 2008.442 Gordon Darling Australia Pacific sheets of white wove Hahnemühle 350 gsm paper Man in armour 1984 Print Fund, 2007 image (each) 107.6 x 78.8 cm from Warrior x 9 2007.1290 sheet (each) 107.6 x 78.8 cm etching and open bite, printed in NIEL, Monsieur (print after) Gift of Sara Kelly, 2008 colour, from multiple plates on thick LEMERCIER, Alfred Leon 2008.115.A–L off-white wove Fabriano paper (lithographer) plate-mark 56.4 x 50.2 cm The psychopathic family 1994 MAURIN, A (lithographer) sheet 68.0 x 57.0 cm lift-ground aquatints, printed in black active 1833 ink, each from one copper plate on 12
152 PROCTOR, Thea The sensitive plant 1938 white wove Hahnemühle 350 gsm Australia 1879–1966 from Series surreal paper England 1903–12, 1914–21 etching, printed in black ink, from image (each) 107.5 x 78.5 cm The Batherss c.1918 one plate on cream wove paper sheet (each) 107.5 x 78.5 cm lithograph, printed in red ink, from plate-mark 7.8 x 9.2 cm Gift of Mike Parr, 2008 one stone on paper sheet 19.0 x 28.0 cm 2008.117.A–L image 30.7 x 29.0 cm Gift of James Agapitos, OAM, and sheet (sight) 33.3 x 31.0 cm Ray Wilson, OAM, 2007 PIGUENIT, W C mount 59.4 x 50.3 cm 2007.917 Australia 27 August 1836–17 July 2007.407 1914 ROBINSON, William England 1898, 1900 PULE, John born Australia 1936 HENN, M L (lithographer) born Niue 1962 ATELIER FRANCK BORDAS The Salmon Ponds and vicinity New Aotearoa, New Zealand from 1964 (print workshop) established France 1978 Norfolk Tasmania 1867 Mahalahala 1996 lithographs, printed in colour, each lithograph, printed in black ink, from Notre Dame 2006 from two stones (black image, buff one stone on thick off-white wove lithograph, printed in colour, from tint stone) on white wove paper Somerset paper multiple stones on Arches satine book (closed) 33.4 x 50.8 cm image 58.8 x 42.8 cm paper 2007.367.1–6 sheet 76.0 x 56.6 cm image 38.6 x 29.4 cm Gift of Theo Tremblay in celebration sheet 56.5 x 38.5 cm POWER, John Wardell of the NGA 25th anniversary, 2008 Gift of the artist, 2008 Australia 1881 – England 1943 2008.118 2008.321.1 England from 1906; France 1920–22 Luxembourg I 2006 L’homme calculateur 1937 RAYNER, Henry lithograph, printed in colour, from linocut, printed in brown ink, from Australia 1902 – England 1957 multiple stones on Arches satine one block on wove buff paper England from 1924 paper image 30.8 x 23.6 cm My path is a rose, even as this plain image 29.0 x 42.8 cm sheet (sight) 31.8 x 24.5 cm 1938 sheet 38.5 x 50.5 cm Purchased with the assistance etching and drypoint, printed in black Gift of the artist, 2008 of James Agapitos, OAM, and ink, from one plate on cream wove 2008.321.2 Ray Wilson, OAM, 2007 paper Luxembourg II 2006 2007.1111 plate-mark 14.2 x 21.7 cm lithograph, printed in colour, from sheet 28.6 x 27.8 cm PRESTON, Margaret multiple stones on Arches satine Gift of James Agapitos, OAM, and Australia 1875–1963 paper Ray Wilson, OAM, 2007 Germany, France 1904–07, France, image 33.0 x 43.8 cm 2007.914 England, Ireland 1912–19 sheet 38.5 x 55.5 cm The eternal stream 1938 Gift of the artist, 2008 Spring magnoliaa c.1932 etching, printed in black ink, from 2008.321.3 woodcut, printed in black ink, from one plate on cream wove paper one block; hand-coloured on paper Petit Pont 2006 plate-mark 14.0 x 2.8 cm image 26.0 x 26.2 cm lithograph, printed in colour, from sheet 19.0 x 28.0 cm sheet (sight) 29.5 x 28.6 cm multiple stones on Arches satine Gift of James Agapitos, OAM, and 2007.361 paper Ray Wilson, OAM, 2007 image 29.0 x 40.2 cm The snail 1949 2007.915 sheet 38.5 x 56.5 cm snencil print, printed in colour, from The man with the ass’s head 1938 Gift of the artist, 2008 one hand-cut stencil on thin black etching, printed in black ink, from 2008.321.4 card one plate on cream wove paper image 29.8 x 21.0 cm Pont des Arts 2006 plate-mark 10.4 x 9.0 cm sheet 29.8 x 21.0 cm lithograph, printed in colour, from sheet 27.8 x 19.4 cm 2007.362 multiple stones on Arches satine Gift of James Agapitos, OAM, and paper Ray Wilson, OAM, 2007 image 28.6 x 39.8 cm 2007.916 sheet 38.5 x 56.5 cm
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 153 Gift of the artist, 2008 The hut, Gippsland 1956 Johannot paper 2008.321.5 soft-ground etching and aquatint, book (closed) 28.9 x 22.5 cm Bofinger 2006 printed in warm black ink, from one Purchased with the assistance lithograph, printed in colour, from plate on cream wove paper of James Agapitos, OAM, and multiple stones on Arches satine plate-mark 12.0 x 16.5 cm Ray Wilson, OAM, 2007 paper sheet 17.0 x 25.0 cm 2007.1134.1–27 sheet 39.2 x 28.8 cm Gift of the artist, 2008 STRINGER, John image 56.5 x 38.5 cm 2008.62 Australia 1937–2007 Gift of the artist, 2008 Child away 1955 United States 1970–1988 2008.321.6 soft-ground etching and aquatint, Icarus falling 1960 Rue Saint Antoine 2006 printed in warm black ink, from one woodcut, printed in colour, from lithograph, printed in colour, from plate on cream wove paper multiple blocks on thin cream multiple stones on Arches satine plate-mark 17.0 x 13.0 cm lithographic paper paper sheet 21.5 x 16.0 cm image 45.6 x 31.5 cm image 29.0 x 39.4 cm Gift of the artist, 2008 sheet 49.8 x 36.6 cm sheet 38.5 x 56.5 cm 2008.63 Gordon Darling Australia Pacific Gift of the artist, 2008 Skipping Rhymes 1956 Print Fund, 2007 2008.321.7 Skipping Rhymes: A collection of 2007.1288 Le Louvre 2006 Australian skipping rhymes collected lithograph, printed in colour, from and illustrated by Robert THORPE, Lesbia multiple stones on Arches satine folio-bound linocuts, printed in born Australia 1919 paper colour, from two blocks; typesetting Europe 1960–62, 1972–75; Taiwan image 38.8 x 28.8 cm on thin off-white wove paper 1976–78 sheet 56.5 x 38.5 cm book closed 25.0 x 19.4 book open 25.0 x 38.5 A collection of 33 prints 1950s-1980s Gift of the artist, 2008 Gift of the artist, 2007 2008.321.8 Gift of the artist, 2008 2008.64.1–14 2007.1317–2007.1349 Rue des Rosiers 2006 lithograph, printed in colour, from SCHMEISSER, Jörg TIPPING, Richard Kelly multiple stones on Arches satine born Germany 1942 born Australia 1949 paper Australia from 1976 Sign here 1992–2004 image 28.8 x 38.8 cm A collection of 42 etchings 1978–1999 printed signs in boxed carry case on sheet 38.5 x 56.5 cm Gordon Darling Australia Pacific varnished wooden carry-case with Gift of the artist, 2008 Print Fund, 2007 engraved title 2008.321.9 2007.1413–2007.1434 box (closed) 25.0 x 74.4 x 8.6 cm Chartres 2006 Gordon Darling Australia Pacific lithograph, printed in colour, from STRACHAN, David Print Fund, 2008 multiple stones on Arches satine England 1919 – Australia 1970 2008.154.1–47 paper Australia 1921–36; England, France image 44.4 x 29.4 cm 1936–38; Australia 1938–48; UK, TRAILL, Jessie sheet 56.5 x 38.5 cm Europe 1948–60; Australia Australia 1881–1967 Gift of the artist, 2008 from 1960 England, Europe frequently after 1906 2008.321.10 KERSHAW, Alister (author) From overseas 1913 Australia 1921 – France 1995 etching, printed in sepia ink, from ROONEY, Robert MURRAY, Jacques (printer) one plate on thin cream wove paper born Australia 1937 active 1950s plate-mark 30.2 x 48.6 cm Stand 1956 STRAMUR-PRESSE (publisher) 2007.401 soft-ground etching and aquatint, France 1951–1953 Le portail, St Maclou 1927 printed in warm black ink, from one Accent and hazard 1951, 24 etching, printed in colour, from two plate on cream wove paper September plates on cream laid paper plate-mark 12.0 x 16.5 cm etchings, aquatints, printed in black plate-mark 25.4 x 19.6 cm sheet 15.2 x 19.0 cm and colour, each from one plate on sheet 45.8 x 26.8 cm Gift of the artist, 2008 white wove Velin de 2007.402 2008.61
154 1932 VALIS, Fred CICADA PRESS (print workshop) etching and aquatint, printed in sepia Creation of Woman 1979 established Australia 2003 ink, from one plate on thin cream mezzotint, printed in black ink, from A collection of 412 prints printed by wove paper one plate on thick off-white wove Michael Kempsonn 2003–2007 plate-mark 27.8 x 25.1 cm paper 2007.414 plate-mark 18.8 x 9.2 cm Gordon Darling Australia Pacific Autumn 1922 card closed 21.6 x 10.8 cm Print Fund, celebrating the etching, printed in brown ink, from card (opened) 21.6 x 21.6 cm National Gallery of Australia’s 25th one plate on thin cream wove paper Gift of Tom Trauer, 2008 anniversary, 2007 plate-mark 38.0 x 42.2 cm 2008.307 2007.1549 2007.1296 Not titled [female face over lily pondd] 1979 VARIOUS ARTISTS TRAUER, Robert mezzotint, printed in black ink, from LOANE, John (printer) born Czechoslovakia 1913 – died one plate on thick off-white wove born Australia 1950 Australia paper VIRIDIAN PRESS (print workshop) A collection of 51 prints 1960s-1980s plate-mark 14.7 x 11.8 cm established Australia 1988 Gift of Tom Trauer, the artist’s son, card closed 21.8 x 15.1 cm A collection of 121 prints printed by 2008 card (opened) 21.8 x 30.2 cm John Loane 1990–2006 n n Gift of Tom Trauer, 2008 Gift of John Loane, 2007 2008.308 2007.1550–2007.1670 TSE, Jonathan Tiki 1976 born Hong Kong 1967 VARIOUS ARTISTS Australia from 1975 mezzotint, printed in black ink, from one plate on thick off-white wove LOANE, John (printer) Portrait of an Australian 1998 paper born Australia 1950 screenprint, printed in colour, from plate-mark 17.8 x 8.4 cm VIRIDIAN PRESS (print workshop) established Australia 1988 multiple plates on white wove paper card closed 20.0 x 11.4 cm book (closed) 12.2 x 8.5 x 0.4 cm card (opened) 20.0 x 22.8 cm A collection of 228 prints printed by Gordon Darling Australia Pacific Gift of Tom Trauer, 2008 John Loane 1990–2006 Print Fund, 2007 2008.309 Gordon Darling Australia Pacific 2007.1292 Print Fund, celebrating the VARIOUS ARTISTS National Gallery of Australia’s 25th TYERS, Jenny anniversary, 2007 born 1969 A collection of 6 invitations and acceptances from Melbourne women 2007.1435–2007.1662 The woman, the hares, the volcano artists of the 1930ss c.1930 VARIOUS ARTISTS and the rare bird 2002 Gift of Bridget McDonnell, 2008 RAWLING, Larry (printer) etchings, printed in black ink, each 2008.331.1–6 from one plate; hand-coloured on born Australia 1938 etching printed on thick VARIOUS ARTISTS LARRY RAWLING PRINT off-white wove paper WORKSHOP (print workshop) A collection of 26 political posters book closed 27.4 x 28.0 x 2.0 cm established Australia 1984 1970s-1990s book open 27.4 x 55.6 cm Gift of Martin Munz, 2007 A collection of 647 screenprints Gordon Darling Australia and Pacific 2007.1387–2007.1412 printed by Larry Rawling 1966–2007 Print Fund, 2008 Purchased with the assistance 2008.155 VARIOUS ARTISTS of the Gordon Darling Australia Pacific Print Fund, celebrating the UNIDENTIFIED ARTIST A collection of 106 prints, artist books, matrix elements and National Gallery of Australia’s 25th Melbourne steeplechasee c.1850s documentationn 1966–2007 anniversary, 2008 chalk-lithograph, printed in black ink, Gift of Larry Rawling, 2008 2008.94 from one stone; hand-coloured on 2008.325–2008.431 white wove paper VARIOUS ARTISTS image 15.0 x 27.0 cm VARIOUS ARTISTS REDBACK GRAPHIX (design sheet 17.0 x 27.0 cm KEMPSON, Michael (printer)born studio) 2007.1524 Australia 1961 established 1979 – closed 1983
