2020 ANNUAL REPORT Merrimack Valley School District • SAU #46 M V 2 0 2 0 B E S L E S P E S S E S W E S M V M S M V H S M V L C I T ’ S A M A T T E R O F P R I D E
• MVSD Mission Statement • Ensuring that ALL students are provided with the knowledge, skills, and values necessary to prepare them for college, career, and citizenship
• MVSD • 105 Community Drive • Penacook, NH • 03303 • SAU #46 • p - 603.753.6561 • f - 603.753.6023 • http://www.mvsdpride.org • 2020 Annual Report | Merrimack Valley School District
Table of Contents
School Board Committee Assignments/Meetings …………… 2 Staff/School Directory ………………………………………… 3 2020 Warrant …………………………………………………… 4 Minutes of 2019 Annual Meeting ……………………………… 6 Proposed 2020-2021 Budget …………………………………… 11 Estimated Revenue Information ……………………………… 16 Projected/Estimated Tax Rates ……………………………… 17 Report of the School Board Chairperson ……………………… 18 Report of the Superintendent of Schools ……………………… 19
Annual School Reports Boscawen Elementary School ………………………………… 21 Loudon Elementary School …………………………………… 22 Penacook Elementary School ………………………………… 23 Salisbury Elementary School…………………………………… 24 Webster Elementary School …………………………………… 25 Merrimack Valley Middle School ……………………………… 26 Merrimack Valley High School ………………………………… 27
Class 2019 Final College Choices ……………………………… 29 Service Awards ………………………………………………… 30 Committee Structure and Reports …………………………… 31 MVSD Long Range Progress Report ………………………… 33 Enrollment Report (October 2019) …………………………… 36 Retiring Faculty………………………………………………… 37
1 2020 Annual Report | Merrimack Valley School District /EP]]Y ] 2 2020 Annual Report | Merrimack Valley School District 3 2020 Annual Report | Merrimack Valley School District State of New Hampshire Merrimack Valley School District WARRANT for Annual District Meeting March 6, 2020 To the inhabitants of the pre-existing School Districts of Boscawen, Loudon, Penacook, Salisbury, and Webster comprising the Merrimack Valley School District, qualified to vote in Merrimack Valley School District affairs: You are hereby notified to meet at the Merrimack Valley High School on Friday the 6th day of March next at seven o’clock in the afternoon to act on the following subjects. (The polls will be open for balloting on Articles I and II from 11:00 a.m. to 7:00 p.m. except as otherwise ordered at the meeting. All other articles will be acted upon commencing at 7:00 p.m.) ARTICLE I. To choose a moderator, by ballot, for the ensuing year. ARTICLE II. To choose, by ballot, five school board members, one from the pre-existing District of Boscawen to serve for a term of three years; one from the pre-existing District of Loudon to serve for a term of three years; one from the pre-existing District of Penacook to serve for a term of three years; and one from any of the pre-existing Districts for the At-Large position to serve for a term of three years; and one from the pre-existing District of Salisbury for a term of two years. One elected candidate must be a resident of Boscawen, one elected candidate must be a resident of Loudon, one elected candidate must be a resident of Penacook, one elected candidate must be a resident of any of the five pre-existing towns and one elected candidate must be a resident of Salisbury. All candidates will be elected at large. ARTICLE III. Shall we adopt the provisions of RSA 40:13 (known as SB 2) to allow official ballot voting on all issues before the Merrimack Valley School District on the second Tuesday of March? By Petition ARTICLE IV. To see if the School District will approve the cost items included in the collective bargaining agreement reached between the Merrimack Valley School Board and the Merrimack Valley Education Association, which calls for the following estimated increases in salaries and benefits: 2020-2021 $ 833,843 2021-2022 $ 399,676 2022-2023 $ 413,585 And further, to raise and appropriate the sum of $833,843 for the 2020-2021 fiscal year, such sum representing the additional costs attributable to the increase in salaries and benefits required by the new agreement over those that would be paid at current staffing levels. 7KH6FKRRO%RDUGUHFRPPHQGV WKLVDUWLFOH ARTICLE V. Shall the School District, if Article IV is defeated, authorize the governing body to call one special meeting, at its option, to address Article IV cost items only? (Majority vote). ARTICLE VI. To see if the School District will vote to raise and appropriate the sum of Forty One Million Eight Hundred Fifty Nine Thousand One Hundred Forty Dollars ($41,859,140) for the support of schools, the salaries of school district officials and agents, and for the payment of statutory obligations of said District, and to authorize the application against said appropriation of such sums as are estimated to be received from the State’s adequate education grants together with other income. The School Board shall certify to the selectmen of each of the towns of Boscawen, Loudon, Salisbury and Webster and the City Council of Concord for Penacook the amount to be raised by taxation of said municipalities. This article 4 2020 Annual Report | Merrimack Valley School District does not include appropriations voted in other warrant articles. 7KH 6FKRRO %RDUG UHFRPPHQGV WKLV DUWLFOH ARTICLE VII. To see if the School District will vote to raise and appropriate the sum of Three Hundred Thousand Dollars ($300,000) with said funds to be deposited in the Maintenance Expendable Trust Fund for the purposes of maintaining school buildings and grounds. 7KH 6FKRRO %RDUG UHFRPPHQGV WKLV DUWLFOH ARTICLE VIII. To transact any other business that may legally come before this meeting. Given under our hand at said Penacook this 10th day of February 2020. Merrimack Valley School Board Tracy Ann Bricchi Lorrie Carey Andrew Chalsma Sally Hirsh Dickinson Bradley Kulacz Seelye Longnecker Bobbi-Jo Michael Melissa Muzzy Timothy Vendt Laura Vincent 5 2020 Annual Report | Merrimack Valley School District Merrimack Valley School District Annual Meeting Minutes March 7, 2019 The polls held in the Merrimack Valley High School Auditorium for Articles I, II, and III were opened by Moderator Charles Niebling at 11:00 a.m. The following ballot clerks and supervisors were duly sworn in by the Moderator; Sarah Chalsma, Judy Elliot, Deborah Matott, Francine Clave, Agnes Colby, April Rollins, Marjorie Schoonmaker, Marie Griffith, Pamela Malcolm, Lynne Riel, Helen Capps, George Cummings, Dorothy Swenson, Henry Bergeron Sherlene Fisher. Martha Vendt, School District Clerk, and John Herbert, Assistant Moderator, were also sworn in by the Moderator. At 11:00 a.m. Moderator Niebling announced that the ballot boxes were inspected and showed that they were empty and ready for use. The supervisors verified that the ballot boxes were empty. Moderator Niebling asked Assistant Moderator John Hebert to lock the ballot boxes, then declared the polls open for Articles I, II, and III, and stated that all other articles would be acted upon beginning at 7:00 p.m. At 4:22 p.m. Moderator Niebling read the names and towns of each absentee ballot. After confirmation by the ballot clerks