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 155 A collection of 47posters produced by AUSTRALIAN PRINT WORKSHOP KING, Inge REDBACK GRAPHIXX 1979–1994 (print workshop) born Germany 1918 established Australia 1989 England 1939–49; Europe, USA Gordon Darling Australia Pacific Paradise rifle birds 2004 1949–50; Australia from 1951 Print Fund lithograph, printed in colour, from Animal shapes in spacee c.1948 2008.277–2008.323 multiple stones on white wove paper carved and polished marble image (irregular) 46.6 x 38.4 cm 24.0 x 37.0 x 18.0 cm WHITE, Robin sheet 76.4 x 56.8 cm Purchased with the assistance born Aotearoa New Zealand 1946 Gift of the Australian Print of James Agapitos, OAM, and Kiribati 1982–99 Workshop, 2007 Ray Wilson, OAM, 2007 Bee hive 2005 2007.689 2007.1067 stencil, printed in colour, from three stencils on woven wool bale SCULPTURE KLIPPEL, Robert image 72.2 x 54.1 cm Australia 1920–2001 BAYLISS, Clifford sheet 72.2 x 54.1 cm England, France 1947–50; USA Australia 1916 – England 1989 Gordon Darling Australia Pacific 1957–63, 1966–67 England from 1935 Print Fund, 2007 Number 38, Child’s god 1948 2008.157 Totemic figuree c.1945 carved walnut wood with ball carved and drilled wood Fan for the fighting man 2005 bearings 24.0 x 10.0 x 8.0 cm photographic digital prints on silk 42.0 x 10.0 x 13.0 Purchased with the assistance and bamboo fans Purchased with the assistance of James Agapitos, OAM, and box (closed) 25.0 x 18.8 x 4.2 cm of James Agapitos, OAM, and Ray Wilson, OAM, 2007 each (extended) 22.7 x 39.7 cm Ray Wilson, OAM, 2007 2007.930 Gordon Darling Australia Pacific 2007.1073 Print Fund, 2007 BOYD, Arthur MAREK, Dusan 2008.158.1–7 Australia 1920–1999 Czechoslovakia 1926 – Australia 1993 England, Australia, Italy from 1959 WIGLEY, James Australia 1948–54; Papua New Australia 1918–1999 The bridee c.1953 Guinea 1954–59; Australia from 1959 France, England 1948–52 glazed and coloured terracotta not titled [dolll] c.1953 79.0 x 50.0 x 45.0 cm McLeod and mob in jaill c.1956 painted and carved wood Purchased with the assistance etching, printed in black ink, from 13.2 x 2.5 cm of James Agapitos, OAM, and one plate on white wove paper Gift of James Agapitos, OAM, and Ray Wilson, OAM, 2007 image 25.0 x 19.6 cm Ray Wilson, OAM, 2007 2007.934 sheet (sight) 28.8 x 22.4 cm 2007.869 Gordon Darling Australia and Pacific Ned Kellyy c.1954 MCAUSLAN, Gordon Print Fund, 2008 glazed and coloured terracotta Aotearoa New Zealand 1913 – 2008.85 72.0 x 43.0 x 50.0 cm Purchased with the assistance Australia 1996 WILSON, Dora of James Agapitos, OAM, and Australia from 1936 England 1883 – Australia 1946 Ray Wilson, OAM, 2007 Rexx c.1950 Australia from childhood; England, 2007.935 brass Europe 1927–29 38.0 x 9.0 x 9.0 cm HORN, Timothy Ti tree shade Gift of James Agapitos, OAM, and born Australia 1964 etching, printed in black ink, from Ray Wilson, OAM, 2007 Europe 1993–96; USA from 2002 one plate on paper 2007.880 plate-mark 15.0 x 11.4 cm Stheno 2006 OLIVER, Bronwyn sheet (sight) 16.7 x 12.8 cm silicone rubber, copper tubing, fibre Australia 1959–2006 2007.412 optics 152.0 x 101.0 x 101.0 cm Garland 2006 WOLSELEY, John Purchased with the assistance of the copper wire born England 1938 American Friends of the National 115.0 x 115.0 x 7.0 cm France 1961–63; Europe 1971, Gallery of Australia, 2008 2008.180 1974–75; Australia from 1976 2008.107
156 Bush relief web 1956 International Art Australia 1919 – England 1977 jarrah, wire, iron, nails England from 1948 65.0 x 67.0 x 17.0 cm DECORATIVE ARTS Figure with spikes 1954 Gift of Christopher and Philip DAUM FRÈRES (manufacturer) cast bronze with black patina Constable in memory of their mother established France 1887 42.0 x 13.0 x 12.0 cm Esther Constable, 2007 Gift of James Agapitos, OAM, and 2007.370 Rain vasee c.1900 Ray Wilson, OAM, 2007 not titled [small jarrah sculpture] glass: acid-etched and enamelled 2007.918 c.1965 28.0 x 13.0 x 13.0 cm carved jarrah Gift of Diana Woollard ROBERTS, Douglas 42.0 x 23.0 x 16.0 cm 2008.196 Australia 1919–1976 Gift of Christopher and Philip LALIQUE, René not titled [surrealist carvingg] c.1950 Constable in memory of their mother born France 1860 – died France carved and painted wood Esther Constable, 2007 60.0 x 7.0 x 7.0 cm 2007.371.A–B Design drawing for a choker necklace Purchased with the assistance not titled [small metal sculpture with (Collier de Chien)) c.1904 of James Agapitos, OAM, and corkk] 1955–56 pencil, ink and gouache on Blanchet Ray Wilson, OAM, 2007 wire, cork, wood base Frères Kléber linseed-oil treated 2007.1124.A–B 18.8 x 8.0 x 8.0 cm vegetable paper Gift of Christopher and Philip 28.1 x 22.1 cm STAUNTON, Madonna Constable in memory of their mother 2007.426 born Australia 1938 Esther Constable, 2007 Design drawing for a necklacee c.1901 Gods and heroes 2005 2007.372 pencil, ink and gouache on Blanchet glass bottles, perspex numbers, cloth, Frères Kléber linseed-oil treated collage of photographic and printed VALAMANESH, Hossein vegetable paper images in weathered and painted born Iran 1949 28.2 x 21.9 cm wooden frame Australia from 1973 2007.427 18.8 x 55.6 x 4.6 cm Touch love 2006 Design drawing for a brooch (Broche 2007.395 crown of thorn (Euphorbia milii) and à pendentif)) c.1904 ribbon on paper pencil and gouache on Blanchet SWALLOW, Ricky overall 112.0 x 429.0 x 3.0 cm Frères Kléber linseed-oil treated born Australia 1974 2007.1283.A–D vegetable paper USA 2002, England 2003–2006, USA 28.0 x 22.0 cm from 2006 VASSILIEFF, Danila 2007.428 Tusk 2007 Russia 1897 – Australia 1958 Design drawing for a comb (Peigne cast bronze with white patina Australia 1923–29; Central and South du centre ‘Glycenes’))) c.1899 50.0 x 105.0 x 6.0 cm America, Europe, England 1929–35; pencil, ink and gouache on Blanchet Gift of the Prescott Family Australia from 1935 Frères Kléber linseed-oil treated Foundation, 2008 Female formm c.1952 vegetable paper 2008.204 carved wood 28.0 x 22.0 cm 60 x 35.5 x 22 cm TAYLOR, Howard 2007.429 Gift of James Agapitos, OAM, and Australia 1918–2001 Ray Wilson, OAM, 2007 WAGNER, Siegfried (designer) United Kingdom 1938–49; United 2007.923 Denmark 1874–1952 Kingdom, Europe 1961–62 Animall c.1951 BING & GRØNDAHL Bush cylinderr c.1957 carved and polished Lilydale (manufacturer) galvanised iron limestone established Denmark 1853 2430.0 x 60.0 x 60.0 cm 18.3 x 30.0 x 14.0 cm Jar with lid November 1898 Gift of Christopher and Philip Purchased with the assistance porcelain with modelled and painted Constable in memory of their mother of James Agapitos, OAM, and underglaze decoration Esther Constable, 2007 Ray Wilson, OAM, 2007 23.5 cm, 29.0 cm (diam.) 2007.369 2007.1138 2007.430.A–B
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 157 PHOTOGRAPHY album closed 31.5 x 27.8 x 2.4 cm The Poynton Bequest, 2008 open album 31.5 x 44.0 cm 2008.182 ARION, Herr album page 32.4 x 27.0 cm working United States of America photograph (each) 11.5 x 9.0 cm ERNST, Max c.1899 image oval 8.5 x 8.9 cm Germany 1891 – France 1976 also worked in the United States of Unititled album 1899 2007.1306 America from the series PRINT PERET, Benjamin Photographien Arions California- France 1899–1959 Reise [Photographs Arion’s BASELITZ, Georg La brebis galante [The gallant sheep] Californian Journeyy] born Germany 1938 1949 95 gelatin silver photographs and Remix 2006 etching, aquatint, lithograph, pochoir, albumen silver photographs eleven etchings, aquatints and letterpress open album 22.0 x 58.5 x 7.0 cm drypoints, printed in black ink with page 24.2 x 38.6 cm album closed 22.0 x 32.0 x 9.5 cm yellow plate tone, printed from two comp 12.8 x 10.0 cm sheet (each) 20.4 x 29.0 cm plates The Poynton Bequest, 2008 2007.1307 sheet 85.0 x 65.0 cm 2008.210 N, Pushpamala The Poynton Bequest, 2007 GAUGUIN, Paul born India 1956 2008.90.1–11 France 1848 – French Polynesia 1903 ARNI, Clare BECKMANN, Max born Great Britain 1962 Manao Tupapaou 1894 Germany 1884 – United States of lives and works in India lithograph America 1950 comp 18.0 x 27.0 cm The Native Types: A series of Frauenbad [Women’s bath house] sheet 42.7 x 59.2 cm photographs illustrating the scenery 1922 The Poynton Bequest, 2008 and the mode of life of the drypoint 2008.181 women of South India 2001–4 comp 43.5 x 28.5 cm 8 Type C colour photographs and 2 sheet 53.0 x 47.6 cm HOCKNEY, David gelatin silver photographs The Poynton Bequest, 2008 born Great Britain 1937 sheet (each) 61.0 x 50.8 cm 2008.205 worked in the United States of 2007.908.1–10 America CASSATT, Mary TUNG, Hing The diploma 1962 United States 1844–1926 born China – died Hong Kong etching and aquatint Hélène de Septeuil 1889–90 sheet 55.5 x 39.5 cm Foochow panorama 1870 drypoint printed in brown ink The Poynton Bequest, 2008 3 albumen silver photographs sheet 24.1 x 16.2 cm 2008.206 composition 21.0 x 83.5 cm The Poynton Bequest, 2008 2008.89.A–C Gretchen and the snurl 1961 2008.208 etching printed from five plates VARIOUS 19TH AND 20TH CÉZANNE, Paul sheet 28.0 x 79.0 cm CENTURY PHOTOGRAPHERS France 1839–1906 The Poynton Bequest, 2008 Approximately 7000 Asia–Pacific 2008.207 Portrait of Guillaumin with the photographs, archival material and ‘Hanged man’ 1873 KANDINSKY, Wassily books 1860–1940 etching Russia 1866 – France 1944 2007.440–2007.442 comp 15.8 x 11.6 cm Germany France Sweden sheet 30.0 x 19.3 cm WATSON, William (attributed to) Kleine Welten I 1922 Gift of Margaret Olley AC, 2007 BORN DIED 5NITED 3TATES OF !MERICA from the series Kleine Welten 2007.1268 working United States of America (Small worlds) 1890s DEGAS, Edgar colour lithograph Kodak album of views of San France 1834–1917 comp 25.0 x 22.5 cm Francisco, Colorado, Sacramento, sheet 35.5 x 27.7 cm La sortie du bainn c.1882 Almedaa c.1890 Gift of Tony and Carol Berg in drypoint and aquatint 104 gelatin silver photographs honour of the National Gallery of comp 12.7 x 12.7 cm Australia’s 25th Anniversary
158 MARCOUSSIS, Louis of her parents Prof. F H Reuter and 2007.1269 Poland 1878 – France 1941 Mrs I Reuter Kleine Welten II 1922 Eaux-fortes pour Alcools de 2007.1518.1–5 from the series Kleine Welten Guillaume Apollinaire [etchings for Tsukioka Yoshitoshi (Small worlds) Guillaume Apollinaire’s Alcools] Japan 1839–1892 colour lithograph 1934 comp 26.2 x 22.0 cm etching Looking in pain: the appearance of a sheet 34.5 x 27.5 cm portfolio 19.1 x 12.7 cm prostitute of the Kansei era 1888 Gift of Tony and Carol Berg in The Poynton Bequest, 2008 from the series Thirty-two aspects of honour of the National Gallery of 2007.1661.1–44 customs and manners Australia’s 25th Anniversary colour woodblock 2007 MASEREEL, Frans sheet 38.0 x 24.0 cm 2007.1270 Belgium 1889–1972 The Poynton Bequest, 2007 France 2007.1532 Kleine Welten III 1922 Die Passion eines Menschen [One from the series Kleine Welten YOSHITSUYA, Utagawa man’s passion] 1924 (Small worlds) Japan 1822–1866 colour lithograph woodcut comp 27.8 x 23.0 cm page 22.0 x 18.5 cm Spirit of the Cherry Tree 1842–44 sheet 33.0 x 27.5 cm Gift of Dorothy Danta in memory colour woodblock The Poynton Bequest, 2007 of her parents Prof. F H Reuter and sheet 38.0 x 24.0 cm 2007.1309 Mrs I Reuter The Poynton Bequest, 2007 2007.1519 2007.1529 Kleine Welten IV 1922 from the series Kleine Welten PICASSO, Pablo YZAY, Charles (Small worlds) Spain 1881 – France 1973 BORN DIED &RANCE colour lithograph Pelican cigarettes 1934 comp 26.7 x 25.6 cm L’Homme au chien (rue Schelcher) lithograph sheet 34.0 x 28.9 cm [Man with a dog (rue Schelcher)] sheet 79.4 x 58.9 cm The Poynton Bequest, 2007 1915 The Poynton Bequest, 2007 2007.1310 etching with plate tone, scraping on copper plate 2007.1533 image 27.8 x 21.8 cm KUNISADA I, Utagawa THEATRE ART Japan 1786–1865 sheet 37.5 x 28.0 cm The Poynton Bequest, 2007 Kabuki puppets after 1844 MATISSE, Henri (designer) 2007.1308 colour woodblock France 1869–1954 sheet 36.0 x 25.0 cm SELIGMANN, Kurt LES BALLETS RUSSES DE SERGE The Poynton Bequest, 2007 born Switzerland 1900 DIAGHILEV (producer) 2007.1530 France United States established 1909 – closed 1929 COURTHION, Pierre Hat from costume for a Courtier 1920 MAGRITTE, René wool felt, wire, paint Belgium 1898–1967 Les vagabondages héraldiques 1934 28.0 cm ELUARD, Paul fifteen etchings with aquatint 2008.233 France 1895–1952 comp 34.8 x 24.4 cm Switzerland France (1914) page 50.8 x 38.4 cm The Poynton Bequest, 2008 Moralité du sommeil [Morality of 2008.211 sleep] 1941 lineblock printed in black ink from STRUCK, Hermann one block; letterpress printed in black Germany 1876–1944 ink page 18.4 x 13.8 cm Die Kunst des Radierens [The Art of comp 16.6 x 8.2 cm Etchingg] 1920 The Poynton Bequest, 2008 etching, lithograph 2008.209 page 23.0 x 18.4 cm Gift of Dorothy Danta in memory
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 159 Pacific Art Kapriman people Female figure 1850–1950 OBJECT wood, fibre, pigment, patina 70.0 x 16.0 x 10.0 cm Iatmul people 2008.174 Gable mask from a Haus Tambaran cane, sago leaf fibre, pigment Roviana People 124.0 x 100.0 cm Portrait bust of a Young Man 2008.153 1870–1900 Orators stool [kawa rigitt] wood, nautilus shell, human hair, wood, shell, ochre patinas, pigment 122.0 x 51.0 x 45.0 cm 33.0 x 26.0 x 22.0 cm 2008.173 2007.431 Bridal veil [Ambusap] SALLE, Mathew shell, fibre born Tatau village 1969 77.0 x 20.0 cm 2008.175 Cockerel and Snake fighting [turuu] 2004 Maori people wood, ochres, shell Maori Cloak [Huakii] 1800–1835 38.0 x 104.0 cm New Zealand Flax 2008.232 143.0 x 242.0 cm SAWOS people 2007.616 Spirit figure from a house post Te Fenua Enata People [Wundjumbuu] 1850–1910 War club [U’uu] Garamut wood wood, fibre 145.0 x 44.0 cm 151.5 x 25.0 cm 2007.379 2008.185 Tigoana SCULPTURE Solomon Islands 1900–1966 Prehistoric stone mortar and pestle Figure of a diety [Adaro] c.1940 4000–2000 BC wood, patinas, shell stone 82.0 x 19.0 x 16.0 cm 20.0 x 33.0 x 25.0 cm 2008.109 2008.116.A–B
Aitu people Chieftain’s seat [No’oangaa] 1800–1860 Tamanu wood 16.0 x 50.0 x 23.0 cm 2007.433
Chuukese people Pounder [Phouu] 19th century Coral 16.0 x 7.5 cm 2007.432
160 APPENDIX 5 TOTAL ACQUISITIONS INCLUDING PURCHASES AND GIFTS 2002–03 TO 2007–08
9931 1063 10994 2007–08
968 289 1257 2006–07
755 834 1589 2005–06 FINANCIAL YEAR 858 1157 2015 2004–05
356 175 531 2003–04
376 219 595 2002–03
0 2000 4000 6000 8000 10 000 12 000
ACQUISITIONS
Total number of purchases Total number of gifts
Note: Purchases in 2007–08 include a collection of approximately 7000 Indonesian photographs and a number of large print archives.