that they were registered voters, the Moderator placed the ballots in the ballot box. There were 9 absentee ballots. At 6:40, 6:43, 6:49, 6:53, and 6:56 p.m. Moderator Niebling reminded the voters that the polls for Articles I, II, and III would be closing promptly at 7:00; however, those still in line on the stage may continue to check in and vote. If not on stage at 7:00, voters would not be allowed to vote. School Board members present were Caroletta Alicea, Tracy-Anne Bricchi, Lorrie Carey, Andrew Chalsma, Hilary Denoncourt, Sally Hirsh-Dickinson, Seelye Longnecker, Bobbi-Jo Michael, Melissa Muzzy and, Laura Vincent. Also present were Superintendent Mark MacLean, Assistant Superintendent Randy Wormald, Business Administrator Robin Heins, Human Resources Manager Kathleen Boucher, Facilities Director Fred Reagan, Technology Director Lee Despres, Legal Counsel Shawn Tanguay, and other District Administrators. At 7:00 p.m. Moderator Niebling welcomed those present to the MVSD Annual Meeting. He declared that the Warrant Articles were open for action and the polls were closed for action on Articles I, II, and III. Moderator Niebling asked Assistant Moderator John Hebert to unlock the ballot box and distribute the ballots to the ballot clerks and checklist supervisors to count the votes for Articles I, II, and III after all voters on stage completed submitting their ballots. Moderator Niebling recognized Fred Reagan to lead the Pledge of Allegiance and the Merrimack Valley High School Chorus to lead the National Anthem. He then respectfully asked all veterans to stand and be recognized and thanked them for their service. Moderator Niebling recognized John Hebert, Salisbury resident, who has agreed to serve as Assistant Moderator, and Martha Vendt, District Clerk. Moderator Niebling reviewed the Merrimack Valley School District Moderator’s rules of procedure handout for the meeting, if accepted. These included methods of voting such as voice vote, card count, and secret ballot, stating that if he was not able to determine the majority by voice vote, he would proceed to card vote. Moderator Niebling asked voters who wished to speak during the meeting to go to the microphones and, when recognized, to state their name and town of residence clearly, for the record. Moderator Niebling explained that any decision of the moderator could be overruled by a majority vote. Moderator Niebling also advised that any action could be reconsidered later in the meeting prior to adjournment unless, before moving on to another article, a motion is made to apply the provisions of RSA 40:10. There were no questions from the public regarding the rules of procedure. Motion was made from the floor, second from the floor to accept the Merrimack Valley School District Moderator’s rules of procedure. The motion carried. Moderator Niebling introduced MVSD Board Chair Seelye Longnecker. Board Chair Longnecker began by welcoming everyone to the Annual Meeting. Board Chair Longnecker introduced the School District Clerk, School Board Members, Legal Counsel, Shawn Tanguay, Superintendent Mark MacLean, Assistant Superintendent Randy Wormald, Business Administrator Robin Heins, Human Resources Manager Kathleen Boucher, Facilities Director Fred Reagan, and Technology Director Lee Despres. Board Chair Longnecker recognized MVHS student achievements. 6 2020 Annual Report | Merrimack Valley School District Board Chair Longnecker recognized two Board Members leaving the School Board. Seelye recognized Caroletta Alicea having served the School Board for 19 years for the town of Boscawen. Seelye discussed Caroletta’s service in Concord as a State Representative, the committees she served while on the School Board, that Caroletta’s focus was always based on what was best for the students, and her being instrumental giving Merrimack Valley High School students the opportunity to serve as Pages in the New Hampshire House of Representatives. Seelye wished Carolletta the very best as she retires from the Board, thanked her for her service, and added that she would be greatly missed. Seelye also recognized Kristen Byron, At-Large Board Member, stepping down from the Board to take a job at the Merrimack Valley High School. Seelye listed the committees she served on for the past two years, thanked her for her service, and added that she would be greatly missed. Seelye Longnecker made an announcement concerning the process to fill the vacancy of an At-Large Board Seat. The Board would interview applicants at their April 8, 2019 school board meeting. At 7:21 p.m. Moderator Niebling stated that Articles I, II, and III were still being tallied. As soon as the tallies were available, and at the conclusion of a warrant article the Moderator would interject and announce the results of Articles I, II, and III. Moderator Niebling proceeded to act on Article IV, and read Article IV as follows: Article IV: To see if the School District will vote to raise and appropriate the sum of Forty One Million, Two Hundred Two Thousand, Five Hundred Seventy One Dollars ($41,202,571) for the support of schools, the salaries of school district officials and agents, and for the payment of statutory obligations of said District, and to authorize the application against said appropriation of such sums as are estimated to be received from the State’s adequate education grants together with other income. The School Board shall certify to the selectmen of each of the towns of Boscawen, Loudon, Salisbury and Webster, and the City Council of Concord for Penacook the amount to be raised by taxation of said municipalities. This article does not include appropriations voted in other warrant articles. The School Board recommends this article. Motion from Bobbi-Jo Michael, second from the floor to approve Article IV. Bobbi-Jo Michael spoke to the Article, reviewed the functions, indicated increases and decreases, and shared the factors that lead to the changes in the proposed budget. Overall in the proposed budget there are increases of Seven Hundred Ninety Eight Thousand, Four Hundred Twelve Dollars, ($798,412.00), and decreases of Three Hundred Eighty Four Thousand, Three Hundred Sixty Eight Dollars ($384,368.00), resulting in a net increase of Four Hundred Fourteen Thousand, Fourteen Dollars ($414,014), or 1.02% from the approved 2018-2019 budget. The areas of increase include health and retirement, transportation, fleet increase, security cameras and increased maintenance expenses, extended school year programs, one Special Education position at Boscawen Elementary School, reading teachers usually paid for by Title 1 monies being moved to the operating budget, band uniforms, testing, speech services, physical therapy services, technology due to tenuous federal funding, and copier lease increase. The areas of decrease include retirements, hiring new teachers to replace veteran teachers, decrease in site improvement due to last year’s emergency egress at Boscawen Elementary School which is not in this year’s budget, and supply and equipment lines. Bobbi- Jo discussed the difficulty in New Hampshire’s revenues as