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 161 APPENDIX 6 EXHIBITIONS AND NEW DISPLAYS SHOWN AT THE NATIONAL GALLERY OF AUSTRALIA 2007–08
Tools and techniques of printmaking Richard Larter: a retrospective 14 April – 22 July 2007 20 June – 14 September 2008
VIP: very important photographs 1840s to 1940s Aboriginal and Torres Strait Islander Art* 26 May – 19 August 2007 Completed 21 December 2007 Completed 27 June 2008 George W Lambert retrospective: heroes and icons 29 June – 16 September 2007 Australian Art* Completed 18 August 2007 Drawn in Completed 12 October 2007 14 July 2007– 30 March 2008 Completed 26 April 2008
Pacific gallery Asian Art* Open 18 July 2007 Completed 29 September 2007 Completed 1 March 2008 Australian nineteenth and early twentieth century works of art International Art* Open 1 September 2007 Completed 16 September 2007 Completed 17 November 2007 Robert Rauschenberg 1967–1978 Completed 29 February 2008 1 September 2007 – 27 January 2008 Completed 9 May 2008
Black robe white mist: art of the Japanese Buddhist *Denotes permanent collection rehang nun Rengetsu 8 September 2007 – 27 January 2008
Contemporary Australian art from the permanent collection 8 September 2007 – 27 January 2008
Foyer displays of Pacific art, art of the Americas and art of Africa Open 27 September 2007
Culture Warriors: National Indigenous Art Triennial 13 October 2007 – 10 February 2008
Australian Surrealism: the Agapitos/Wilson collection 16 February – 11 May 2008
Turner to Monet: the triumph of landscape 14 March – 9 June 2008
Treescape 12 April – 3 August 2008
East Asian gallery Open 12 April 2008
162 APPENDIX 7 ATTENDANCE 2002–03 TO 2007–08
502 320 404 285 158 909 1065514 2007–08
487 888 100 172 98 328 686388 2006–07
419 896 382 290 29 785 831971 2005–06 FINANCIAL YEAR 400 884 426 193 1351 828428 2004–05
371 554 1 060 680 95 591 1527825 2003–04
367 547 1 291 880 4281 1663708 2002–03
0 500 000 1 000 000 1 500 000 2 000 000 ATTENDANCE
TOTAL NUMBER OF VISITORS TO THE NATIONAL TO NATIONAL GALLERY TO NATIONAL GALLERY GALLERY IN CANBERRA EXHIBITIONS IN AUSTRALIA EXHIBITIONS INTERNATIONALLY
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 163 APPENDIX 8 TRAVELLING EXHIBITIONS 2007–08
An artist abroad: the prints of James McNeill Whistler Grace Crowley: being modern Tour dates: 5 August 2006 – 4 November 2007 Tour dates: 27 July 2007 – 23 November 2008 Geelong Art Gallery, Victoria, 7 June – 19 August 2007 Art Gallery of South Australia, Adelaide, SA, 1UEEN 6ICTORIA -USEUM !RT 'ALLERY ,AUNCESTON 4AS 27 July – 28 October 2007 1 September – 4 November 2007 Hawkesbury Regional Art Gallery, NSW, 21 December 2007 – 17 February 2008 Stage fright: the art of theatre Mornington Peninsula Regional Gallery, Vic., Tour dates: 6 October 2006 – 28 October 2007 19 March – 18 May 2008 Port Pirie Regional Art Gallery, SA, Art Gallery of Western Australia, Perth, WA, 15 June 2007 – 29 July 2007 14 June – 21 September 2008 Lake Macquarie City Art Gallery, Booragul, NSW, 14 September – 28 October 2007 Ocean to Outback: Australian landscape painting 1850–1950 Michael Riley: sights unseen Tour dates: 4 August 2007 – 17 May 2009 Tour dates: 16 November 2006 – 27 April 2008 Tamworth Regional Gallery, NSW, Dubbo Regional Gallery, Dubbo, NSW, 4 August – 22 September 2007 12 May – 8 July 2007 Tasmanian Museum and Art Gallery, Hobart, Tas., and concurrently Moree Plains Gallery, Moree, NSW, 5 October – 25 November 2007 19 May – 15 July 2007 Riddoch Art Gallery, Mt Gambier, SA, Museum of Brisbane, Queensland, 8 December 2007 – 20 January 2008 27 July – 18 November 2007 Ballarat Fine Art Gallery, Vic., 2 February – 30 March 2008 Art Gallery of NSW, Sydney, 22 February – 27 April 2008 Lawrence Wilson Art Gallery, Perth, WA, 13 April – 1 June 2008 Imagining Papua New Guinea: prints from the Cairns Regional Gallery, Qld, 21 June – 27 July 2008 national collection Tour dates: 14 April 2007 – 18 April 2009 War: the prints of Otto Dix Artspace Mackay, Qld, 13 July – 26 August 2007 Tour dates: 30 November 2007 – 1 February 2009 Noosa Regional Gallery, Qld, Art Gallery of South Australia, Adelaide, SA, 9 November – 5 December 2007 30 November 2007 – 28 January 2008 Tweed River Regional Art Gallery, Tweed River, NSW, National Gallery of Victoria, Melbourne, Vic., 13 December 2007 – 3 February 2008 12 April – 10 August 2008 Grafton Regional Gallery, Grafton, NSW, 12 March – 20 April 2008 Culture Warriors: National Indigenous Art Triennial Tamworth Regional Gallery, Tamworth, NSW, Proudly supported by BHP Billiton; the Australia Council 17 May – 29 June 2008 for the Arts through its Aboriginal and Torres Strait Islander Art Board, Visual Art Board and Community Colin McCahon Partnerships and Market Development (International); Tour dates: 16 June 2007 – 19 October 2008 the Contemporary Touring Initiative through Visions of Australia, an Australian Government program, and the 1UEEN 6ICTORIA -USEUM !RT 'ALLERY ,AUNCESTON Tasmania, 16 June – 2 September 2007 Visual Arts and Craft Strategy, an initiative of the Australian Dell Gallery @ QCA, Brisbane, Qld, Government and state and territory governments; and 19 September – 28 October 2007 the Queensland Government through the Queensland Christchurch Art Gallery Te Puna O Waiwhetu, Indigenous Arts Marketing and Export Agency. New Zealand, 8 March – 8 June 2008 Tour dates: 20 June 2008 – 10 May 2009 Art Gallery of South Australia, Adelaide South Australia, 20 June – 31 August 2008
164 Glenview State School This exhibition is supported by Patron Ann Lewis, Harmony Montessori School AM, Qantas and National Gallery of Australia Council Maleny Artists Exhibitions Fund Pacific Lutheran College Tour dates: 10 October – 30 December 2007 Home Schooling Group at Caloundra Regional Art Gallery The Andy Warhol Museum, Pittsburgh, USA, Bli Bli State school 10 October – 30 December 2007 Caloundra Art Centre Association Maleny Library Black robe white mist: art of the Japanese Buddhist nun Montville State School Rengetsu Peachester State School Supported by the Japan Foundation and the Australia– Gold Creek School, Nicholls, ACT, 14–28 November 2007 Japan Foundation Yar ralumla Primary School, Yarralumla, ACT, Tour dates: 20 February – 28 June 2008 13 December 2007 Hamilton Art Gallery, Vic., 20 February – 30 March 2008 ‘Explore the Elaine and Jim Wolfensohn Gift Travelling RMIT Gallery, Melbourne, Vic., 6 June – 28 June 2008 Exhibitions Suitcases’ Children’s workshop, National Gallery of Australia, Canberra, ACT, 22 January 2008 Borenore Public School, Borenore, NSW, Elaine & Jim Wolfensohn Gift 29 January – 29 February 2008 Travelling Exhibitions Isis District State High School, Childers Qld, Suitcase Kits 6 March – 3 April2008 Blue case: technology Riddoch Art Gallery, Mount Gambier SA, 7 April – 1 May 2008 Walter Nicholls Memorial Gallery, Port Lincoln, SA, Southwest Arts Hay, NSW, 5 May – 9 July 2008 4 June – 1 July 2007 Tocumwal Primary School, Tocumwal, NSW Manning Regional Art Gallery, Taree, NSW, Deniliquin Out of School Care, Deniliquin, NSW 9 July – 30 September 2007 St Mary’s Catholic Primary School, Hay, NSW Coraki Rural Transaction Centre, Coraki, NSW, Deniliquin Nth Primary, Deniliquin, NSW 8 October – 30 November 2007 Bunaloo primary, Bunaloo, NSW Coraki Primary School, Coraki, NSW St Michael’s Primary, Deniliquin, NSW St Josephs Primary School, Coraki, NSW Barham Primary, Barham, NSW Biraban Public School, Toronto, NSW, Coleambally Aged Facility, Coleambally, NSW 30 November – 10 December 2007 St Peters Primary Coleambally, Coleambally, NSW Yarralumla Primary School, Yarralumla, ACT, Coleambally Central School, Coleambally, NSW 13 December 2007 Darlington Point – Aged Care Facility, Darlington Geraldton Regional Art Gallery, Geraldton, WA, Point, NSW 3 March – 4 April 2008 Barham High, Barham, NSW The Australian Prospectors and Miners Hall of Fame, Wakool Primary, Wakool, NSW Kalgoorlie, WA, 10 April – 28 April 2008 Blighty Primary, Blighty, NSW Cooloola Shire Public Gallery, Gympie Qld, 2–10 June 2008 Barooga Primary, Barooga, NSW Gympie State High School, Gympie, Qld Edward Primary School, Deniliquin, NSW James Nash State High School, Gympie, Qld Tin Can Bay State School, Tin Can Bay, Qld The 1888 Melbourne Cup Cooloola Christian College, Gympie, Qld Mary Valley State College, Imbil, Qld Hawkesbury Regional Gallery, Windsor, NSW, Kilkivan State School, Kilkivan, Qld 1 August – 19 October 2007 Toowoomba Regional Art Gallery, Toowoomba, Qld, Latrobe Regional Gallery, Latrobe, Vic., 16 June – 13 July 2008 25 October 2007 – 10 January 2008 Newcastle Region Art Gallery, Newcastle, NSW, Red case: myths and rituals and Yellow case: form, space 3 March – 3 April 2008 and design Caloundra Regional Art Gallery, Caloundra, Qld, 16 July – 21 September 2007 The River School, Maleny, Qld Meridan College, Caloundra, Qld
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 165 APPENDIX 9 OUTWARD LOANS TO EXHIBITIONS – AUSTRALIA AND INTERNATIONAL
OUTWARD LOANS TO EXHIBITIONS AUSTRALIA Outward loans in Australia totalled 539.