a State, the loss of stabilization, and the decrease in Special Education aid resulting in a loss of overall expected revenues. The average per pupil cost is Fourteen Thousand, Seven Hundred Forty Two Dollars and Fifty Five Cents ($14,742.55) in our District which costs about One Thousand, One Hundred Dollars ($1,100) less per student than the state average of Fifteen Thousand Eight Hundred Sixty Five Dollars and Twenty six Cents ($15,865.26). The State’s main adequacy grant provides only Three Thousand, Seven Hundred Eight Dollars and Seventy Eight Cents ($3,708.78) per pupil. Bobbi-Jo also discussed revenue projections. Moderator Niebling opened the floor for discussion and amendments. Ken Ross Raymond, Salisbury resident, noted that though the budget increase is 1.02%, the obligation to the taxpayer is expected to increase by 3.80%. Article IV was adopted by a voice vote. At 7:32 p.m. Moderator Niebling announced that a total of Four Hundred Sixty Five (465) ballots were cast. Motion made by Julie Nudd, Webster resident, second by the floor, to restrict reconsideration of Article IV, applying the provisions of RSA 40:10. The motion to restrict reconsideration of Article IV applying provisions of RSA 40:10 was adopted by a voice vote. 7 2020 Annual Report | Merrimack Valley School District Mike Jette, Webster resident, made a request to Moderator Niebling to have the votes broken down by towns out of the total number of registered voters. Moderator Niebling agreed to the request when available. Moderator Niebling read Article V as follows: Article V: To see if the School District will approve the cost items included in the collective bargaining agreement reached between the Merrimack Valley School Board and the Merrimack Valley Support Staff Association, which calls for an increase in salaries and benefits. The estimated increase for 2019-2020 is $176,228. The estimated increase for 2020-2021 is $175,045. The estimated increase for 2021-2022 is $166,682. And further, to raise and appropriate the sum of $176,228 for the 2019-20120 fiscal year, such sum representing the additional costs attributable to the increase in salaries and benefits required by the new agreement over those that would be paid at current staffing levels. The School Board recommends this article. There was a motion from Sally Hirsh-Dickinson, second from the floor to approve Article V as written. Sally Hirsh- Dickinson spoke to Article V, stating the contract is for a three year agreement beginning July 1, 2019 and ending June 30, 2022. There is an increase in wages each year. 1.4% increase plus steps in the first year (2.4% overall), 1.5% increase plus steps the second year (2.5% overall), and 1.5% plus steps the third year (2.5% overall). The insurance stays the same all three years with a consumer driven higher deductible plan all three years at 97% per individual, 92% for two people, and 85% for families. Insurance buy-backs will increase from $1,000, to $1,250 year one, $1,400 year two and, $1,500 year three. Sally also noted that there were language changes, stated total costs per year, and thanked the stakeholders for their participation in the process. Moderator Niebling opened the floor for discussion. Carissa Corrow, Esther Crowley, Ed Laughlin, and David Farr (Penacook residents) all made comments and asked question relative to the pay scale, their support of higher hourly rates, and the CBA’s inclusion in the operating budget. SAU administration responded. Article V was adopted by a voice vote. Motion made by Julie Nudd, Webster resident, to restrict reconsideration of Article V applying the provisions of RSA 40:10. Moderator Niebling reminded the body that the process had already been discussed and brought it to a voice vote. Point of order from the floor there was no second to the motion. Moderator Niebling withdrew the vote. Moderator Niebling apologized and asked for a second to the motion to restrict reconsideration of Article V. There was a second from the floor. Moderator Niebling asked if there was any discussion on the motion, and thanked the individual who pointed out the point of order. There was no discussion. The motion to restrict reconsideration of Article V applying provisions of RSA 40:10 was adopted by a voice vote. Motion was made from the floor second from the floor to pass over Article VI which reads: Article VI: Shall the School District, if Article V is defeated, authorize the governing body to call one special meeting, at its option, to address Article V cost items only? (Majority vote) There was no discussion. The motion to pass over Article VI was adopted. Moderator Niebling read Article VII as follows: Article VII: To see if the School District will vote to raise and appropriate the sum of Seventy Five Thousand Dollars ($75,000) to fund the position of a School Resource Officer at the Middle School. The School District would fund 75% of the total cost for this position, with the City of Concord funding the remaining 25%. The School Board recommends this article. Motion from the Seelye Longnecker, second from the floor to approve Article VII. Board Chair Seelye Longnecker spoke to the Article. Seelye discussed the result of surveys from the Long Range Planning Committee stating that the school safety and security of the schools as a top priority among all of the responding groups. The addition of an School Resource Officer is seen as a deterrent and a preventative measure to school violence, a proactive measure to increase security and safety at the middle school, provide an avenue for increased education, and an 8 2020 Annual Report | Merrimack Valley School District understanding of the role of the police in our communities. She further discussed the benefit of having another adult monitoring and responding to social emotional learning at the middle school, and having a School Resource Officer available to connect with teachers on civics and leadership topics among other things. Seelye then discussed the process of agreement with the Concord Police department should this Article pass. Moderator Niebling opened the floor for amendment, discussion or debate. There were multiple questions and statements from the legislative body (Jessica Jore and Heather Winchel from Boscawen; Trudy Mott-Smith and Jim O’Neill from Loudon; Carissa Corrow, Liam Jewel, Becky King, and Jess from Penacook; Nicollette from Salisbury; Sarah Chalsma, Heidi Ohlson, and Dan Nudd from Webster). Some comments questioned the need and fit of an SRO. Other comments were in support of the position. SAU administration responded. Motion has been made to move the question which was passed with a voice vote. Article VII has been moved and seconded, question was asked, voice vote was not able to be determined. Moderator Niebling asked for a show of cards and for ballot clerks to count the cards. Point of order there was no second on the motion. Moderator Niebling stated he did get a second to the motion to Article VII when he first introduced it. Clerk Martha Vendt agreed to the Moderator’s statement.Both misunderstood that the point of order was addressing the motion made to move the question, not Article VII. The meeting continued, as this was not clarified until the recording was heard the following day. A total of 168 votes were cast with 116 in the affirmative and 52 in the negative. Article VII is adopted with a card count vote. At 8:18 pm Moderator Niebling presented the results of the ballot voting and answered Mr. Jette’s request for total ballots cast versus registered voters by town. There were 465 ballots cast. Boscawen had 69 votes from 2569 registered voters. Loudon had 137 votes from 4214 registered voters. Penacook had 115 votes from 3627 registered voters. Salisbury had 97 votes from 1125 voters. Webster had 47 votes from 1295 registered voters. Article I: To choose a moderator, by ballot, for the ensuing year. A total of 387 ballots were cast for Charles Niebling, a total of 7 write-ins were cast. Charles Niebling is elected moderator for the ensuing year. Article II: To choose by ballot, four school board members, one from the pre-existing District of Boscawen to serve for a term of three years; one from the pre-existing District of Salisbury to serve for a term of three years; one from the pre- existing District of Penacook to serve for a term of three years; and one from the pre-existing town of Webster to serve for a term of three years. One elected candidate must be a resident of Boscawen, one elected candidate must be a resident of Salisbury, one elected candidate must be a resident of Penacook, and one elected candidate must be a resident of Webster. All candidates will be elected at large. Tim Vendt of Boscawen received 316 votes. There were 14 write in votes. Tracy-Anne Bricchi of Penacook received 328 votes. Hilary Denoncourt of Salisbury received 289 votes. Louise Andrus of Salisbury received 112 votes. Andrew Chalsma of Webster received 316 votes. There was 1 write in votes. Moderator Niebling announced that Tim Vendt, Hilary Denoncourt, Tracy Anne-Bricchi, and Andrew Chalsma were elected. Article III: Shall we adopt the provisions of RSA 40:13 (known as SB 2) to allow official ballot voting on all issues before the Merrimack Valley School District on the second Tuesday of March? {By Petition} A total of 462 ballots were cast on Article III. Statute requires that SB 2 be adopted by a three-fifths majority. Three-fifths of 462 is 277.2. For Article III to be adopted it would require 278 affirmative votes. There were 147 votes in the affirmative, 315 votes in the negative. Article III is defeated. Motion was made and seconded to restrict reconsideration of Article VII. The motion to restrict reconsideration of Article VII applying provisions of RSA 40:10 was adopted by a voice vote. 9 2020 Annual Report | Merrimack Valley School District Moderator Niebling read Article VIII as Follows: Article VIII: To see if the School District will vote to raise and appropriate the sum of up to One Hundred Twenty Thousand Dollars ($120,000) with said funds coming from the unassigned fund balance on June 30, 2019, to be deposited in the Maintenance Expendable Trust Fund for the purposes of maintaining school buildings and grounds. The School Board recommends this article. Motion from Tracy-Anne Bricchi, second from the floor to adopt Article VIII as written. Tracy-Anne Bricchi spoke to the article giving a brief history of the Maintenance Expendable Trust Fund, The Capital Improvement Plan, and feedback from the community to save money in anticipation of large cost repairs. The request is to deposit $120,000 in the Maintenance Expendable Trust Fund for anticipated maintenance costs. Moderator Niebling opened the floor for questions comments or further amendments. Matthew Henry, Penacook resident, asked about Capital Reserve and Expendable Trust Fund balance summaries. Robin Heins responded. Matthew requested a summary of Trust Funds in the Annual report for subsequent years. Comments and questions were posed by Bill Heinz from Boscawen, Chris Koufos from Loudon, Randy Warring and Kevin Roddard from Penacook, Laura Taylor from Salisbury, and Therese Olson Martin from Webster. These included queries about the fund balance, trust fund balances, and how ongoing maintenance is supported via the operational budget. SAU and District administration responded. Article VIII was adopted by a voice vote. Moderator Niebling read Article IX as follows: Article IX: To transact any other business that may legally come before this meeting. Seelye Longnecker addressed the past petitioned articles involving changing ways and times of meetings through the years in order to engage more voters in the Annual Meeting process. She read a statement relative to the Board working with Administration investigating other structures used in other cooperative districts in order to engage more community members while preserving the Annual meeting. Seelye raised the following question: “Would you be in favor of moving the Merrimack Valley School District Annual meeting to a Friday evening, where fewer people have work the next morning, and it’s not a school night?” Seelye stated that the voters’ answer would only be advisory, but the Board would take it into serious consideration. Motion was made by Seelye Longnecker, second from the floor to move the Merrimack Valley School District Annual meeting to a Friday evening. The motion, understood as advisory only, carried by voice vote. Carrissa Corrow, Penacook resident, asked for a post-IB update. Randy Wormald responded. Julie Nudd, Webster resident asked what the net gain or loss was of the Boscawen Elementary egress including the site work and purchase and sale of the house. Fred Reagan responded. Tim Vendt, Boscawen resident, asked questions relative to the size of the student body in the future, wondering if the current high school building would sustain the numbers, or if the school board has discussed purchasing a new high school. Mark MacLean responded. Motion made by Julie Nudd, second from the floor to adjourn the meeting. Moderator Niebling asked the Annual Meeting to recognize the Supervisors of the checklist and Ballot clerks before adjourning. The meeting was adjourned at 8:48 p.m. Respectfully Submitted, Martha Vendt, District Clerk 10 2020 Annual Report | Merrimack Valley School District MERRIMACK VALLEY SCHOOL BOARD PROPOSED BUDGET 2020-2021 2018-2019 2019-2020 2020-2021 Approved Adjusted Proposed Difference 1100 REGULAR EDUCATION Salaries 9,433,090 9,438,548 9,334,548 (104,000) Benefits 4,211,622 4,347,330 4,351,535 4,205 Conference/Workshops 12,199 15,914 14,385 (1,529) Repairs and Maintenance 7,710 5,590 5,590 - Purchased Technical Services (Travel) 1,875 1,875 1,875 - Supplies, Printed Media 429,651 429,809 424,609 (5,200) Furniture & Equipment 76,740 87,489 99,493 12,004 TOTAL 1100 FUNCTION 14,172,887 14,326,555 14,232,035 (94,520) 1210 SPECIAL EDUCATION PROGRAMS Salaries 3,258,239 3,774,770 3,764,610 (10,160) Benefits 1,825,972 1,851,918 1,912,153 60,235 Tuition & Travel 1,295,264 1,295,264 1,180,250 (115,014) Supplies, Printed Media 14,407 14,807 14,807 - Furniture & Equipment 3,290 3,290 3,290 - TOTAL 1210 FUNCTION 6,397,172 6,940,049 6,875,110 (64,939) 1211 SPECIAL EDUCATION (Extended School Year) Salaries 99,600 121,640 126,640 5,000 Benefits 24,492 25,991 26,051 60 Purchased Professional Services 42,989 44,944 44,944 - Tuition & Travel 180,600 190,600 190,600 - Supplies 674 674 674 - TOTAL 1211 FUNCTION 348,355 383,849 388,909 5,060 1260 BILINGUAL PROGRAMS Salaries 69,167 72,709 72,709 - Benefits 70,200 72,431 76,662 4,231 Supplies, Printed Media, Travel 1,375 1,375 1,375 - TOTAL 1260 FUNCTION 140,742 146,515 150,746 4,231 1290 READING PROGRAMS Salaries 598,274 635,268 612,006 (23,262) Benefits 271,396 258,204 269,784 11,580 Repairs & Maint. 