AUSTRALIAN CAPITALTERRITORY FROM TO AUSTRALIAN WAR MEMORIAL Icon and archive: Australian war Australian War Memorial 6 June 2008 12 October 2008 photography 1860–1945 (7 works) NATIONAL LIBRARY OF AUSTRALIA National treasures from Australia’s National Library of Australia 3 December 2005 12 February 2006 great libraries State Library of Victoria 10 March 2006 7 May 2006 (3 works) Tasmanian Museum and Art Gallery 26 May 2006 23 July 2006 State Library of New South Wales 26 August 2006 22 October 2006 State Library of Queensland 17 November 2006 7 January 2007 Flinders University Art Museum – City Gallery 26 January 2007 25 March 2007 Museum and Art Gallery of the 13 April 2007 10 June 2007 Northern Territory Western Australian Museum 30 June 2007 26 August 2007 A modern vision: Charles Bayliss, National Library of Australia 11 July 2008 26 October 2008 photographer 1850–1897 (7 works) Bridging the distance National Library of Australia 6 March 2008 15 June 2008 (1 work) NATIONAL MUSEUM OF AUSTRALIA Dhari a krar: headdresses and National Museum of Australia 28 June 2006 1 June 2008 masks of the Torres Strait (3 works) Utopia: the genius of Emily Kame National Museum of Art, Osaka 26 February 2008 13 April 2008 Kngwarreye National Art Center Tokyo 28 May 2008 28 July 2008 (4 works) National Museum of Australia 21 August 2008 12 October 2008 NATIONAL PORTRAIT GALLERY, CANBERRA Reveries: portraiture, photography National Portrait Gallery, Canberra 27 April 2007 19 August 2007 and mortality University Art Museum, The University of 7 September 2007 14 October 2007 (6 works) Queensland Mornington Peninsula Regional Gallery 19 March 2008 18 May 2008 Portraits by John Brack National Portrait Gallery, Canberra 24 August 2007 18 November 2007 (6 works) Biography National Portrait Gallery, Canberra 21 September 2007 21 October 2007 (16 works) continued
166 THE DRILL HALL GALLERY Creative fellows The Drill Hall Gallery 9 August 2007 16 September 2007 (20 works) Smile of the Buddha: image of The Drill Hall Gallery 1 November 2007 17 December 2007 enlightenment (5 works) Vivienne Binns The Drill Hall Gallery 14 February 2008 30 March 2008 (2 works)
(80 works loaned in the Australian Capital Territory)
NEW SOUTH WALES FROM TO ART GALLERY OF NEW SOUTH WALES Sidney Nolan a new retrospective Art Gallery of New South Wales 3 November 2007 3 February 2008 (16 works) NGV Australia 22 February 2008 18 May 2008 Queensland Art Gallery 6 June 2008 28 September 2008 Bertram Mackennal: the Art Gallery of New South Wales 17 August 2007 4 November 2007 fifth Balnaves Foundation National Gallery of Victoria 15 November 2007 20 January 2008 sculpture project (5 works) Intimate encounters: Indian Art Gallery of New South Wales 8 March 2008 8 May 2008 paintings from Australian collections (10 works) Jan Senbergs: from screenprinter Art Gallery of New South Wales 5 April 2008 25 May 2008 to painter (9 works) Harold Cazneaux: artist in Art Gallery of New South Wales 1 June 2008 31 August 2008 photography (14 works) AUSTRALIAN NATIONAL MARITIME MUSEUM Commemorating Nelson 1805–2005 Australian National Maritime Museum 21 September 2005 21 September 2009 (1 work) Jellyfish: nature inspires art Australian National Maritime Museum8 August 2007 2 March 2008 (4 works) BATHURST REGIONAL ART GALLERY Janet Dawson survey 1953–2006 Bathurst Regional Art Gallery 30 November 2006 28 January 2007 (22 works) The Drill Hall Gallery 22 February 2007 8 April 2007 S H Ervin Gallery 12 May 2007 10 June 2007 University Art Museum, The University of 7 July 2007 19 August 2007 Queensland Tasmanian Museum and Art Gallery 6 September 2007 21 October 2007 Mornington Peninsula Regional Gallery 30 October 2007 2 December 2007 HAWKESBURY REGIONAL GALLERY BloodLines: art and the horse Hawkesbury Regional Gallery 1 August 2007 14 October 2007 (13 works) continued
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 167 HAZELHURST REGIONAL GALLERY & ARTS CENTRE (AZELHURST 2EGIONAL 'ALLERY !RTS #ENTRE 23 March 2008 11 May 2008 from 1770 (1 work) HISTORIC HOUSESTRUST OF NEW SOUTH WALES Homes in the sky: apartment living Museum of Sydney 12 May 2007 26 August 2007 in Sydney (3 works) MANLYART GALLERY & MUSEUM Harbourlife: Sydney Harbour from -ANLY !RT 'ALLERY -USEUM 30 November 2007 13 January 2008 the 1940s to recent times Macquarie University Art Gallery 23 January 2008 8 March 2008 (1 work) MUSEUM OF CONTEMPORARY ART, SYDNEY Paddy Bedford Museum of Contemporary Art, Sydney 7 December 2006 15 April 2007 (1 work) Art Gallery of Western Australia 12 May 2007 22 July 2007 Bendigo Art Gallery 11 August 2007 16 September 2007 University Art Museum, The University of 16 November 2007 1 March 2008 Queensland Fiona Hall: force field Museum of Contemporary Art, Sydney 6 March 2008 1 June 2008 (4 works) City Gallery, Wellington 4 July 2008 2 November 2008 Christchurch Art Gallery Te Puna o Waiwhetu 4 December 2008 1 March 2009 NEWCASTLE REGION ART GALLERY Tracing the meridian: the drawings Newcastle Region Art Gallery 15 December 2007 10 February 2008 of William Dobell (17 works) Sky high: John Olsen’s ceiling Newcastle Region Art Gallery 3 November 2007 27 January 2008 commissions (1 work) About men: Lucian Freud Newcastle Region Art Gallery 18 August 2007 28 October 2007 (1 work) ORANGE REGIONAL GALLERY Cuisine and country Orange Regional Gallery 6 April 2007 20 May 2007 (6 works) Lake Macquarie City Art Gallery 8 June 2007 22 July 2007 Mornington Peninsula Regional Gallery 28 August 2007 21 October 2007 Wagga Wagga Regional Art Gallery 26 October 2007 6 January 2008 Riddoch Art Gallery 12 January 2008 2 March 2008 Broken Hill Regional Art Gallery 3 March 2008 30 April 2008 -ANLY !RT 'ALLERY -USEUM 16 May 2008 15 June 2008 Cairns Regional Gallery 4 July 2008 24 August 2008 Artspace Mackay 29 August 2008 12 October 2008 PENRITH REGIONAL GALLERY & THE LEWERS BEQUEST Peter Upward retrospective 0ENRITH 2EGIONAL 'ALLERY 4HE ,EWERS 20 October 2007 2 December 2007 (3 works) Bequest continued
168 THE BIENNALE OF SYDNEY Revolutions – forms that turn Art Gallery of New South Wales 18 June 2008 7 September 2008 (17 works) Museum of Contemporary Art, Sydney 18 June 2008 7 September 2008
(149 works loaned in New South Wales)
QUEENSLAND FROM TO QUEENSLAND ART GALLERY Queensland Art Gallery 9 November 2007 5 May 2008 of Kenneth Macqueen (5 works) QUEENSLAND ART GALLERY, GALLERY OF MODERN ART Queensland Art Gallery, Gallery of 7 December 2007 13 April 2008 (6 works) Modern Art QUEENSLAND UNIVERSITY OF TECHNOLOGY ART MUSEUM Breaking new ground Queensland University of Technology 27 July 2007 30 September 2007 (1 work) Art Museum Ian Friend: thirty years of works on Queensland University of Technology 24 April 2008 29 June 2008 paper 1977–2007 Art Museum (1 work) ROCKHAMPTON ART GALLERY Singing in the heart: music and the Rockhampton Art Gallery 8 June 2007 29 July 2007 art of Rupert Bunny (6 works)
(19 works loaned in Queensland)
SOUTH AUSTRALIA FROM TO ART GALLERY OF SOUTH AUSTRALIA 100 years of South Australian Art Gallery of South Australia 9 November 2007 28 January 2008 photography: 1840s–1940s (25 works) SOUTH AUSTRALIAN MUSEUM Following Garkman South Australian Museum 15 December 2007 10 February 2008 (4 works) Crayon to acrylic South Australian Museum 15 February 2008 17 March 2008 (1 work) National Museum of Australia 28 March 2008 22 June 2008
(30 works loaned in South Australia)
TASMANIA FROM TO TASMANIAN MUSEUM AND ART GALLERY Out of line: the art of Tasmanian Museum and Art Gallery 16 October 2006 19 November 2006 Vivienne Binns 0ENRITH 2EGIONAL 'ALLERY 4HE ,EWERS 25 May 2007 8 July 2007 (6 works) Bequest Latrobe Regional Gallery 25 July 2007 16 September 2007 Bathurst Regional Art Gallery 5 October 2007 18 November 2007
(6 works loaned in Tasmania)
continued
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 169 VICTORIA FROM TO AUSTRALIAN CENTRE FOR CONTEMPORARY ART Cinema Paradiso Australian Centre for Contemporary Art 12 October 2007 2 December 2007 (12 works) BENDIGO ART GALLERY The long weekend: Australian artists Bendigo Art Gallery 8 December 2007 10 March 2008 in France 1918–1939 (19 works) CASTLEMAINE ART GALLERY AND HISTORICAL MUSEUM Castlemaine Art Gallery and 21 October 2007 9 December 2007 Australian exhibition of Historical Museum women’s work (8 works) CITY MUSEUM OLDTREASURY MELBOURNE City Museum Old Treasury Melbourne 27 August 2007 30 November 2007 Melbourne artists studios 1900–1940 (1 work) GIPPSLAND ART GALLERY Frederick McCubbin to Gippsland Regional Art Gallery 10 May 2008 6 July 2008 Charles McCubbin (3 works) HEIDE MUSEUM OF MODERN ART Savage luxury: modernist design in Heide Museum of Modern Art 14 July 2007 4 November 2007 Melbourne 1930–1939 (8 works) The goddess grins: Albert Tucker Heide Museum of Modern Art 29 May 2007 31 October 2007 and the female image (19 works) Those who made and those who Heide Museum of Modern Art 1 November 2007 30 May 2008 saw: portraits of the Heide circle (14 works) A single mind: Rick Amor Heide Museum of Modern Art 27 March 2008 13 July 2008 (1 work) Hinterlands: Albert Tucker’s Heide Museum of Modern Art 28 June 2008 28 February 2009 landscapes 1960–1975 (2 works) LATROBE UNIVERSITY ART MUSEUM Kite: Mike Brown and the La Trobe University Art Museum 17 September 2007 2 November 2007 Sydney twelve McClelland Gallery + Sculpture Park 18 May 2008 10 August 2008 (1 work) Macquarie University Art Gallery 25 August 2008 17 October 2008 Wangaratta Exhibitions Gallery 6 December 2008 25 January 2009 Swan Hill Regional Art Gallery 1 March 2009 30 April 2009 MORNINGTON PENINSULA REGIONAL GALLERY Drawing with chisels Mornington Peninsula Regional Gallery 29 August 2007 21 October 2007 (1 work) Aspendale Beach: an artists’ haven Mornington Peninsula Regional Gallery 12 December 2007 10 March 2008 (6 works) continued
170 NATIONAL GALLERY OF VICTORIA Australian Impressionism National Gallery of Victoria 31 March 2007 8 July 2007 (39 works) Howard Arkley National Gallery of Victoria 17 November 2006 25 February 2007 (2 works) Art Gallery of New South Wales 10 March 2007 6 May 2007 Queensland Art Gallery 6 July 2007 16 September 2007 Geoffrey Bartlett National Gallery of Victoria 1 July 2007 31 October 2007 (1 work) Gordon Bennett National Gallery of Victoria 6 September 2007 16 January 2008 (3 works) Queensland Art Gallery 10 May 2008 3 August 2008 Art Gallery of Western Australia 20 December 2008 22 March 2009 *OSEPH "EUYS 2UDOLF 3TEINER National Gallery of Victoria 25 October 2007 17 February 2008 imagination, inspiration, intuition (3 works) Modern Britain 1900–1960: National Gallery of Victoria 15 November 2007 24 February 2008 Masterworks from Australian and New Zealand collections (5 works) Yvonne Audette: different directions National Gallery of Victoria 13 September 2007 17 March 2008 1954–1966 (3 works) Art Deco 1910–1939 National Gallery of Victoria 27 June 2008 5 October 2008 (30 works) Kitty Kantilla The Ian Potter Centre: NGV Australia at 27 April 2007 19 August 2007 (4 works) Federation Square Art Gallery of New South Wales 7 December 2007 21 January 2008 SHRINE OF REMEMBRANCE Stained glass windows: Shrine of Remembrance 30 May 2008 30 September 2008 William Montgomery (2 works) STATE LIBRARY OF VICTORIA The Medieval imagination: State Library of Victoria 27 March 2008 15 June 2008 illuminated manuscripts from Cambridge, Australia and New Zealand (1 work) TARRAWARRA MUSEUM OF ART Guy Stuart: bowls, vats, discs TarraWarra Museum of Art 12 August 2007 11 November 2007 and baffles (3 works) THE IAN POTTER MUSEUM OF ART After the Age of Aquarius: American The Ian Potter Museum of Art 28 April 2007 15 July 2007 art in the early seventies (3 works) Australian archaeologists at Pella The Ian Potter Museum of Art 22 March 2008 14 September 2008 (55 works) continued
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 171 Strange fruit: testimony and The Ian Potter Museum of Art 21 July 2007 14 October 2007 memory in Julie Dowling’s portraits (1 work) Dale Hickey: life in a box The Ian Potter Museum of Art 9 February 2008 27 April 2008 (3 works) Vivienne Shark LeWitt: comedies The Ian Potter Museum of Art 3 May 2008 20 July 2008 PROVERBS (1 work)
(254 works loaned in Victoria)
WESTERN AUSTRALIA FROM TO ART GALLERY OF WESTERN AUSTRALIA Radical elegance: Yohji Yamamoto Art Gallery of Western Australia 27 November 2007 17 February 2008 garments in Australian collections (1 work)
(1 work loaned in Western Australia)
OUTWARD LOANS TO EXHIBITIONS INTERNATIONAL Outward loans internationally totalled 109.