1,600 1,600 1,600 - Purch. Prof. Services 1,290 1,240 1,240 - Supplies, Printed Media 2,678 4,404 4,404 - New Equipment 1,725 1,725 1,725 - Dues - - - - TOTAL 1290 FUNCTION 876,963 902,441 890,759 (11,682) 1300 VOCATIONAL EDUCATION Tuition 212,000 212,000 300,000 88,000 TOTAL 1300 FUNCTION 212,000 212,000 300,000 88,000 1410 CO-CURRICULAR ACTIVITIES Salaries (Advisors) 88,000 90,583 136,000 45,417 Benefits 20,793 22,891 22,926 35 Travel 630 630 630 - Band Uniform Replacement - 25,000 - (25,000) Dues (Band, Music, Math, OM) 1,980 1,980 1,980 - TOTAL 1410 FUNCTION 111,403 141,084 161,536 20,452 1420 ATHLETIC PROGRAMS Salaries (Athletic Director/Coaches) 272,742 282,279 282,279 - Benefits 88,406 88,602 90,211 1,609 Purchased Prof. Services (Athletic Trainer) 40,000 37,000 37,000 - Officials/Supplies 59,625 59,625 70,125 10,500 Uniform Replacement 25,000 18,000 12,000 (6,000) New Equip/Programs/Dues 5,429 5,429 5,429 - TOTAL 1420 FUNCTION 491,202 490,935 497,044 6,109 11 2020 Annual Report | Merrimack Valley School District MERRIMACK VALLEY SCHOOL BOARD PROPOSED BUDGET 2020-2021 2018-2019 2019-2020 2020-2021 Approved Adjusted Proposed Difference 2110 SCHOOL RESOURCE OFFICER Purchased Professional Services 80,489 159,891 166,287 6,396 TOTAL 2110 FUNCTION 80,489 159,891 166,287 6,396 2113 DIAGNOSTIC SERVICES Salaries 59,498 65,498 65,498 - Benefits 23,987 34,704 36,119 1,415 Supplies, Printed Media 1,500 1,000 1,000 - TOTAL 2113 FUNCTION 84,985 101,202 102,617 1,415 2120 SCHOOL COUNSELING SERVICES Salaries 716,785 778,550 768,550 (10,000) Benefits 401,143 410,836 429,387 18,551 Purchased Prof. Services (Assessment) 41,259 50,043 44,543 (5,500) Purchased Technical Services 750 750 475 (275) Supplies, Printed Media 11,025 11,025 11,025 - Furniture & Equipment - - - - Dues - - - - TOTAL 2120 FUNCTION 1,170,962 1,251,204 1,253,980 2,776 2122 STUDENT MENTORING SERVICES (Drug/Alcohol) Counseling (Contracted) 55,720 55,720 67,200 11,480 Supplies - - - - TOTAL 2122 FUNCTION 55,720 55,720 67,200 11,480 2130 HEALTH SERVICES Salaries 540,667 554,852 554,852 - Benefits 289,414 290,744 303,031 12,287 Purchased Professional Services 3,900 3,900 3,900 - Repair & Maintenance 500 500 500 - Purchased Technical Services (Linen/Insur.) 6,275 6,275 6,275 - Supplies, Printed Media 10,307 23,050 22,350 (700) Furniture & Equipment 894 500 500 - Dues - - - - TOTAL 2130 FUNCTION 851,957 879,821 891,408 11,587 2132 STUDENT HEALTH SUPPORT SERVICES (LADAC) Salaries 66,000 66,000 66,000 - Benefits 44,434 39,465 41,278 1,813 TOTAL 2132 FUNCTION 110,434 105,465 107,278 1,813 2140 PSYCHOLOGICAL SERVICES Salaries 106,846 106,846 106,846 - Benefits 73,701 74,890 78,703 3,813 Purchased Professional Services 7,000 8,000 8,000 - TOTAL 2140 FUNCTION 187,547 189,736 193,549 3,813 2149 BEHAVIORAL SERVICES Salaries 57,498 58,498 58,498 - Benefits 34,529 33,957 36,159 2,202 Purchased Professional Services 12,000 12,000 12,000 - TOTAL 2149 FUNCTION 104,027 104,455 106,657 2,202 2150 SPEECH SERVICES Salaries 387,871 482,520 482,520 - Benefits 151,230 205,363 212,832 7,469 Purchased Professional Services 129,494 101,494 81,494 (20,000) TOTAL 2150 FUNCTION 668,595 789,377 776,846 (12,531) 2153 HEARING & VISION SERVICES Salaries 203,636 148,636 148,636 - Benefits 109,042 80,577 85,958 5,381 Purchased Professional Services 138,000 138,000 138,000 - TOTAL 2153 FUNCTION 450,678 367,213 372,594 5,381 12 2020 Annual Report | Merrimack Valley School District MERRIMACK VALLEY SCHOOL BOARD PROPOSED BUDGET 2020-2021 2018-2019 2019-2020 2020-2021 Approved Adjusted Proposed Difference 2162 PHYSICAL THERAPY SERVICES Purchased Professional Services 72,913 82,733 94,762 12,029 TOTAL 2162 FUNCTION 72,913 82,733 94,762 12,029 2163 OCCUPATIONAL THERAPY Salaries 227,672 264,772 264,772 - Benefits 150,781 151,069 158,533 7,464 Purchased Professional Services 52,500 52,500 52,500 - TOTAL 2163 FUNCTION 430,953 468,341 475,805 7,464 2190 STUDENT SUPPORT SERVICES Salaries 354,819 471,422 471,422 - Benefits 201,621 233,491 242,978 9,487 Purchased Professional Services 56,887 56,887 56,887 - Supplies, Printed Media, Postage 4,180 4,180 4,180 - Furniture & Equipment 900 900 900 - Dues 1,800 2,200 2,200 - TOTAL 2190 FUNCTION 620,207 769,080 778,567 9,487 2210 INSTRUCTIONAL STAFF MENTORING Salary 33,238 35,161 35,161 - Benefits 25,059 15,691 16,187 496 Travel 1,900 1,900 1,900 - TOTAL 2210 FUNCTION 60,197 52,752 53,248 496 2211 CURRICULUM SERVICES Supplies, Printed Media, Software 1,800 1,800 1,800 - TOTAL 2211 FUNCTION 1,800 1,800 1,800 - 2212 CURRICULUM DEVELOPMENT Salaries 39,076 24,476 24,476 - Benefits 10,080 10,101 10,124 23 Conference - MVSSA 7,830 7,830 7,830 - TOTAL 2212 FUNCTION 56,986 42,407 42,430 23 2213 INSTRUCTIONAL STAFF TRAINING Course Reimbursement 77,628 77,628 89,500 11,872 Workshops/Conferences 61,750 61,750 61,750 - TOTAL 2213 FUNCTION 139,378 139,378 151,250 11,872 2219 OTHER IMPROVEMENT OF INSTRUCTION Purchased Professional Services 4,322 4,322 4,322 - TOTAL 2219 FUNCTION 4,322 4,322 4,322 - 2222 SCHOOL LIBRARY SERVICES Salaries 252,073 264,231 264,231 - Benefits 177,801 179,542 181,106 1,564 Repair & Maintenance 1,700 1,600 1,300 (300) Travel/Conference 600 600 600 - Supplies, Books, Printed Media 31,770 40,170 41,370 1,200 Furniture & Equipment 3,040 3,040 3,040 - Dues 30 20 20 - TOTAL 2222 FUNCTION 467,014 489,203 491,667 2,464 2225 COMPUTER ASSISTED INSTRUCTION SERVICES Salaries 323,756 339,799 339,799 - Benefits 149,434 158,448 158,572 124 Repairs & Maintenance 45,413 8,000 6,000 (2,000) Travel/Conference 4,500 5,000 5,000 - Supplies, Licensing, Internet Access 32,300 121,303 146,507 25,204 Equipment 160,980 144,490 145,075 585 TOTAL 2225 FUNCTION 716,383 777,040 800,953 23,913 13 2020 Annual Report | Merrimack Valley School District MERRIMACK VALLEY SCHOOL BOARD PROPOSED BUDGET 2020-2021 2018-2019 2019-2020 2020-2021 Approved Adjusted Proposed Difference 2310 SCHOOL BOARD SERVICES Salaries 13,400 13,400 13,400 - Benefits 130 130 130 - Travel/Conferences 1,000 1,000 1,000 - Supplies, Printed Media 5,000 5,000 5,000 - NHSBA Dues 6,552 6,552 6,552 - TOTAL 2310 FUNCTION 26,082 26,082 26,082 - 2311 SUPPORT OF SCHOOL BOARD SERVICES Liab. Insurance and Annual Reports 17,940 17,940 17,916 (24) TOTAL 2311 FUNCTION 17,940 17,940 17,916 (24) 2312 DISTRICT MODERATOR/CLERK SERVICES Salaries 4,406 4,406 4,406 - Benefits 338 338 338 - TOTAL 2312 FUNCTION 4,744 4,744 4,744 - 2313 DISTRICT TREASURER SERVICES Salaries 2,300 2,300 2,300 - Benefits 135 135 135 - Postage 1,500 1,500 1,500 - TOTAL 2313 FUNCTION 3,935 3,935 3,935 - 2317 AUDIT SERVICES Audit Services 36,000 37,876 43,000 5,124 TOTAL 2317 FUNCTION 36,000 37,876 43,000 5,124 2318 LEGAL SERVICES Legal Services 64,000 64,000 64,000 - TOTAL 2318 FUNCTION 64,000 64,000 64,000 - 2319 SAFETY/TRUANT OFFICER (OTHER SCHOOL BOARD SERVICES) Salaries 35,529 36,599 36,599 - Benefits 36,675 28,207 29,285 1,078 Purchased Prof. Services (Fingerprinting) 5,500 5,500 5,500 - Advertising 36,072 40,000 40,000 - Travel 400 400 400 - TOTAL 2319 FUNCTION 114,176 110,706 111,784 1,078 2321 OFFICE OF THE SUPERINTENDENT Office of the Superintendent 776,646 780,358 804,437 24,079 TOTAL 2321 FUNCTION 776,646 780,358 804,437 24,079 2410 OFFICE OF THE PRINCIPAL Salaries 1,342,530 1,401,860 1,401,860 - Benefits 625,217 664,268 680,372 16,104 Conference & Travel 4,750 4,500 4,500 - Repair & Maintenance 41,600 41,600 43,400 1,800 Postage & Printing 23,142 21,682 19,748 (1,934) Supplies, Printed Media 13,521 13,471 13,096 (375) Furniture & Equipment 63,000 75,000 75,000 - Dues/NEASC Recert. 13,215 13,365 14,600 1,235 TOTAL 2410 FUNCTION 2,126,975 2,235,746 2,252,576 16,830 2490 GRADUATION EXPENSE Graduation Expense 10,250 16,120 16,120 - TOTAL 2490 FUNCTION 10,250 16,120 16,120 - 2620 OPERATING BUILDINGS SERVICES Salaries 1,317,689 1,342,392 1,367,392 25,000 Benefits 660,076 661,331 637,237 (24,094) Workshops 1,000 500 (500) Purch. Prof. Serv. (Water, Sewer, Trash) 120,860 128,760 123,510 (5,250) Repair & Maintenance 209,900 201,000 201,000 - 14 2020 Annual Report | Merrimack Valley School District MERRIMACK VALLEY SCHOOL BOARD PROPOSED BUDGET 2020-2021 2018-2019 2019-2020 2020-2021 Approved Adjusted Proposed Difference Insurance & Telephone 219,781 219,781 219,781 - Supplies 192,368 192,368 169,700 (22,668) Elec, Oil, Natural Gas, Wood Chips 652,616 652,612 660,612 8,000 Furniture & Equipment 50,000 50,000 57,000 7,000 TOTAL 2620 FUNCTION 3,423,286 3,449,244 3,436,732 (12,512) 2630 CARE & UPKEEP OF GROUNDS Snow Plowing/Sanding 93,000 93,000 93,000 - Fields/Lawn Care 55,000 55,000 55,000 - Repair & Maintenance 18,000 18,000 25,500 7,500 Supplies/Gas 52,949 67,949 62,949 (5,000) Field Improvements 2,000 2,000 2,000 - Equipment 32,500 32,500 47,500 15,000 TOTAL 2630 FUNCTION 253,449 268,449 285,949 17,500 2660 SECURITY 45,000 45,000 50,000 5,000 2700 TRANSPORTATION SERVICES Salaries 1,076,926 1,075,795 1,070,795 (5,000) Benefits 474,502 431,774 432,443 669 Repair & Maintenance 115,291 128,753 145,000 16,247 Contract Transportation (Special Education) 124,025 126,095 126,095 - Transient Transportation 39,360 61,660 92,000 30,340 Insurance 51,995 51,995 55,635 3,640 Supplies/Tools 5,000 5,000 5,000 - Fuel 187,000 187,000 170,000 (17,000) Vehicle Replacement 150,000 204,000 204,000 - Dues 615 615 700 85 TOTAL 2700 FUNCTION 2,224,714 2,272,687 2,301,668 28,981 2900 SUPPORT SERVICES Neg. Agreement - MVEA 262,186 - - Neg. Agreement - MVSSA 152,027 - 175,045 175,045 Neg. Agreement - MVAA 24,982 - 19,447 19,447 Salary Pool - Non BU 14,519 - - - TOTAL 2900 FUNCTION 453,714 - 194,492 194,492 4200 SITE IMPROVEMENT Site Improvement 436,345 131,345 131,345 - TOTAL 4200 FUNCTION 436,345 131,345 131,345 - 4600 BUILDING IMPROVEMENT Building Improvement 225,000 155,000 225,000 70,000 TOTAL 4600 FUNCTION 225,000 155,000 225,000 70,000 5222 MAINTENANCE EXP. TRUST FUND - - - - SUBTOTAL GENERAL FUND 38,874,813 39,993,801 40,399,140 405,340 5220 TRANSFER TO FEDERAL 710,000 710,000 710,000 - 5221 TRANSFER TO FOOD SERVICE 750,000 750,000 750,000 - GRAND TOTAL OPERATING BUDGET 40,788,582 41,453,799 41,859,140 405,340 0.98% WARRANT ARTICLES ARTICLE IV MVEA Proposal (3 year agreement) 833,843 ARTICLE VI PROPOSED BUDGET 41,859,140 ARTICLE VII MET FUND 300,000 TOTAL BUDGET W/ ALL ARTICLES 42,992,983 15 2020 Annual Report | Merrimack Valley School District MERRIMACK VALLEY SCHOOL DISTRICT REVENUE PROJECTIONS FOR 2020-21 Revenues Dept. of Revenue Estimated Received Admin. Revenue 2018-2019 2019-2020 2020-2021 +/- Diff. Unreserved Fund Balance$ 55,935.00 $ (495,856.00) $ 200,000.00 $ 695,856.00 Reserve for Repair & Maint. Exp. Trust$ - $ - $ - $ - Transfer from SpEd Trust Fund $ - $ - $ - $ - Total Fund Balance $ 55,935.00 $ (495,856.00) $ 200,000.00 $ 695,856.00 STATE SOURCES Adequate Ed. Grant$ 9,850,271.00 $ 10,367,034.00 $ 11,954,055.00 $ 1,587,021.00 Equalized Property Tax$ 3,191,253.00 $ 3,218,583.00 $ 3,186,712.00 $ (31,871.00) Kindergarten Aid$ - $ - $ - $ - Area Voc Transportation$ 23,871.00 $ 24,000.00 $ 24,000.00 $ - Special Education Aid $ 154,461.78 $ 252,763.00 $ 252,763.00 $ - Child Nutrition$ 15,450.12 $ 13,000.00 $ 13,000.00 $ - Total State Sources $ 13,235,306.90 $ 13,875,380.00 $ 15,430,530.00 $ 1,555,150.00 FEDERAL SOURCES Title I & II$ 1,255,928.00 $ 710,000.00 $ 710,000.00 $ - Child Nutrition$ 394,541.19 $ 350,000.00 $ 350,000.00 $ - Medicaid Distributions$ 391,815.01 $ 200,000.00 $ 200,000.00 $ - Other Federal$ - $ - $ - $ - Total Federal $ 2,042,284.20 $ 1,260,000.00 $ 1,260,000.00 $ - LOCAL SOURCES OTHER THAN TAXES Tuition$ 1,019,131.38 $ 990,000.00 $ 1,050,000.00 $ 60,000.00 Investment Income$ 728.64 $ 700.00 $ 700.00 $ - Other Income (Rent, etc.)$ 276,465.00 $ 40,532.00 $ 40,532.00 $ - Sale of Food$ 689,609.64 $ 650,000.00 $ 650,000.00 $ - Total Local Sources $ 1,985,934.66 $ 1,681,232.00 $ 1,741,232.00 $ 60,000.00 GRAND TOTAL $ 17,319,460.76 $ 16,320,756.00 $ 18,631,762.00 $ 2,311,006.00 TOTAL BUDGET $ 40,788,527.00 $ 41,453,799.00 $ 41,859,140.00 $ 405,341.00 0.98% DISTRICT ASSESSMENT $ 23,104,312.00 $ 24,637,187.00 $ 23,227,378.00 $ (1,409,809.00) -5.72% 2017-2018 2018-2019 Special Education Expenditures 10,866,205 11,665,365 Special Education Revenues 940,566 971,884 Net Special Education Costs 9,925,639 10,693,481 The special education revenues include adequacy allocation for special education students. 16 2020 Annual Report | Merrimack Valley School District MVSD – Projected/Estimated Tax Rates ȋ Ȍ ------ Scenario 1 – Proposed Operating Budget without Warrant Articles – (Total Budget = $41,859,140) Estimated $ 2016 – 2017 – 2018 – 2019 – 2020 – Change Actual Tax Rate Actual Tax Rate Actual Tax Rate Actual Tax Rate Tax Estimate ȋ Town ȋ ȋ ȋ ȋ ȋ Ȍ Ȍ Ȍ Ȍ Ȍ Boscawen $16.96 $18.71 $15.84 $17.44 $15.77 ($1.67) Loudon $15.04 $15.31 $14.57 $15.47 $14.74 ($0.73) Penacook $20.76 $21.22 $20.95 $21.63 $19.07 ($2.56) Salisbury $17.26 $16.88 $16.68 $15.54 $16.15 $0.61 Webster $14.41 $13.80 $13.03 $13.59 $13.02 ($0.57) Scenario 2 – Proposed Operating Budget including Warrant Articles (CBA & MET) – (Total Budget = $42,575,602) Estimated $ 2016 – 2017 – 2018 – 2019 – 2020 – Change Actual Tax Rate Actual Tax Rate Actual Tax Rate Actual Tax Rate Tax Estimate ȋ Town ȋ ȋ ȋ ȋ ȋ Ȍ Ȍ Ȍ Ȍ Ȍ Boscawen $16.96 $18.71 $15.84 $17.44 $16.29 ($1.15) Loudon $15.04 $15.31 $14.57 $15.47 $15.10 ($0.37) Penacook $20.76 $21.22 $20.95 $21.63 $19.66 ($1.97) Salisbury $17.26 $16.88 $16.68 $15.54 $16.54 $1.00 Webster $14.41 $13.80 $13.03 $13.59 $13.32 ($0.27) Scenario 3 – Proposed Operating Budget CBA (no MET) – (Total Budget = $42,275,602) Estimated $ 2016 – 2017 – 2018 – 2019 – 2020 – Change Actual Tax Rate Actual Tax