CANADA FROM TO VANCOUVER ART GALLERY Truth/Beauty: Pictorialism and the Vancouver Art Gallery 2 February 2008 27 April 2008 photograph as art 1845–1945 (16 work)
(16 works loaned in Canada)
GERMANY FROM TO HAMBURGER KUNSTHALLE Mark Rothko: a retrospective Kunsthalle der Hypo-Kulturstiftung 8 February 2008 27 April 2008 (1 work) Hamburger Kunsthalle 8 May 2008 3 August 2008
(1 work loaned in Germany)
ITALY FROM TO FERRARA PALAZZO DEI DIAMANTI Miro: the Earth Ferrara Palazzo dei Diamanti 17 February 2008 25 May 2008 (1 work) Museo Thyssen-Bornemisza 17 June 2008 14 September 2008 PALAZZO DELLE ESPOSIZIONI Mark Rothko Palazzo delle Esposizioni 5 October 2007 6 January 2008 (1 work) PALAZZO REALE Francis Bacon Palazzo Reale4 March 2008 24 August 2008 (1 work)
(3 works loaned in Italy)
continued
172 NEW ZEALAND FROM TO AUCKLAND ART GALLERY Auckland Art Gallery 30 June 2007 30 September 2007 (1 work)
(1 works loaned in New Zealand)
PORTUGAL FROM TO CALOUSTE GULBENKIAN FOUNDATION Ingenuity: photography Calouste Gulbenkian Foundation 1 February 2007 30 April 2007 and engineering Palais des Beaux Arts, Brussels 5 July 2007 9 September 2007 (12 works)
(12 works loaned in Portugal)
SWITZERLAND FROM TO FONDATION BEYELER The other collection Fondation Beyeler 19 August 2007 6 January 2008 (2 works)
(2 works loaned in Switzerland)
UNITED STATES OF AMERICA FROM TO JEWISH MUSEUM NEW YORK Jewish Museum New York 2 May 2008 21 September 2008 Abstract Expressionism and Saint Louis Art Museum 19 October 2008 11 January 2009 postwar America (1 work) Albright-Knox Art Gallery 13 February 2009 31 May 2009 THE ANDY WARHOL MUSEUM Andy and Oz: Parallel visions The Andy Warhol Museum 11 October 2007 30 December 2007 (63 works) BRIGHAM YOUNG UNIVERSITY MUSEUM OF ART Turning point: the demise of Brigham Young University Museum of Art 17 July 2008 9 January 2009 modernism and rebirth of meaning in American art (10 works)
(74 works loaned in United States of America)
SUMMARY OF OUTWARD LOANS Outward loans to exhibitions – Australia: 539 Outward loans to exhibitions – international: 109 National Gallery of Australia travelling exhibitions lending program: 498 Other new and continuing loans: 386 Total outwards loans: 1532
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 173 APPENDIX 10 INWARD LOANS
EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PUBLIC LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL ACT Heritage Library, Griffith, ACT 10 0 0 0 0 10 Allen Memorial Art Museum, Oberlin, USA 0 0 1 0 0 1 American Friends of the National Gallery of 0 1 0 0 0 1 Australia, New York, USA Art Gallery of New South Wales, Sydney, NSW 0 0 43 9 0 52 Art Gallery of South Australia, Adelaide, SA 0 0 29 5 0 34 Art Gallery of Western Australia, Perth, WA 0 0 5 1 0 6 Art Museums of Bergen, Bergen, Norway 0 0 2 0 0 2 Australian Academy of Science, Canberra 0 1 0 0 0 1 City, ACT Australian Council of National Trusts, 0 1 0 0 0 1 Campbell, ACT Australian Institute of Aboriginal and Torres 0 0 0 1 0 1 Strait Islander Studies, Canberra, ACT Australian War Memorial, Campbell, ACT 0 0 17 0 0 17 Bachmann Eckenstein Art and Antiques, 0 0 0 97 0 97 Basel, Switzerland Ballarat Fine Art Gallery, Ballarat, Vic. 0 0 5 3 0 8 Benalla Art Gallery, Benalla, Vic. 0 0 2 0 0 2 Bendigo Art Gallery, Bendigo, Vic. 0 0 2 0 0 2 Bishop Museum, Honolulu, USA 0 0 6 0 0 6 Boomalli Aboriginal Artist Co-Operative Ltd, 0 0 7 12 0 19 Leichhardt, NSW Carrick Hill, Springfield, SA 0 0 1 0 0 1 Christ’s Hospital School, Horsham, UK 0 0 1 0 0 1 Collectors, Melbourne c/- Bill Nuttall, Niagara 0 0 1 0 0 1 Galleries, Richmond, Vic. Dawson’s Bookshop / Michael Dawson 0 0 3 0 0 3 Gallery, Los Angeles, USA Dubbo Regional Art Gallery, Dubbo, NSW 0 0 1 18 0 19 Estate of Emile Otto (E O) Hoppe (under management Curatorial Assistance Pasadena), 0 0 10 0 0 10 Pasadena, USA Fine Arts Museums of San Francisco, San 0 0 2 0 0 2 Francisco, USA Fondation Beyeler, Riehen/Basel, Switzerland 0 0 1 0 0 1 continued
174 EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PUBLIC LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL French and Company LLC, New York, USA 0 0 1 0 0 1 Frinzi, Mr Gianni – acting as agent for Mr 0 0 1 0 0 1 Andrew Yip, Sutherland Galerie Hans, Hamburg, Germany 0 0 1 0 0 1 Galerie Paffrath, Dusseldorf, Germany 0 0 1 0 0 1 Gallery Gabrielle Pizzi, Melbourne, Vic. 0 0 3 2 0 5 Geelong Grammar School, Corio, Vic. 0 0 1 0 0 1 Grahame Galleries + Editions, Milton, Qld 0 0 1 1 0 2 Hamburger Kunsthalle, Hamburg, Germany 0 0 3 0 0 3 Hamilton Art Gallery, Hamilton, Vic. 0 0 3 2 0 5 Josef Lebovic Gallery, Paddington, NSW 0 0 0 0 1 1 Kerry Stokes Collection, Perth, 0 1 4 0 0 5 West Perth, WA Kröller-Müller Museum, Otterlo, The 0 0 2 0 0 2 Netherlands Los Angeles County Museum of Art, Los 0 0 1 0 0 1 Angeles, USA Maningrida Arts and Culture, Winnellie, NT 0 0 3 0 0 3 -ANLY !RT 'ALLERY -USEUM -ANLY .37 0 0 1 0 0 1 Marshall Arts Aboriginal Fine Art Gallery, 0 0 2 2 0 4 Hyde Park, SA Megalo Access Arts Inc, Watson, ACT 0 0 7 0 0 7 Michael Riley Foundation, Dulwich Hill, 0 0 0 362 0 362 NSW Milani Gallery, Woolloongabba, Qld 0 0 9 3 0 12 Mildura Arts Centre, Mildura, Vic. 0 0 1 0 0 1 Ministry of Defence Art Collection, 0 0 1 0 0 1 London, UK Mitchell Library, State Library of New South 0 0 4 0 0 4 Wales, Sydney, NSW Monash Gallery of Art, Wheelers Hill, Vic. 0 0 0 1 0 1 Moree Plains Gallery, Moree, NSW 0 0 0 14 0 14 Mori Gallery, Sydney, NSW 0 0 1 0 0 1 Museo Thyssen-Bornemisza, Madrid, Spain 0 0 2 0 0 2 Museum of Sydney, Sydney, NSW 0 0 0 36 0 36 Museum Victoria, Melbourne, Vic. 0 0 1 0 0 1 National Galleries of Scotland, Edinburgh, UK 0 0 1 0 0 1 National Gallery of Art, Washington, USA 0 0 2 0 0 2 National Gallery of Victoria, Melbourne, Vic. 0 0 30 4 0 34 National Library of Australia, Parkes, ACT 62 33 17 0 0 112 continued
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 175 EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PUBLIC LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL National Portrait Gallery, Canberra, 0 0 2 0 0 2 Parkes, ACT Nellie Castan Gallery, South Yarra, Vic. 0 0 1 1 0 2 Nevill Keating Pictures Ltd, London, UK 0 0 1 0 0 1 Newcastle Region Art Gallery, Newcastle, 0 1 2 1 0 4 NSW Niagara Galleries, Richmond, Vic. 0 11 0 0 0 11 Northern Territory Library, Darwin, NT 14 0 0 0 0 14 Papunya Tula Artists Pty Ltd, 0 0 3 1 0 4 Alice Springs, NT Parliament House Art Collection, 0 0 1 0 0 1 Canberra, ACT Perpetual Trustee Company Limited, 0 1 0 0 0 1 Canberra, ACT Philadelphia Museum of Art, 0 0 2 0 0 2 Philadelphia, USA Private Collection c/- Indigenart, The 0 0 7 4 0 11 Mossenson Galleries, Subiaco, WA Private collection c/- Pat Wallace, 0 0 1 0 0 1 Crows Nest, NSW Private collection c/- William Mora Galleries, 0 0 3 0 0 3 Richmond, Vic. Queen’s University Library, Belfast, UK 0 0 1 0 0 1 Queensland Art Gallery, Brisbane, Qld 0 0 8 0 0 8 Roslyn Oxley9 Gallery, Paddington, NSW 0 10 9 1 0 20 Royal Academy of Arts, Piccadilly, UK 0 0 1 0 0 1 Royal Botanic Gardens, Sydney, Sydney, NSW 0 0 1 0 0 1 Royal Geographical Society of South Australia 0 0 2 0 0 2 Inc., Adelaide, SA Saint Louis Art Museum, St Louis, USA 0 0 3 0 0 3 Smithsonian American Art Museum, 0 0 2 0 0 2 Washington, USA St Mary’s Cathedral, Sydney, NSW 0 0 1 0 0 1 Staatliche Kunstsammlungen Dresden, 0 0 2 0 0 2 Dresden, Germany State Library of New South Wales, 41 0 0 0 0 41 Sydney, NSW State Library of Queensland, Brisbane, Qld 14 0 0 0 0 14 State Library of South Australia, Adelaide, SA 60 0 0 0 0 60 State Library of Tasmania, Hobart, Tas. 15 0 0 0 0 15 State Library of Victoria, Melbourne, Vic. 43 0 2 0 0 45 continued
176 EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PUBLIC LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL State Library of Western Australia, Perth, WA 8 0 0 0 0 8 Stills Gallery, Paddington, NSW 0 0 10 10 0 20 TarraWarra Museum of Art, Healesville, Vic. 0 0 1 1 0 2 Tasmanian Museum and Art Gallery, 0 0 3 1 0 4 Hobart, Tas. Tate, London, UK 0 0 5 0 0 5 The Big River Collection, North Hobart, Tas. 0 0 1 0 0 1 The Ian Potter Museum of Art, Parkville, Vic. 0 0 1 0 0 1 The J Paul Getty Museum, Los Angeles, USA 0 0 1 0 0 1 Tiwi Design, Bathurst Island, NT 0 0 3 0 0 3 Tolarno Galleries, Melbourne, Vic. 0 0 1 1 0 2 Toledo Museum of Art, Toledo, USA 0 0 2 0 0 2 Toowoomba Regional Art Gallery, 0 0 1 0 0 1 Toowoomba, Qld Uniting Church in Australia, Sydney, NSW 0 1 0 0 0 1 University Art Museum, The University of 0 0 2 0 0 2 Queensland, Brisbane, Qld University of Sydney Art Collection, 0 0 0 1 0 1 University of Sydney, NSW Van Gogh Museum, Amsterdam, The 0 0 1 0 0 1 Netherlands Victoria and Albert Museum, London, UK 0 0 5 0 0 5 Watters Gallery, East Sydney, NSW 0 0 7 0 0 7 Wesfarmers Limited, Perth, WA 0 0 2 1 0 3 William Mora Galleries, Richmond, Vic. 0 0 0 1 0 1 Wilson Centre, London, UK 0 0 1 0 0 1 Yale Center for British Art, New Haven, USA 0 0 2 0 0 2 Subtotal 267 61 347 597 1 1273
EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PRIVATE LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL Anderson, Joy, Toorak, Vic. 0 0 1 0 0 1 Andrew Geue and Deborah Nikou, 0 0 1 0 0 1 Norwood, SA Arney, Betty, Beaumont, SA 0 0 1 0 0 1 Arthur Frank Shorter and Cristine Elaine 0 1 0 0 0 1 Andrews, Sydney, NSW Bachmann, Mr Thomas, Basel, Switzerland 0 0 1 0 0 1 Barker, Dr Rowan, Mosman, NSW 0 0 0 1 0 1 Bellear, Lisa, Brunswick, Vic. 0 0 0 1 0 1 continued
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 177 EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PRIVATE LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL Beresford, Bruce, Birchgrove, NSW 0 0 1 0 0 1 Bett, Mr Dick, North Hobart, Tas. 0 0 0 1 0 1 Birch, Goldie, Toorak, Vic. 0 0 1 0 0 1 Blake, Andrew, Yirrkala, NT 0 0 1 0 0 1 Bloom, Norman, Toorak, Vic. 0 0 1 0 0 1 Bonyhady, Prof Tim, Reid, ACT 0 1 0 0 0 1 Bourke, Mr Anthony, Bundeena, NSW 0 0 0 9 0 9 Boyle Family via State Library of Victoria, 1 0 0 0 0 1 Melbourne, Vic. Burney, Linda, Dulwich Hill, NSW 0 0 0 7 0 7 Butler, Roger, Parkes, ACT 0 4 0 0 0 4 Chazan, Dr Sam, Arrmadale, Vic. 0 0 1 0 0 1 Christopher Hodges and Helen Eager, 0 0 3 0 0 3 Alexandria, NSW Christophersen, Christine, Woodroffe, NT 0 0 1 1 0 2 Cornford, Mr Ian, Killara, NSW 0 0 0 2 0 2 Corrigan, Mr Pat, Darling Point, NSW 0 0 1 6 0 7 Cox, David, Blackheath, NSW 0 0 1 0 0 1 Craigie, Cathy, Marrickville, NSW 0 0 0 41 0 41 Craigie, Ian ‘Yurry’, Moree, NSW 0 0 0 3 0 3 Croft, Brenda 0 0 0 27 0 27 Cruthers, Mr John, Newtown, NSW 0 1 0 0 0 1 Cruthers, Sir James and Lady Sheila, 0 0 0 2 0 2 Claremont, WA Cunnington, Janita, Point Lookout, Qld 0 0 0 2 0 2 Deborah Clark and Gordon Bull, Chifley, ACT 0 0 1 0 0 1 Dowling, Julie, Maddington, WA 0 0 2 2 0 4 Dufour, Mrs Mary, Deviot, NSW 0 1 0 0 0 1 Estate of Dr Bruce Reid – via State Library of 1 0 0 0 0 1 New South Wales, Sydney, NSW Estate of Elizabeth Summons, Melbourne, Vic. 0 1 0 0 0 1 Fairfax AO, Mr James, Bowral, NSW 0 0 1 0 0 1 Ferguson, Mr and Mrs Rob and Jenny, 0 0 2 0 0 2 Moss Vale, NSW Forsey, Keith, Campbell, ACT 0 0 6 0 0 6 French, Dort, Moree, NSW 0 0 0 5 0 5 French, Greg, Jamaica Plain, USA 0 0 5 0 0 5 Frey, Margaret, Red Hill, ACT 0 0 1 0 0 1 Frison, Mr Fabio, Basel, Switzerland 0 0 4 0 0 4 continued
178 EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PRIVATE LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL Geoffrey and Alex Legge, East Sydney, NSW 0 0 2 0 0 2 Goldstein, Mr Sidney, Basel, Switzerland 0 0 1 0 0 1 Graham-Stewart, Michael, Freeman Bay, 0 0 1 0 0 1 New Zealand Greer, Mr Robin, Brisbane, Qld 0 0 1 0 0 1 Hall, Ms Diane, Basel, Switzerland 0 0 4 0 0 4 Hamm, Treahna, Yarrawonga, Vic. 0 0 1 0 0 1 Hartenberger, Mr Russell, Basel, Switzerland 0 0 6 0 0 6 Hassall, Mr Geoffrey, Bronte, NSW 0 1 5 0 0 6 Hendel, David, South Melbourne, Vic. 0 0 1 0 0 1 His Grace The Duke of Northumberland, 0 0 1 0 0 1 Alnwick, UK Hockley, Wendy, Kemp’s Creek, NSW 0 0 0 12 0 12 Horn, Mr Tim, Chimayo, USA 0 0 2 0 0 2 Hosch, Dr Alfred, Basel, Switzerland 0 0 6 0 0 6 Humphries, Mr Barry, London, England 0 0 1 0 0 1 Hurst, Joe, Sydney, NSW 0 0 0 1 0 1 Hurst, Mr Andre, Basel, Switzerland 0 0 4 0 0 4 James Agapitos and Ray Wilson, 0 1 0 0 0 1 Bellevue Hill, NSW John and Anne Fraser, Sydney, NSW 0 0 1 0 0 1 John Cruthers and Elaine Baker, 0 0 2 0 0 2 Newtown, NSW Joseph Fekete and Annie Bartlett, 0 0 1 1 0 2 Annandale, NSW Kal kman, Roanne, Basel, Switzerland 0 0 3 0 0 3 Kistler, Mr Brian, Santa Barbara, USA 0 0 1 1 0 2 Klose, Mr Simon, Benalla, Vic. 0 0 1 0 0 1 Knaus, David, Palm Springs, USA 0 0 103 0 0 103 Kombumerri, Dillon, Sydney, NSW 0 0 0 1 0 1 Lagerberg, Johanna, Dalkeith, WA 0 0 1 1 0 2 Larter, Mr Richard, Narrabundah, ACT 0 0 4 0 0 4 Laverty, Dr and Mrs Colin, Balmain, NSW 0 0 8 0 0 8 Legge, Mr Geoffrey, East Sydney, NSW 0 0 1 0 0 1 Lunde, Mr Asbjorn R, Hillsdale, USA 0 0 2 0 0 2 Machin, Mr Michael, Brisbane, Qld 0 0 3 0 0 3 May, Ron and Patricia, Canberra, ACT 0 0 1 1 0 2 McLeavey, Peter Joseph John, Wellington, 0 1 0 0 0 1 New Zealand continued
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 179 EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PRIVATE LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL McPhee, Mr John, Double Bay, NSW 0 0 2 0 0 2 Mellor, Danie, Kambah, ACT 0 0 6 1 0 7 Milson, Virginia, Bronte, NSW 0 0 1 0 0 1 Moffat, Tracey 0 0 0 1 0 1 Morris, Leon, Fannie Bay, NT 0 0 0 2 0 2 Mr Dirk Maas, Mr Klaus Kramer, 0 0 14 0 0 14 Basel, Switzerland Mr John Walker, Ms Gabriele Hadl, Basel, 0 0 8 0 0 8 Switzerland Mr Sylvan Barnet, Mr William Burto, 0 0 1 0 0 1 Basel, Switzerland Murdoch, Mr Rupert, Sydney, NSW 0 0 1 0 0 1 Murphy, Miriam, BELLAIRE, USA 0 0 1 0 0 1 Myer, Rupert, AM 0 0 1 1 0 2 Nell, Sydney, NSW 0 0 1 0 0 1 Nelson, Peter, Cottesloe, WA 0 0 1 1 0 2 Newby, Mr David M, Moss Vale, NSW 0 0 1 0 0 1 Novick, Mr Jeff, Basel, Switzerland 0 0 6 0 0 6 Ochsner, Mr Claudius, Basel, Switzerland 0 0 6 0 0 6 O’Donnell, Kay, Sydney, NSW 0 0 1 1 0 2 Ogden, Chris, St Kilda, Vic. 0 0 0 1 0 1 Patrick Hutchings and Heng-Wie The, 0 0 1 1 0 2 Fitzroy North, Vic. Perkins, Hetti, Paddington, NSW 0 0 0 3 0 3 Perkins, Rachel, Potts Point, NSW 0 0 0 4 0 4 Price, Phil, Cook, ACT 0 0 1 0 0 1 Private Collection, Basel, Basel, Switzerland 0 0 15 0 0 15 Private Collection, c/- Philip Bacon Galleries, 0 0 2 0 0 2 Fortitude Valley, Qld Radford, Mr Ron, Parkes, ACT 0 1 0 0 0 1 Reed, Prof Dennis J, Glendale, USA 0 0 6 0 0 6 Ricketts, Mr Howard, London, UK 0 0 3 0 0 3 Riley, Bernadette 0 0 0 9 0 9 Riley, David, Glebe, NSW 0 0 0 3 0 3 Roberts, Mr and Mrs J, Elong Elong, NSW 0 0 1 0 0 1 Rohr, Emily, Broome, WA 0 0 1 0 0 1 Roncolato, Melissa, Sydney, NSW 0 0 0 1 0 1 Rooney, Robert, Hawthorn East, Vic. 0 0 16 0 0 16 Rosenblatt, Mr Norman, Brighton East, Vic. 0 0 1 0 0 1 continued
180 EXTERNAL LONG NGA SHORT TRAVELLING TERM NGA TRAVELLING TERM PRIVATE LENDERS EXHIBITION LOAN EXHIBITION EXHIBITION LOAN TOTAL Saltzman, Ms Sandra, Basel, Switzerland 0 0 2 0 0 2 Selle, Mrs Helen, Kirribilli, NSW 0 0 1 0 0 1 Shafer, Bernard, South Yarra, Vic. 0 0 1 0 0 1 Shuttlewood, Lorna, Watson, ACT 0 0 1 0 0 1 Sigurdsson, Dr Tryggvi, Basel, Switzerland 0 0 1 0 0 1 Smorgon, Mrs Loti, South Yarra, Vic. 0 0 1 0 0 1 Soltermann, Mr Daniel, Basel, Switzerland 0 0 5 0 0 5 Stanley, Mark 0 0 0 1 0 1 Stevens, Mr John, Honolulu, USA 0 0 10 10 0 20 Stokes, Mr Kerry, West Perth, WA 0 0 1 0 0 1 Synnot, Amanda, Turner, ACT 0 2 0 0 0 2 The Hon Peter Underhill and Dr Nancy 0 0 1 0 0 1 Underhill, Chelmer, Qld Triguboff, Eleonora, Paddington, NSW 0 0 1 1 0 2 Tuckson AM, Margaret, Wahroonga, NSW 0 5 0 0 0 5 Tyler, Kenneth, Sharon, USA 0 1 0 0 0 1 Unger, Mr Daniel, Basel, Switzerland 0 0 6 0 0 6 Vanstone, Justice Ann, Adelaide, SA 0 0 1 0 0 1 Vellios, Jim, Bexley, NSW 0 0 1 0 0 1 Warren, Joy, Yarralumla, ACT 0 0 1 0 0 1 Watters, Mr Frank, East Sydney, NSW 0 0 1 0 0 1 Weis, Bob, West St Kilda, Vic. 0 0 1 0 0 1 Whitworth, Mr Michael, Woollahra, NSW 0 0 0 1 0 1 Williamson, Richard, Bardon, Qld 0 0 1 0 0 1 Wilmerding, Mr John, Landover, USA 0 0 1 0 0 1 Wolf, Mr Stephan, Basel, Switzerland 0 0 1 0 0 1 Wright, Mr Leslie, Vancouver, Canada 0 0 1 1 0 2 Wrobel, Mr and Mrs Fred and Elinor, 0 0 1 0 0 1 Woolloomooloo, NSW Zanotelli, Mr Rolando, Basel, Switzerland 0 0 3 0 0 3 Subtotal 2 21 347 171 0 541 Total (all inward loans) 269 82 694 768 1 1814
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 181 APPENDIX 11 OUTWARD LOANS INCLUDING TRAVELLING EXHIBITIONS 2002–03 TO 2007–08
498 1034 1532 2007–08
310 768 1078 2006–07
317 1093 1410 2005–06 FINANCIAL YEAR 429 1591 2020 2004–05
632 1585 2217 2003–04
627 1923 2550 2002–03
0 500 1000 1500 2000 2500 3000
OUTWARD LOANS
Works of art on loan Works of art on loan other than for travelling exhibitions for travelling exhibitions
182 APPENDIX 12 NATIONAL GALLERY OF AUSTRALIA SPONSORS 2007–08
The National Gallery of Australia acknowledges the Foundation Summer Scholarship 2008 program following sponsors and partners for their generous and students financial and in kind support throughout the s #HAMPAGNE 0OL 2OGER FOR THEIR SUPPORT OF THE 2007–08 year: Gallery’s twenty-fifth anniversary and the Turner to s !CTEW!', AS MAJOR PARTNER FOR George W Lambert Monet: the triumph of landscape retrospective: heroes and icons s #OOPERS "REWERY FOR THEIR SUPPORT OF THE 'ALLERYS s !$3(%, FOR SUPPORT OF Turner to Monet: the twenty-fifth anniversary and the Culture Warriors: triumph of landscape National Indigenous Art Triennial s !USTRALIA #OUNCIL FOR THE !RTS FOR SUPPORT OF THE s %MBASSY OF THE 5NITED 3TATES OF !MERICA FOR THEIR Culture Warriors: National Indigenous Art Triennial support of Robert Rauschenberg 1967–1978 through the Aboriginal and Torres Strait Islander, s %-# !USTRALIA FOR SUPPORT OF VIP: very important Visual Arts and Community Partnerships Market photographs 1840s–1940s Development (International) Boards. s &ORREST (OTEL AND !PARTMENTS FOR PROVIDING s !USTRALIA *APAN &OUNDATION FOR SUPPORT OF Black robe accommodation for guests throughout the year in white mist: art of the Japanese Buddhist particular for the Culture Warriors: National nun Rengetsu Indigenous Art Triennial and for their support of s !USTRALIAN !IR %XPRESS FOR THEIR ONGOING SUPPORT OF Turner to Monet: the triumph of landscape the National Gallery of Australia’s travelling s 'ORDON $ARLING !USTRALIA 0ACIlC 0RINT &UND FORITS exhibitions program continuing support of the development and s !USTRALIAN "ROADCASTING #ORPORATION FOR THEIR promotion of the Australian & Pacific continuing support through ABC TV and ABC Radio Print Collection in particular ABC Stateline and 666 ABC Canberra s 'ORDON $ARLING &OUNDATION FOR THEIR s The Australian Government through the continuing support Contemporary Touring Initiative for funding to assist s )NFRONT 3YSTEMS FOR SUPPORT OF VIP: very important the travelling exhibition Culture Warriors: National photographs 1840s–1940s Indigenous Art Triennial and, through Visions of s *APAN &OUNDATION FOR THEIR SUPPORT OF Black robe Australia, to assist the travelling exhibition Ocean to white mist: art of the Japanese Buddhist Outback: Australian landscape painting 1850–1950 nun Rengetsu s "(0 "ILLITON AS -AJOR 3PONSOR FOR THE EXHIBITION AND s *1 0TY ,IMITED FOR THEIR CONTINUING SUPPORT THROUGH tour of Culture Warriors: National Indigenous magazines, Antiques & Artt and World of Art Art Triennial and Antiques s 4HE "RASSEY OF #ANBERRA FOR THEIR CONTINUING SUPPORT s ,AMBERT 6INEYARDS FORSUPPORT OF George W Lambert of the National Gallery of Australia and Sony retrospective: heroes and icons Foundation Summer Scholarship program and students s ().$-!23( AS 0RINCIPAL 3PONSOR FOR The story of Australian printmaking 1801–2005 s #ASELLA 7INES FOR SUPPORT OF George W Lambert retrospective: heroes and icons, Australian s -ANTRA ON .ORTHBOURNE FOR PROVIDING Surrealism: the Agapitos/Wilson collection and accommodation to guests throughout the year, in Richard Larter: a retrospective particular for their support of the Culture Warriors: National Indigenous Art Triennial and for their s #ANBERRA !RTS 4EACHERS !SSOCIATION FORSUPPORT OF support of Turner to Monet: the triumph the National Gallery of Australia and Sony of landscape
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 183 s .ATIONAL 'ALLERY OF !USTRALIA #OUNCIL %XHIBITIONS Fund for support of Ocean to Outback: Australian Landscape Painting 1850–19500 and Andy and Oz: parallel visions s .ATIONAL !USTRALIA "ANK FOR NAMING RIGHTS sponsorship for the National Australia Bank Sculpture Gallery and for the annual Sculpture Garden Sunday s .INE .ETWORK !USTRALIA FOR THEIR SUPPORT OF Turner to Monet: the triumph of landscape s /,EARY 7ALKER 7INES FOR THEIR SUPPORT OF THE Gallery’s twenty-fifth anniversary and the Culture Warriors: National Indigenous Art Triennial s 4HE .ORTHERN 4ERRITORY 'OVERNMENT THROUGH ArtsNT for support of the Culture Warriors: National Indigenous Art Triennial s 1!.4!3 !IRWAYS ,IMITED FOR THEIR CONTINUING support especially with the exhibition Andy and Oz: parallel visionss, collaboration between the National Gallery of Australia and The Andy Warhol Museum, Pittsburgh, USA s 4HE 1UEENSLAND 'OVERNMENT THROUGH 1UEENSLAND Indigenous Arts Marketing and Export Agency for support of Culture Warriors: National Indigenous Art Triennial s 2 - 7ILLIAMS THE "USH /UTlTTER FOR SUPPORT OF THE travelling exhibition, Ocean to Outback: Australian landscape painting 1850–1950 s 3ONY &OUNDATION !USTRALIA FOR SUPPORT OF THE National Gallery of Australia and Sony Foundation Summer Scholarship 2008 program s 3OUTHERN #ROSS 4EN FOR SUPPORT OF THE Culture Warriors: National Indigenous Art Triennial s 7). 4ELEVISION FOR SUPPORT OF George W Lambert retrospective: heroes and icons s 9ALUMBA 7INES FOR THEIR SUPPORT OF THE 'ALLERYS twenty-fifth anniversary and the Turner to Monet: the triumph of landscape.
184 APPENDIX 13 NATIONAL GALLERY OF AUSTRALIA VOLUNTEERS AT 30 JUNE 2008
ABORIGINAL AND MEMBERSHIP Janelle Brice Lena Britton TORRES STRAIT Dorothy Anderson Margaret Bromley ISLANDER ART Elizabeth Brooks Adrian Brooks Judy Burns Kelli Cole Betty Browning Doreen Butler Laurel Brummell Betty Campbell ASIAN ART Frances Butterfield Maureen Chan Helen Campbell Margo Geering Barrie Clarke Shelley Clarke Bill Geering Cathie Collins Bruce Cook Chris Haskett Helen Deane Beverley Copeland Jan Smith Sylvia Dicker Kerin Cox Helen Douglas Shirley Crapp AUSTRALIAN AND Kay Dunne Merrilyn Crawford INTERNATIONAL Karin Fyfe Dodie Crichton Margaret Gerahty DECORATIVE ARTS Meridith Crowley Audrey Harvey AND DESIGN Paloma Crowley Isabelle Hayward Colleen Cunningham Jane Herring Joan Johns Eddie Davenport Meredith Hinchliffe Beryle Legge-Wilkinson Elizabeth Davies Penelope Roberts Doris McCauley Sumie Davies Diana Woollard Heather Mears Mary de Mestre Estelle Neilson Ruth Dobson AUSTRALIAN AND Nigel Neilson Bea Duncan INTERNATIONAL Alison Thomas Heather Duthie Rita Williams PHOTOGRAPHY Roma Elford Gene Willsford Robert Deane Gloria Ellis Gerda Zietek Bernard Lilenthal Margaret Enfield Brian England RESEARCH LIBRARY AUSTRALIAN PRINTS, Phyllis Evenett DRAWINGS AND Pam Cossey Peter Field ILLUSTRATED BOOKS Bill Geering Miriam Fischer Jill More Judith Fleming Keith Avent Julia Nicholls Patrick Fleming Linda Hastings Kay Smith Marcia Fletcher Macushla Robinson Colleen Fox VOLUNTARY GUIDES Monty Fox CONSERVATION Margaret Frey Win Abernathy Janet Garrett Margaret Carson Janet Aitken Cordelia Gee Gudrun Genee Gail Allen Robert Goodrick William Hamilton Elizabeth Allison Ross Gough Anna Bannan Christine Grose INTERNATIONAL Susan Bastian Pamela Guilfoyle PAINTING AND Hilary Batten Barrie Hadlow Elizabeth Bennett SCULPTURE Jann Hallenan Lynne Booth Pamela Walker Fiona Hase Carolyn Brennan
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 185 Toni Hassan Patrick O’Hara Clem Hayes Susan O’Connor Brit Helgeby Denise Page Rosanna Hindmarsh Evelyn Paton Margaret Hollis Bettye Pearce Mie Ling Huisken Nicole Podeur Elspeth Humphries Julia Pratt Carol Hunt Norma Price Odette Ingram Joan Purkis Robin Irvine Beryl Quartel Ursula Isaks Kaye Rainey Rosslyn Jackson Anne Reese Phoebe Jacobi Georgia Renfree Tami Jacobsen Helen Richmond Marilyn Jessop Fred Roberts Clara Johns Judy Roberts Diane Johnson Laure Roger Kay Johnston Hilary Rotsey Jillian Kennedy Myra Rowling Krysia Kitch Christine Saddington Edith Kuhn Sylvia Shanahan Meg Lambeck Mary Lou Sheppard Philippa Larkindale Kimberley Simms Paul Legge-Wilkinson Carol Slater Rachel Letts Elizabeth Sloan Bernard Lilienthal Jan Smith Caren Luddy Jane Smyth Jane Marcissac Peggy Spratt Alva Maguire Carol Summerhayes Karen Manton Bob Sutherland Susan McAffer Catherine Sykes Patricia McCullough Menna Thomas Margaret McIntosh Heather Thompson Michael McKeown Jo Thomson Audrey McKibbin Arthur Tow Phyllis McLean Meryl Turner Jennifer Morris Roberta Turner Margaret Morris Pamela Walker Geraldine Mountifield Deirdre Ward Patti Mulcare Judy Ware Patsy Murray Pamela Weiss Maryann Mussared Sally Wells Maria Helena Nicoll Jenny Wilson Rhonda Nobbs-Mohr Marjorie Wilson Kate Nocklels Judith Wood Caroline Nott Robert Worley
186 APPENDIX 14 PUBLICATIONS OF THE NATIONAL GALLERY OF AUSTRALIA 2007–08
George W Lambert retrospective: Australian Surrealism: the Agapitos/ heroes and icons Wilson collection Elena Taylor, author Margaret Maher, editor Eric Meredith, editor Andrew Rankin Design, design Kirsty Morrison, design Sarah Robinson, production Colin McCahon: focus exhibition Robert Rauschenberg 1967–1978 Deborah Hart, author Jaklyn Babington, author Eric Meredith, editor Jeanie Watson, editor Kirsty Morrison, design Carla da Silva, design Turner to Monet: the triumph of Black robe white mist: art of the landscape painting Japanese Buddhist nun Rengetsu Ron Radford, Christine Dixon and Melanie Eastburn, Lucie Folan and Lucina Ward, authors Robyn Maxwell, authors Ariana Klepac, Eric Meredith, editors Michaela Forster, editor Kristin Thomas, design Spatchurst, design Kirsty Morrison, Erica Seccombe, production Sarah Robinson, Kristin Thomas, production Fire and ice (children’s alphabet book) Printed images by Australian artists Kirsty Morrison, concept and design 1885–1955 (volume 2) Roger Butler, author Richard Larter Pauline Green, editor Deborah Hart with Deborah Clark and Joanna Kirsty Morrison, design and production Mendelssohn, authors Eric Meredith, editor Culture Warriors: National Indigenous Kirsty Morrison, design Art Triennial Brenda Croft, editor War: the prints of Otto Dix Deborah Clark, Susan Jenkins, editing Mark Henshaw, author Art Direction Creative, design Jeanie Watson, editor Kirsty Morrison, Erica Seccombe, production Kristin Thomas, design
Andy and Oz: parallel visions Artonview (four issues) Deborah Hart, author No. 51 spring 2007 Jeanie Watson, editor No. 52 summer 2007–08 Kristin Thomas, design No. 53 autumn 2008 No. 54 winter 2008 Jeanie Watson, editor (51) Eric Meredith, editor (52, 53, 54) MA@D Communication, designer (51) Kristin Thomas, designer (52, 53, 54)
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 187 APPENDIX 15 WEBSITE VISITATION
Visits to the website totalled 1.18 million (approx. 3250 per day).