Rate Actual Tax Rate Actual Tax Rate Tax Estimate ȋ Town ȋ ȋ ȋ ȋ ȋ Ȍ Ȍ Ȍ Ȍ Ȍ Boscawen $16.96 $18.71 $15.84 $17.44 $16.07 ($1.37) Loudon $15.04 $15.31 $14.57 $15.47 $14.95 ($0.52) Penacook $20.76 $21.22 $20.95 $21.63 $19.42 ($2.21) Salisbury $17.26 $16.88 $16.68 $15.54 $16.38 $0.84 Webster $14.41 $13.80 $13.03 $13.59 $13.19 ($0.40) Scenario 4 – Proposed Operating Budget MET (no CBA) – (Total Budget = $42,159,140) Estimated $ 2016 – 2017 – 2018 – 2019 – 2020 – Change Actual Tax Rate Actual Tax Rate Actual Tax Rate Actual Tax Rate Tax Estimate ȋ Town ȋ ȋ ȋ ȋ ȋ Ȍ Ȍ Ȍ Ȍ Ȍ Boscawen $16.96 $18.71 $15.84 $17.44 $15.86 ($1.46) Loudon $15.04 $15.31 $14.57 $15.47 $14.80 ($0.58) Penacook $20.76 $21.22 $20.95 $21.63 $19.17 ($2.31) Salisbury $17.26 $16.88 $16.68 $15.54 $16.21 $0.77 Webster $14.41 $13.80 $13.03 $13.59 $13.07 ($0.44) Please note: These scenarios DO NOT include Article VII mvsdpride.org 17 2020 Annual Report | Merrimack Valley School District School Board Chairperson ,WFDQEHRYHUZKHOPLQJWRWKLQNDERXWWKHSUREOHPVZHIDFHDVDFRXQWU\DQGKRZOLWWOHLPSDFWZHDVLQGLYLGXDO FLWL]HQVFDQKDYHRQVROYLQJWKHP7KHDSSDUHQWXQZLOOLQJQHVVRISHRSOHWROLVWHQWRHDFKRWKHUORRNIRU FRPPRQJURXQGDQGFHOHEUDWHRXUDFFRPSOLVKPHQWVLVGLVFRXUDJLQJ)RUWXQDWHO\WKDWLVQRWWKHZD\ZHGR EXVLQHVVLQWKH0HUULPDFN9DOOH\6FKRRO'LVWULFW 2XU$QQXDO0HHWLQJSURYLGHVDQRSSRUWXQLW\IRUDOORIXVDVLQGLYLGXDOFLWL]HQVWRYRLFHRXURSLQLRQV(YHQ ZKHQWKHUHLVVLJQLILFDQWGLVDJUHHPHQWDVWKHUHZDVUHJDUGLQJODVW\HDU¶VTXHVWLRQDERXWD6FKRRO5HVRXUFH 2IILFHUIRUWKH0LGGOH6FKRROSHRSOHOLVWHQHGWRHDFKRWKHUUHVSHFWIXOO\DQGHYHU\RQH¶VYRWHFRXQWHGLQWKH GHFLVLRQ7KLVLVGHPRFUDF\LQDFWLRQ(YHU\RQHZKRZDQWVWRFDQKDYHDQLPSDFWRQGHFLVLRQVDERXWRXU VFKRROV 'XULQJWKHUHFHQWGLVFXVVLRQDERXW0HUULPDFN9DOOH\¶VPDVFRWLQVSLWHRIYHU\VWURQJIHHOLQJVRQERWKVLGHV ZHVKRZHGWKDWZHFDQOLVWHQUHVSHFWIXOO\WRHDFKRWKHUDQGILQGDJUHHDEOHFRPSURPLVHV$OWKRXJKZHFDQQRW UHZULWHKLVWRU\ZHFDQUHH[DPLQHRXUXQGHUVWDQGLQJRIKRZLWDIIHFWVDOORIXV:HFDQKRQRUWKHLGHQWLWLHV DQGVDFULILFHVRIWKRVHZKRFDPHEHIRUHXVE\LQFOXGLQJDFFXUDWH1DWLYH$PHULFDQKLVWRU\LQRXUFXUULFXOXP DQGE\FUHDWLQJ/DQG$FNQRZOHGJHPHQWSODTXHVIRURXUEXLOGLQJV)XUWKHUPRUHZHSODQWRFUHDWHD³+LVWRU\ 5RRP´ZKHUHUHWLUHG0HUULPDFN9DOOH\,QGLDQDUWLIDFWVFDQEHDSSUHFLDWHGE\WKRVHDOXPQLZKRFKHULVKWKHLU PHPRU\:HORRNIRUZDUGWRFRQWLQXHGFROODERUDWLRQZLWKWKH1+&RPPLVVLRQRQ1DWLYH$PHULFDQ$IIDLUV0W .HDUVDUJH,QGLDQ0XVHXPDQG,QGLJHQRXV1+DOORIZKRPKDYHEHHQPRVWKHOSIXOLQLGHQWLI\LQJFRPPRQ JURXQG (YHQDVZHZUHVWOHZLWKVXFKHPRWLRQDOO\FKDUJHGLVVXHVRXUSULPDU\SXUSRVHLVWRSURYLGHWKHEHVWSRVVLEOH HGXFDWLRQIRUDOORIRXUFKLOGUHQZLWKLQWKHFRQILQHVRI1HZ+DPSVKLUH¶VFKDOOHQJLQJVFKRROIXQGLQJV\VWHP 7KDQNVWRWKHGHGLFDWLRQRIRXUUHPDUNDEOHWHDFKHUVVXSSRUWVWDIIDQGDGPLQLVWUDWRUVDVZHOODVWKHRQJRLQJ VXSSRUWRIRXUFRPPXQLWLHVZHFRQWLQXHWRVXFFHHGLQWKDWHQGHDYRU6WXGHQWVDWDOOOHYHOVDUHOHDUQLQJWR FRPPXQLFDWHFROODERUDWHDQGSUREOHPVROYHDWWKHVDPHWLPHWKH\JDLQFRPSHWHQFHLQWUDGLWLRQDOVFKRRO VXEMHFWV2XUJUDGXDWHVQHHGWREHSUHSDUHGERWKDFDGHPLFDOO\DQGVRFLDOO\LQRUGHUWRILQGWKHLUSHUVRQDO SDWKZD\VWRVXFFHVVLQDUDSLGO\FKDQJLQJZRUOG:KLOHZHZLOODOZD\VVWULYHWRJHWEHWWHUDWKHOSLQJWKHPWRGR WKDWZHKDYHDORWWRFHOHEUDWHULJKWQRZ5HFRUGQXPEHUVRIRXUKLJKVFKRROVWXGHQWVDUHWDNLQJDGYDQWDJHRI (DUO\&ROOHJHRSSRUWXQLWLHVDQGJUDGXDWLQJZLWKFROOHJHFUHGLWV2XU&57&JUDGXDWHVDUHFHUWLILHGDQGZRUN IRUFHUHDG\:HDUHDFWLYHO\ZRUNLQJWRLQFUHDVHDQGLPSURYHRXUFRQQHFWLRQVZLWKORFDOEXVLQHVVHVVRWKDW VWXGHQWVZKRFKRRVHDGLIIHUHQWSDWKPD\DOVRKDYHRSSRUWXQLWLHV 1RVXPPDU\RIWKLVSDVW\HDULQWKH0HUULPDFN9DOOH\6FKRRO'LVWULFWZRXOGEHFRPSOHWHZLWKRXWPHQWLRQLQJ WZRRIRXURXWVWDQGLQJ6$8DGPLQLVWUDWRUV%XVLQHVV$GPLQLVWUDWRU5RELQ+HLQVZLOOUHWLUHLQ-XQHDIWHU \HDUVLQWKH'LVWULFW+HU\HDUVRIGHGLFDWLRQH[SHULHQFHLQVWLWXWLRQDONQRZOHGJHXQIDLOLQJZRUNHWKLFDQG NLQGQHVVZLOOOHDYHGLIILFXOWVKRHVWRILOO$QG0DUN0DF/HDQKDVEHHQQDPHG1HZ+DPSVKLUH6XSHULQWHQGHQW RIWKH 6HHO\H/RQJQHFNHU 18 2020 Annual Report | Merrimack Valley School District Superintendent’s Annual Report ,QWKHHDUO\PLG ¶VLQWHUHVWUDWHVKLW/LYH$LGFRQFHUWVUDLVHGPLOOLRQGROODUVIRU IDPLQHUHOLHILQ$IULFDQHZ&RNHPDGHLWVGHEXW1LQWHQGRZDVUHOHDVHGVRPHSHRSOH ³WLJKWUROOHG´WKHLUSDQWVDQG0V5RELQ5HDJDQ QRZ0UV5RELQ+HLQV VXEPLWWHGKHU DSSOLFDWLRQWR³6XSHUYLVRU\8QLRQ1R´$IWHU\HDUVRIVHOIOHVVO\VHUYLQJWKHOHDUQLQJ FRPPXQLWLHVRI0HUULPDFN9DOOH\DQG$QGRYHU5RELQLVUHWLULQJ5RELQLVPRUHWKDQWKH %XVLQHVV$GPLQLVWUDWRURI6$8 $QGRYHUDQG0HUULPDFN9DOOH\ 6KHNQRZVDQGWUXO\FDUHV IRUHYHU\RQH5RELQOLNHO\NQRZV\RXDVZHOODV\RXUIULHQGVDQGUHODWLYHV2YHUWKHSDVWWKUHH DQGDKDOIGHFDGHVPDQ\RIRXUHPSOR\HHVKDYHUHOLHGXSRQKHUHPSDWK\DQGFDULQJQDWXUH $OZD\VSXWWLQJRWKHUVILUVW5RELQOHDYHVDQLQGHOLEOHPDUNDQLPSHFFDEOHFRPPDQGRIWKH QXPEHUVDVWDQGDUGIRUKDUGZRUNWRRPXFKLQVWLWXWLRQDONQRZOHGJHWRDUWLFXODWHDQGELJVKRHV WRILOO6KHZLOOEHPLVVHGWKDQN\RX5RELQ 5HWLUHPHQWQHZVDQGKHDUWIHOWJUDWLWXGHVDVLGHWKH096'KLJKOLJKWHGFRPPXQLFDWLRQVVDIHW\ VHFXULW\DQGFXUULFXOXPDVIRFDOSRLQWVIRUWKH VFKRRO\HDU,QWKHUHDOPRI FRPPXQLFDWLRQVWKH³096'6SRWOLJKW´KDVHPHUJHG3OHDVHYLVLWWKH³6SRWOLJKW´WRYLHZWKH FXUUHQWLVVXHDQGDUFKLYDOVXEPLVVLRQV KWWSV ZZZPYVGSULGHRUJPYVGVSRWOLJKW 0DQ\ WKDQNVWR0U3DXO%DUQZHOODQGWKHVWXGHQWVDW09+6IRUVHHLQJWKLVSURMHFWWKURXJK7KH VDIHW\DQGVHFXULW\RIDOORIRXUVWXGHQWVDQGVWDIIDUHDOZD\VSULRULWLHV:LWKWKLVLQPLQGZRUN KDVEHHQFRPSOHWHGDQGSODQQHGUHJDUGLQJDFFHVVFRQWUROLQPDQ\RIRXUEXLOGLQJV $GGLWLRQDOO\ZLWKRYHUZKHOPLQJVXSSRUWIURPWKH096'FRPPXQLW\ZHDUHPRYLQJIRUZDUGZLWK RXUSODQVWRKROGDIXOOVFDOH09+6FDPSXVVHFXULW\H[HUFLVHWKLVVSULQJ)XUWKHUGHWDLOVDUH IRUWKFRPLQJ2XUFXUULFXOXPHPSKDVLVWKLV\HDULQFOXGHVEULQJLQJIRUZDUGILQDQFLDOOLWHUDF\DVD JUDGXDWLRQUHTXLUHPHQWDQGVWUHQJWKHQLQJDQGIRUPDOL]LQJRXUEXVLQHVVFRQQHFWLRQVDQG SDUWQHUVKLSV7KH096'&XUULFXOXP&RPPLWWHHDORQJZLWK'LVWULFWDQGEXLOGLQJOHYHOFXUULFXOXP JURXSVKDYHDOVRPDGHJUHDWSURJUHVVLQRXUQHZFXUULFXOXPIUDPHZRUNWKURXJKRXUDIILOLDWLRQ ZLWK1($6&DQG³SRUWUDLWRIDJUDGXDWH´LQLWLDWLYH (DFK\HDUWKH6FKRRO%RDUGDQGDGPLQLVWUDWLRQFROODERUDWHWRFUDIWDEXGJHWWKDWHIIHFWLYHO\DQG LQQRYDWLYHO\PHHWVWKHQHHGVRIRXUGLYHUVHOHDUQHUV:LWKDNHHQXQGHUVWDQGLQJDQG DSSUHFLDWLRQRIWKHILQDQFLDOVXSSRUWRXUFRPPXQLWLHVSURYLGHZHVWULYHWREULQJD FRVWFRQVFLRXVSURSRVDOWKDWLVVHQVLWLYHWRWD[SD\LQJSURSHUW\RZQHUV LW¶VDGHOLFDWH DQG VRPHWLPHVGLIILFXOW EDODQFHWRVWULNH$PRQJRXUILGXFLDU\PDQWUDVDUHWKHWHUPV³UHSXUSRVH´ ³UHDOORFDWH´DQG³WKLQNGLIIHUHQWO\´:HFKDOOHQJHRXUVHOYHVWRWKLQNFULWLFDOO\DERXWQHHGV SULRULWLHVDQGVSHQGLQJ:LWKWKDWVWDWHGWKHSURSRVHGRSHUDWLQJEXGJHWIRU UHSUHVHQWVD LQFUHDVHRYHUWKHWRWDODSSURYHG DSSURSULDWLRQ'LVFUHWHEXGJHW GHWDLOVDUHLQWKLVSDFNHWDQGDUHUHDGLO\DFFHVVLEOHRQWKH096'ZHEVLWH KWWSV ZZZPYVGSULGHRUJ 7KLV\HDU¶VZDUUDQWLQFOXGHVDQHZDJUHHPHQWZLWKWKH09(GXFDWRUV¶$VVRFLDWLRQ 09($ 7KLV DUWLFOHZLOOEHEURXJKWWRWKHOHJLVODWLYHERG\ WKHYRWHUV SULRUWRWKHRSHUDWLQJEXGJHWDV DSSURYDOSURYLGHVWKH'LVWULFWZLWKDQRSSRUWXQLW\WRDGMXVWWKHSURSRVHGEXGJHW7KLVURXQGRI QHJRWLDWLRQVLQFOXGHGVRPHFUHDWLYHFRQYHUVDWLRQVWRVWUHQJWKHQWKH'LVWULFW¶VDELOLW\WRDWWUDFW DQGUHWDLQWDOHQWHGHGXFDWRUVZKLOHDOVREHLQJPLQGIXORIIXWXUHLPSDFWVDQGH[SHQVHV2WKHU 19 2020 Annual Report | Merrimack Valley School District PRQHWDU\DUWLFOHVRQWKHZDUUDQWLQFOXGHDQDSSURSULDWLRQWRVXSSRUWWKH'LVWULFW¶V&DSLWDO ,PSURYHPHQW3ODQ &,3 DVZHOODVDVPDOODSSURSULDWLRQIRUDYHU\ODUJHTXHVWLRQ:HORRN IRUZDUGWRDSRVLWLYHDQGUHVSHFWIXOGLVFRXUVH 7KHUHLVJRRGQHZVWRUHSRUWLQWHUPVRIUHYHQXHV$VD'LVWULFWZHDQWLFLSDWHUHFHLYLQJ DSSUR[LPDWHO\PLOOLRQGROODUVPRUHLQDGHTXDF\IURPWKHVWDWH LQWKHILQDO\HDURIWKH ELHQQLXPEXGJHW &RPELQHGZLWKWKHFRQVHUYDWLYH