Pages viewed totalled 3.8 million.
VISITORS BY COUNTRY In order of number of visits.
PAGES COUNTRY OR TERRITORY VISITS PER VISIT Australia 578271 3.95 United States of America 2536722.34 United Kingdom 85694 2.44 Canada 27927 2.54 France 23463 2.86 Germany 200622.41 Italy 15216 3.02 Spain 10441 3.41 Netherlands 9401 3.04 New Zealand 8790 3.11
REFERRALS Indicates how people arrived at the Gallery’s website. In order of percentage.
SOURCE PERCENTAGE Search engines 57.67% Referring sites 31.61% Direct traffic 10.72%
188 MOST POPULAR SECTIONS OF THE SITE In order of number of unique page views.
WEBSITE SECTION UNIQUE PAGE VIEWS Exhibition (aggregated exhibitions) 345590 International Paintings and Sculpture 280737 NGA home 254965 About us 123445 Exhibitions (general exhibition information) 122798 Federation 116212 Turner to Monet 90825 International Prints (Kenneth Tyler website) 61769 Collection overviews 52659 Monet and Japan 52443 Visiting 52286 Russia 43610 Ocean to Outback 38140 Niat07 36773 The Italians 36358 Namatjira 34246 Indonesian Textiles 33406 Lambert 30720 Memorial Poles 29247 Calendar (Public Programs events) 28411 Research (Library) 27568 Artonline (e-newsletter) 26762 Westwood 26645 Warhol 26568 Retake 26465
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 189 APPENDIX 16 CONSULTANTS 2007–08
There were 32 consultants paid more than $10000 in 2007–08.
NAME NATURE OF SERVICES AMOUNT KEY Arup &ACADE !COUSTIC CONSULTANCY 121219 a Australian Government Solicitor Legal 12257 a Australian National Audit Office External audit services 69700 c Brizulis Associates Engineering services 403838 a Cardno Young Engineering services 167287 a Davidson Trahaire Corpsych Pty Limited Employee assistance program 14300 a Defire (ACT) Pty Ltd Fire safety 22999 a Dysen Pty Ltd Fire systems 17597 a Edmore Pty Limited Staff Induction Program 10125 b Erwood Accelerated Purchasing 4ENDER CONTRACT SERVICES 36385 b Food Service Essentials Catering design 15318 a 'EORGE 3EXTON !SSOCIATES Lighting design plan 219693 a Hughes Truman Pty Ltd Hydraulic services 24285 a James Adamson Strategic plan review 12000 b Ken Begg and Associates Public affairs advice 78975 b KPMG Financial accounting services 19500 b Knight Frank Hooker Valuation services 15000 c Mallesons Stephen Jaques Legal 104529 a -C'REGOR 0ARTNERS Landscaping design services 215255 a Naked Communications NGA branding review 52500 a National Consulting Pty Ltd Financial system reporting 14400 b Page Kirkland Lorimer Pty Ltd Cost planning for building project 920714 a Philip Chun and Associates Pty Ltd Building code consultant 18839 a Pro Safety Consultants Security advice 27000 a PTW Architects Architectural services 862168 a Simon Storey Valuers Valuation services 33800 c Simpson Solicitors Legal 17744 a Steensen Varming (Australia) Pty Ltd Mechanical engineering advice 822247 a Unilinc Serial collection and cataloguing services 18000 a Walter Turnbull Internal audit 70814 c Wilkinson Murray Acoustic consultancy 11775 a Wyagdon Enterprises Collection management risk assessment 14200 b Total 4464463 a) Expertise not available within the Gallery b) Resources not available within the Gallery c) External scrutiny required or preferred
Note: all amounts are quoted GST exclusive.
190 APPENDIX 17 COMPLIANCE INDEX AND CONTACT OFFICERS
COMPLIANCE INDEX CONTACT OFFICERS The National Gallery of Australia Annual Report The National Gallery of Australia is situated in 2007–088 has been prepared in accordance with Canberra at Parkes Place, Parkes. the Commonwealth Authorities and Companies (Report of Operations) Orders 20088 made under General correspondence should be addressed to: Section 48 of the Commonwealth Authorities and The Director Companies Act 1997. National Gallery of Australia GPO Box 1150 The following is a summary of this Annual Report CANBERRA ACT 2601 according to these requirements: Telephone: (02) 6240 6411 Advertising and Market Research Facsimile: (02) 6240 6529 Audited Financial Statements Website: nga.gov.au Business Continuity Management Chairman’s Foreword The National Gallery of Australia is open daily from Commonwealth Disability Strategy 10.00 am to 5.00 pm (closed Christmas Day). Commonwealth Ombudsman Consultants Enquiries regarding this report may be directed to: Contact Officers The Deputy Director Corporate Overview National Gallery of Australia Council Committees Telephone: (02) 6240 6401 Director’s Report Facsimile: (02) 6270 6411 Enabling Legislation Email: [email protected] Environment Protection and Biodiversity Equal Employment Opportunity Enquiries about procedures for seeking information Fraud Control Guidelines from the National Gallery of Australia under the Freedom of Information Freedom of Information Act 1982 may be made in Indemnities and Insurance writing by facsimile or email to: Industrial Democracy Freedom of Information Coordinator Internal and External Scrutiny National Gallery of Australia Letter of Transmittal GPO Box 1150 Occupational Health and Safety CANBERRA ACT 2601 Performance Based Pay Telephone: (02) 6240 6677 Performance Measures and Outcomes Facsimile: (02) 6240 6529 Privacy Legislation Email: [email protected] Responsible Ministers Website: nga.gov.au Risk Management Service Charter Social Justice and Equity Staffing List Staffing Overview Strategic Plan Table of Contents Training
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 191
INDEX INDEX
A The Asian Arts Society of Australia 37 Black, Margaret 26, 142 Aboriginal and Torres Strait Islander asset management 49 Black, Neville (donor) 118 art attendance statistics 10, 32, 163 Black robe white mist: art of the acquisitions 9, 22–3, 107–16 Atyeo, Mme Anne (donor) 25, 124, 135 Japanese Buddhist nun Rengetsu (exhibition) 10, 35, 37, 162, 165 Culture Warriors: National Atyeo, Sam 25, 123–4, 135 Indigenous Art Trienniall 5, 9, Audit Plan 2007–10 13 Blyth, Toby (donor) 23, 109 10, 22, 33, 34, 36, 41, 42, 43, 45, auditor’s report 60–1 Bogle, Michael 43 162, 164 Australian art Boles, Bernard 26, 124, 135 permanent collection rehang 162 acquisitions 22–6, 119–56 Bonyhady, Tim 42 Aboriginal Memorial 47 permanent collection rehang 162 Boyd, Arthur 24, 33, 156 access to the collection 18, 20, 29, 32 Australian Garden 47 Boyd, Daniel 23, 109 acquisitions 9–10, 22–9, 107–61 Australian Government Cultural Bracher, Roslynne 4, 9, 13, 22, 102, Aboriginal and Torres Strait Gifts Program 24 103, 110 Islander art 9, 22–3, 107–16 Australian History Identity and Values branding 45 Asian art 10, 27, 116–18 project 40 Brown, Joseph AO, OBE (donor) 24, Australian art 23–6, 119–57 Australian National Audit Office 13 140 international art 10, 27–8, 157–8 Australian nineteenth and early Building Committee 13, 103 Pacific art 10, 28, 160 twentieth century works of art building refurbishment 5, 47–8, 55 photography 10, 28–9, 141–2, 158 (new display) 162 Business Continuity Plan 14 statistics 161 Australian Street Stencilss 36 Butler, Roger 187 theatre art 10, 27, 159 Australian Surrealism: the Agapitos/ Buvelot, Louis 30 Acquisitions Committee 5, 13, 103 Wilson collectionn (exhibition) 9, 10, 24, 25, 30, 33, 45, 162 Acquisitions Strategy 22 C Adams, Tate 26, 142 Callinan, Ian AC 4, 5, 13, 102, 103 B advertising 15 Calvert, Samuel 26, 143 African art 9, 33 "A 4HICH 1UANG Calvert-Jones, Janet 9, 115 Agapitos, James OAM (donor) 9, 29, Babington, Jaklyn 39, 187 Calvert-Jones, John AM 4, 9, 102, 103, 121, 124–42 Baburaj, Dheepu 37 115 Ah Kee, Vernon 23, 107 Bacon, Phillip AM (donor) 24, 138 Cameron, Dorothy 25, 143 Ajioka, Chiaki 37, 38 Ballet Russe costumes 10, 27, 30, 38, Cameron, Peter (donor) 25, 143 American Friends of the National 159 Campbell, Bronwyn 37 Gallery of Australia 28, 50 Banggala, England 23, 107 Campbell, Oswald Rose 26, 143 Amor, Rick 25, 142 Barbara Blackman Temenos Cassatt, Mary 28, 158 Andy to Oz: parallel visions Foundation Lecture 41 Cazneaux, Harold 36 (exhibition) 11, 25, 34, 165 Barton, William 42 Cézanne, Paul 28, 34, 158 Antoinette, Michelle 38 Baselitz, George 28, 158 Champion de Crespigny, Robert AC 5, Apuatimi, Jean Baptiste 23, 41, 108 Beckmann, Max 10, 28, 158 13, 102, 103 archives 43 Beeche, Robyn 37 Chea, Hwei-f’en 37, 41 Arion, Herr 158 Bell, Richard 23, 108 Children’s Gallery 33, 39 Arni, Clare 29 Bell, Robert 38 Christano, Dadang 30, 37 Art and Alzheimer’s project 39 Benjamin, Sandy 24, 38 Churcher, Betty 41 Art Indemnity Australia 35 Beresford, Bruce 42 Coates, John and Diana (donors) 23, 109 Asian art Berg, Tony and Carol (donors) 10, 28, Coates, Liz 26, 125 acquisitions 10, 27, 116–18 158 Coe, David and Michelle 9, 22, 110 permanent collection rehang 162 Billabong, Willy 23, 109 Colin McCahon (exhibition) 164 research and publications 37 Binns, Vivienne 40 collection development 18, 19 Black, Dorrit 26, 124
194 Designated Work Groups 54 financial operations 49 Collection Study Room 40, 41 Deutscher, Chris (donor) 24, 139 financial reports 59–99 Comcover Risk Management Dickson, Lex 24, 119 Folan, Lucie 37, 187 Assessment Services 14 Diggins, Lauraine (donor) 23, 109 Fraud Control Plan 14, 15 commercial operations 44, 50 Director’s report 9–11 Fraud Risk Assessment 14 committees of inquiry 16 disability strategy 52 freedom of information 15, 16 Commonwealth Disability Strategy 52 disabled persons, access 40 Froud, Alan 11, 104, 105 competitive tendering and contracting Disaster Recovery Plan 14, 29 functions and powers of Gallery 13 51 Discovery Tours 40 funding 50 complaints procedure 53–4 display of the collection 33 compliance index 191 disposal of works of art 22 G conservation of the collection 11, Dix, Otto 34, 164 Garrett, Peter 6 29–30 Dixon, Christine 38, 187 Gasgoigne, Ben and family (donors) 9, Constable, Christopher and Philip documentation of the collection 31 24, 136 (donors) 24, 25, 141 Douglas, Melanie 24, 119 Gasgoigne, Rosalie 9, 24, 136 Constable, Janelle (donor) 24, 120 Drawn inn (exhibition) 40, 162 Gaughin, Paul 10, 28, 28, 34, 158 consultancy services 51 Dupain, Max 29, 33, 141 George W Lambert retrospective: consultants 190 heroes and iconss (exhibition) contact officers 191 E 10, 33, 45, 162 Contemporary Australian art from the George W Lambert Symposiumm 41 permanent collectionn (new Eagle, Mary 41 gifts 9–10, 22–9, 107–61 display) 162 East Asian Gallery 162 Gill, S T 26, 148 Continuous Improvement Action Plan Eastburn, Melanie 37, 38, 187 Gleeson, James 24, 33, 43, 126–9, 136, 54 Ebaterinja, Walter 23, 109 148 corporate governance 56 ecologically sustainable development Glover, Henry Heath 26, 148 corporate overview 12–16 48 Glover, John 25, 148 Croft, Brenda L 41, 187 education 39–40 Goal 1 Build and maintain an Crooke, Ray 26, 144 Edwards, Deborah 41 outstanding national art 1888 Melbourne Cupp (exhibition) 35, Crossland, J M 24, 136 collection 22–31 165 Crowley, Grace, retrospective 34, 164 Goal 2 Increase the audience for and Elaine and Jim Wolfensohn Gift Cullen, Gregor 25, 144, 145 engagement with the exhibitions (exhibition) 35, 165 Culliton, Lucy 25, 136 and programs of the NGA Culture Warriors: National Indigenous electronic collections 43 32–46 Art Trienniall 5, 9, 10, 22, 33, 34, Elliott, Simon 11, 104, 106 Goal 3 Create a welcoming and 36, 41, 42, 43, 45, 162, 164 Ellyard, Heather 25, 136 engaging visitor experience Curran, Charles AC 4, 5, 9, 13, 22, 50, Elze, Sophia 30 46–7 102, 103, 104, 110 Emergency Response Plan 14 Goal 4 Secure and strategically manage Curran, Eva 9, 22, 110 enabling legislation 12 resources to support Gallery environmental performance 48 operations and activities 48–51 D equal employment opportunity 52 Goal 5 Provide a safe and productive working environment for all Danta, Dorothy (donor) 28, 159 Ernst, Max 28, 158 staff 52–5 Darling, Gordon and Marilyn (donors) ethical standards 52 Goal 6 Ensure the highest standards of 9, 25, 107–8 exhibitions 33–5, 162 corporate governance 56 Davila, Juan 35 travelling 10, 11, 32, 34–5, 164 Goal 7 Build productive relationships Dawson-Damer, Ashley 4, 9, 13, 25, expenditure 49 with government and other 102, 103, 139 Eyerman, Charlotte 41 stakeholders 57 de Clario, Domenico 25, 136 Golovin, Alexander 30 de Heer, Rolf 42 F Gontcharova, Natalia 30 de Leon, Ernesto 27 facilities management 51 Gooding, Janda 41 de Medici, eX 25, 40, 41, 145 feedback on service standards 15, 53 Gordon Darling Australia Pacific Print de Sainson, Louis 26, 145–7 film screenings 42 Fund 9, 26, 110–14, 125, 144, 147, 154, 155 de Wesselow, Simkinson 26, 134 Finance, Risk Management and Audit Deacon, Destiny 41 Committee 5, 13, 14, 103 Gordon Darling Foundation Travel Degas, Edgar 10, 28, 38, 158 Grant 39
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 195 Gordon, Kevin 24, 120 I lectures and talks 41 Gott, Ted 41 imaging and digitisation 31 Lee, Riley 42 government funding 50 Imagining Papua New Guinea: prints Lewers, Darani 24, 120, 121 government, working with 57 from the national collection Lewis, Ann 165 Grace, Betty 42 (exhibition) 164 Levy, Col 24, 121 Grace Crowley: being modern Indian Gallery 5, 9 Liberman, Lee 5, 13, 102, 103 (retrospective exhibition) 34, 164 Individual Development and Lindsay, Percy 30 Graham, Patricia J 37 Performance Agreements Loane, John (donor) 25, 155 Gray, Anna (Anne) 36, 41, 187 (IDPAs) 53 loans 32, 166–82 Greenaway, Paul (donor) 29, 142 Indonesian photographs 10, 29 inward 32, 174–81 Greeno, Dulcie 42, 107 industrial democracy 53 outward 32, 166–73, 182 Griffith, Pamela 25, 148 Integrated Pest Management Plan 29 Lubin, David 41 Grishin, Sasha 41 interaction with other authorities 16 Luxton, John 42 Gu, Wenda 27, 116 internal and external scrutiny 13 Gudthaykudthay, Philip 23, 114 international art M acquisitions 27–8, 157–8 guides, voluntary 185–6 Macapagal Arroyo, HE Gloria 27, 116, Gumana, Malaluba 23, 114 permanent collection rehang 162 117, 118 research and publications 38 McCubbin, Frederick 9, 25, 30, 139 H McDonnell, Bridget (donor) 155 J Haks, Leo 10, 29 McElligott, Philip AM MBA 23, 114 Hall, Bernard 30, 43 Jacks, Robert 25, 149 McGill, Clyde 26, 151 Hall, Fiona 35 Jakupa, Pax Jr 26, 149 McPhee, John 25, 42 Hamm, Treahna 23, 41, 108 Jerrems, Carol 36 Magritte, René 28, 159 Hannaford, Mary Jane 24, 120 judicial decisions 16 Maguire, Tim 26, 150 Hansen, David 42 maintenance of the collection 29 Harris, Brent 25, 148–9 K management structure 13, 104 Harris, Catherine and David (donors) Kandinsky, Wassily 10, 28, 158–9 Manifold, Marion 25, 150 117 Kantilla, Kitty 23, 109, 114 Marcoussis, Louis 28, 159 Hart, Deborah 187 Keating, Megan 26, 130 Margaret Olley Foundation 26 Heiss, Anita 42 Kelly, Sara (donor) 25, 152 market research 15 Hemsley, Warwick 4, 5, 102, 103 key strategies 22, 32, 46, 48, 52, 56 Masereel, Frans 28, 159 Henshaw, Mark 39, 187 Kieven, Lydia 42 Mason, Penny 25, 151 Heritage Strategy 48 King’s Yard Hobart 23, 120 Masterpieces for the Nation Fund 9, Herring, Jane 38, 185 Kinsman, Jane 38 27, 116 Hessing, Mona 43 Kirsova, Helene 43 Matisse, Henri 10, 27, 159 Hickey, Dale 25 Knight, Beverly 41 Mawurndjula, John 23, 109 Hinchcliffe, Meredith 38, 185 Koedal, Beizam 42 Maxwell, Robyn 37, 187 Hing, Tung 29, 158 Kogan, Danial 26, 150 Maxwell, Simeran 38 Hirsh, Emmanuel (donor) 25, 141 Kohen, Apolline 41 Maymuru-White, Naminapu 23, 115 Hirst, Brian 24 Kreckler, Derek (donor) 26, 150 media 45 Hockney, David, 28, 158 Mellor, Danie 23, 115 Holt, Don and Janet (donors) 23, 109 L members programs 42 Holtermann, Bernardt Otto 30 membership 51 Lalique, René 27, 157 Hookey, Gordon 23, 41, 109 volunteers 185 Lambert, George W 24, 26, 33, 40, 41, Hope, Jonathan (donor) 118 131, 138 Menon, Padma 37 Horn, Timothy 25, 35, 156 retrospective 10, 33, 45, 162 merchandising 44 Horsefield, Gwen 39 Lancaster, Geoffrey 42 Meredith Hinchliffe Fund 24, 121 Howarth, Crispin 39 Lane, Leonie 25 Mesoamerican collection 9 Howoldt, Jenns 41 Larsen, Helge 24, 120 Michael Riley: sights unseen (exhibition) 35, 164 Hunter, Pauline (donor) 24, 121 Larter, Richard 35, 41 Milgram, B Lynne 41 Hunter, William 26, 149 retrospective 34, 45, 162 Milpurrurru, George 23, 109 Laverty, Colin and Elizabeth 41
196 Ombudsman 16 public programs 41 Ministers responsible for National online publishing 45–6 publications 36–9, 43, 187 Gallery 12 oral histories 43 publishing activities 44, 45 Minister’s Statement of Expectations Orde Poynton Gallery 33, 36 Pule, John 25, 153 56 O’Reilly, Chiara 42 Pushpamala N 29, 158 Moffatt, Tracey 35, 36 outcome and outputs 17–20 Music and dance in Javanese artt 42 Owens, Emilie 38, 39 R musical performances 42 Radford, Ron AM 4, 5, 6, 9–11, 24, 102, Muttukumaru, Peggy (donor) 118 P 104, 105, 187 Myer, Rupert AM 4, 5–6, 11, 13, 102, Paauwe, Deborah 29, 142 Ramsey, Ron 41 103, 104 Pacific art 2APHAEL #O Rauschenberg, Robert, collection 10 N acquisitions 10, 28, 160 new displays 33, 162 Rawling, Larry 9, 155 Nadjamerrek, Lofty Bardayal 23, 26, research and publications 39 Redback Graphics 26, 155 109, 111 Packer, Roslyn 4, 5, 13, 102, 103 reframing program 11 NAIDOC Week 42 Page, Louise 42 Rendezvous with Art program 40 Naidoo, Shanthini 11, 104, 106 Palangi, Nasser (donor) 116 Rengetsu, Otagaki 35, 37 Nair, Sulini 37 Pambegan, Arthur Koo’ekka 41, 110 research 36–9 Nakamarra, Doreen Reid 9, 23, 109 Pareroultja, Otto 23, 110 Research Library 42–4 Namatjira, Albert 9, 25, 107 Parr, Mike 25, 152 volunteers 185 Namok, Rosella 26, 111 Paspaley Family 9, 22, 110 responsiveness to Government and National Australia Bank Sculpture Perceval, John 9, 25, 139 Parliament 57 Gallery 9, 25 performance pay 53 retail store 44 National Capital Education Tourism Richard Larter: a retrospective Project 39 performance report 17–57 (exhibition) 34, 45, 162 National Gallery of Australia Council performances 42 risk management 14 4, 5, 13, 102 Perkins, Hetti 41 Risk Registers 14 National Gallery of Australia Council Petyarr, Gloria 26, 112 Robert Rauschenberg 1967–1978 Exhibitions Fund 11 photography (exhibition) 162 National Gallery of Australia acquisitions 10, 28–9, 141–2, 158 Roberts, Neil 43 Foundation 50, 117 exhibitions 10, 11, 28, 30, 36, 37, 43, Roberts, Pen 38, 185 National Indigenous Art Triennial 5, 45, 162 Roberts, Tom 24, 30, 140 9, 10, 22, 33, 34, 36, 41, 42, 43, framing project 11 Robertson, Barbara (donor) 142 45, 162, 164 research and publications 36–7 Robinson, William 25, 153 Neeson, John 25, 151 Picasso, Pablo 28, 159 Rockefeller, David 50 Newton, Gael 36 Picture paradise: Asia–Pacific Ngal, Angelina 23, 109, 110 photography 1840–1940 Roggenkamp, Joy 25, 140 Nicholas, William 24, 139 (exhibition) 11, 28, 30, 36, 37, Rooney, Robert 25, 35, 154 Nolan, Sidney 24, 33, 40, 132–3, 139 43, 45 Rotary Collection of Australian Art Nona, Dennis 9, 22, 23, 26, 41, 112, 115 Piguenit, William 26, 153 Fund 23, 26, 114 Notonegoro, Adje 27, 118 Planning, Risk Management and Rudd, Kevin 6 Nuske, Bruce 24, 121 Compliance Advisory Group 14 Rupert, Nura 26, 112 Polynesian collection 9 O Possum Tjapaltjarri, Clifford 9, 22, 110 S Poynton Bequest 10, 28, 117, 158 occupational health and safety 54–5 Safety and Integrated Systems Prescott Family Foundation 25 Committee 55 audit 11, 54 Preston, Margaret 26, 30, 153 Sanson, Gareth 25, 41, 141 judicial decisions 16 privacy policy 15 Savill, Denis (donor) 9, 25, 139 Ocean to Outback: Australian landscape painting 1850–1950 private funding 50 Sayers, Andrew 41 (exhibition) 11, 34, 36, 164 Proctor, Thea 26, 134, 153 Sculpture by the Seaa symposium 38 O’Connor, Sharon 36 Project Gallery 33, 36 Sculpture Garden Sundayy 39 O’Hehir, Anne 36, 37 promotion of Gallery programs 44 See, Pamela Mei-Leng 26, 134 Oliver, Bronwyn 25, 156 promotion of works of art 18, 20 Seligmann, Kurt 28, 159 Olley, Margaret 28, 158 protection of the collection 30 Senior Executive Service 56
NATIONAL GALLERY OF AUSTRALIA ANNUAL REPORT 2007–08 197 senior executives 56 Tools and techniques of printmaking W (exhibition) 162 senior management committees 56 Wagner, Siegfried 27, 157 Touch, Hab 37 Sensbergs, Jan 41 Walker, John R 26, 135 trade sales 44 Service Charter 15, 53 War: the prints of Otto Dixx 34, 164 Traill, Jessie 26, 154 Sharp, Martin 35 Ward, Frazer 41 training and development 53 Sheckter, Sandra 37 Ward, Lucina 38, 187 Trauer, Robert 155 Shelsher, Amanda 24, 122 Warden, Kathleen 38 Trauer, Tom (donor) 155 Shiko, Munakata 38 Warhol, Andy 11, 34 travelling exhibitions 10, 11, 32, 34–5, Singh, Dayanita 37 Watson, Judy 23, 26, 110, 113, 114 164 Small Objects Store 29 Watt, David 26, 135 Treescapee (exhibition) 40, 162 Smith, Jason 42 website 45–6, 188–9 Tremblay, Theo (donor) 25, 153 social justice and equity 15 Welden, Elizabeth 38 The Triumph of Landscapee forum 41 Sony Foundation Summer Scholarship Whistler: an artist abroadd (exhibition) Tse, Jonathan 26, 155 39 164 Tucker, Albert 24, 33, 135, 141 Southeast Asian Gallery 27 White, Robin 26, 156 Turner, J M W 36 special access tours 40 William Dobell Foundation archive 43 Turner to Monet: the triumph of sponsors 10, 183–4 Williams, Fred 40 Sriwanichpoon, Manit 41 landscapee (exhibition) 10, 30, 34, 35, 40, 41, 42, 44, 45, 46, 162 Wilson, Ray OAM (donor) 9, 24, 29, staff 52, 105 121, 124–42 25th anniversary celebrations 9, 41, 44, development and performance 50 Winn, Philippa 24, 119 agreements 53 Twenty-fifth Anniversary Gift Wolfensohn Family Foundation 50 statistics 52 Program 50 Wolpert, Andrew 41 training and development 53 Tyler, Kenneth and Marabeth 28, 50 Woollard, Diana (donor) 27, 157, 185 workplace agreements 52, 53 workforce planning 52 Stage fright: the art of theatre U workplace agreements 52, 53 (exhibition) 35, 164 workplace diversity 52 Star, Raphy (donor) 24 Underground Soundss 41 Worrall, Adam 11, 104, 105 Staunton, Madonna 25, 141, 157 Utopiaa 42 Wright, John Leslie 43 Stevens, John 37 UTSAV 2008 – Dance, Women, Culturee 37 Wylie, John and Myriam 9, 25, 139 Strategic Plan 2007–10 13 report against 21–57 V Y Stringer, John 26, 154 Yalandja, Owen 23, 115 Struck, Hermann 28, 159 Valamanesh, Hossein 25, 26, 135, 157 Yoshitoshi, Tsukioka 27, 117, 159 Summit group 5 van den Heuvel, Niki 38 Yunupingu, Gulumbu 23, 110, 114 Swallow, Ricky 25, 157 Vanderstukken, Robert (donor) 117 Vasilieff, Danila 30, 157 T Venice Biennale 37 venue hire 44 Takahashi, Sayumi 37 Vidor, Vicki OAM 26, 150 Talkin’ up big: artists’ dayy 41 VIP: very important photographs Taylor, Howard 24, 25, 135, 141, 157 1840s–1940ss (exhibition) 10, 36, teacher activities 40 162 Thayeb, Teuku Mohammad Hamzah Visions of Australia 11, 35 27 visitors 47 theatre art 10, 27, 159 attendance statistics 10, 32, 163 Thomas, Daniel 41 feedback on service standards 15, 53 Thorpe, Lesbia 25, 154 public programs 41 Tigoana 10, 28 research 47 Timberry, Esme 23, 42, 107 students 39 Tipping, Richard 26, 154 travelling exhibitions 35 Tjakamarra, Anatjari No III 23, 110 voluntary guides 30, 185–6 Tjupurrula, Turkey Tolson 23, 110 volunteers 185–6 Tomescu, Aida 25, 135 Vongpoothorn, Savanhdary 40
198