SURSRVHGLQFUHDVHLQRSHUDWLQJ H[SHQVHVZHDUHKRSHIXOWKDWWKLVLQFUHDVHLQUHYHQXHPD\UHVXOWLQDGHFUHDVHWRWKH 'LVWULFW$VVHVVPHQWWKXVSRWHQWLDOO\OHVVHQLQJWKHVFKRRO¶VSRUWLRQRIORFDOSURSHUW\ WD[HV7KHUHDUHPDQ\FDYHDWVLQWKHSUHYLRXVVWDWHPHQWWKHELJJHVWLVWKDWWKHUHDUHQR JXDUDQWHHVWKDWWKLVLQFUHDVHLQDGHTXDF\UHYHQXHZLOOH[LVWLQWRWKHIXWXUH7KHVWDWHLV FRQYHQLQJDFRPPLWWHHWRLQYHVWLJDWHSXEOLFVFKRROIXQGLQJDQGWKHDGHTXDF\IRUPXOD KRZHYHU WKHVWDWH¶VORQJKLVWRU\RIJUDSSOLQJZLWKWKLVFRQFHSWGRHVQRWSRUWHQGDQH[SHGLHQWVROXWLRQ :HDUHRSWLPLVWLFWKRXJKDQGZLOOHQVXUHWKDWRXUYRLFHVDUHKHDUG:HHQFRXUDJH\RXWRVKDUH \RXUVHQWLPHQWVZLWK\RXUUHSUHVHQWDWLYHVLQ&RQFRUGDVZHOO 6$8RSHUDWLRQVLQFOXGHOHDGLQJDQGFROODERUDWLQJZLWKPDQ\GLIIHUHQWV\VWHPV7KHVH HQFRPSDVVVWXGHQWVSDUHQWVHOHFWHGRIILFLDOVVWDWHDQGQDWLRQDORUJDQL]DWLRQVFXUULFXOXP ILQDQFHSHUVRQQHOWUDQVSRUWDWLRQIDFLOLWLHVVSHFLDOHGXFDWLRQFRPPXQLFDWLRQVDVZHOODVDOO RIWKHXQGHUO\LQJSURFHVVHVDQGDSSOLFDWLRQVDVVRFLDWHGZLWKHDFKDUHD(VWDEOLVKLQJHIIHFWLYH UHODWLRQVKLSVUHWDLQLQJDWDOHQWHGWHDPDQGVXSSRUWLQJRQJRLQJSURIHVVLRQDOJURZWKDUH SDUDPRXQWWRVXFFHVVZKHQZRUNLQJZLWKWKLVPDQ\FRQVWLWXHQWVDQGJURXSV:HDUHJUDWHIXOIRU WKHVXSSRUWLYHUHODWLRQVKLSVZHKDYHZLWKRXUFRPPXQLWLHV:HZLOOFRQWLQXHWRVWULYHWR VWUHQJWKHQWKHVHERQGVDQGIRUWLI\\RXUWUXVW$VDOZD\VVHUYLQJDV\RXUVXSHULQWHQGHQWRI VFKRROVLVDFKDOOHQJLQJKXPEOLQJDQGUHZDUGLQJH[SHULHQFH 5HVSHFWIXOO\VXEPLWWHG 0DUN0DF/HDQ 20 21 22 23 24 25 26 Merrimack Valley High School – “It’s a Matter of Pride!” MISSION The Merrimack Valley High School community is dedicated to the pursuit of an education that will prepare all of its members for their future. To achieve 21st century learning experiences, the school and its members will...Pursue high academic standards through challenging and diverse learning opportunities; Respect self and others; Instill interpersonal skills useful in both local and global communities; Develop a plan for personal success; and Engage in behaviors that promote wellness and a safe, healthy environment. SSCCHHOOOOLLP ROFILE THE SCHOOL AND COMMUNITY Merrimack Valley High School is a public comprehensive high school, grades 9-12, with a current enrollment of approximately 850 students. Accredited by the New England Association of Schools and Colleges (NEASC) and the State of New Hampshire, the school serves the com- munities of Penacook, Boscawen, 106 Village Street Loudon, Salisbury, Webster, and Andover, New Hampshire. Merrimack Valley High School is also a 2004 Penacook, NH 03303 International Center for Leadership in Education Model School and in 2010 the Athletic Director, Principal, mvhs.mvsdpride.org and Superintendent were recognized for excellence in education. Merrimack Valley High School is in a suburban community located north of Concord, New Hampshire in Merrimack County. The towns in the p – 603.753.4311 District are less than an hour from Boston, the Lakes Region, the White Mountains and the ocean. All of the f – 603.753.1400 com- munities are close to the State Capital of Concord. This proximity allows us to access many cultural activities, institutions of higher learning, and other valuable enrichment opportunities. Mr. David Miller David Miller Principal For more information, visit: http://mvhs.mvsdpride.org/about-us/mvhs-profile Principal [email protected]@mvsdpride.org MVHS – FACTS AND FIGURES Mr.Shaun Shaun St. St. Onge Onge …MVHS courses that offer students the opportunity for college credit. These exciting Assistant Principal options are found in our AP programming; through our Project Lead The Way (PLTW) [email protected] program; via dual enrollment options; in select Project Running Start courses and Early 48 College courses, and through our affiliation with the Concord Regional Technical Center Mr.Andrew Andrew Brauch Brauch (CRTC). Assistant Principal Recent College [email protected] & University Mr.Kevin Kevin O’Brien O’Brien Administrator for Athletics & Acceptances Administrator for Athletics & MVHS Class of School Counseling School Counseling [email protected] 2019 – Post- • Yale [email protected] • Clemson Secondary Plans Jamie Vose • Rutgers AdministratorMs. Jamie for Vose Special 65% - Colleges & Universities • UConn AdministratorEducation for Special • St. Anselm [email protected] 27% - Professional [email protected] • Babson Employment /Career • Villanova • Auburn 5% - Military Services • University of NH Merrimack Valley High School uses a competency- ACADEMICS @ MVHS based grading and reporting Merrimack Valley High School students are engaged in a rigorous and diverse curriculum that emphasizes system for all of its courses. the use of formative measures along with inquiry-based and authentic summative assessments. It should be noted that final grades are not determined Specific Highlights: by the averaging of quarter • Technology and Devices - a robust infrastructure and a wealth of devices support and augment grades. We focus on a effective learning and teaching “Body of Evidence” in each • Project Pride - to further engage students in their unique passions and learning styles, all MVHS competency that provides Seniors must successfully complete and present a Senior Project students with multiple and • Project-based learning is embedded throughout the curriculum varied learning experiences • Students must document and complete required community service before graduating and chances to • Online and extended learning opportunities are an integral part of the MVHS experience demonstrate their skills and knowledge. ATHLETICS AND CO-CURRICULARS Merrimack Valley offers a diverse range of athletic and co-curricular options for students: Athletics: Football | Field Hockey | Soccer | Cross Country | Golf | Basketball | Indoor Track | Spirit | Softball | Baseball | Outdoor Track and Field | Lacrosse | Co-curriculars: Color Guard | Destination Imagination | Drama | Key Club | Math Team | National Art Honor Society | National Honor Society | Political Action | Ski & Snowboard | Best Buddies | Student Council | Future Business Leaders of America | Marching Band 27 2020 Annual Report | Merrimack Valley School District MISSION Extended Learning Opportunities Students may choose to independently design an Extended Learning Opportunity for course credit. Extended Learning Opportunities require administrative approval and may include college courses, internships, virtual courses, and other off-campus opportunities. Honors Option Students in English 9, English 10, and World History may opt to take an Honors option. To meet this SSAT MMeeaann S core requirement, students agree to complete a more rigorous and challenging curriculum with- in their classes, Score which requires additional reading and writing assignments above and beyond what is required of other Critical Reading and students in the class. Early College CWritingritical Eligible students at MVHS may enroll in courses at New Hampshire Technical Institute. NHTI has Read504ing and established an Early College Program that specifically allows eligible MVHS students to enroll in NHTI Writ ing credit-bearing courses on the NHTI campus at a discounted tuition. The students would earn both high Mathematics school and college credit for these courses. 504 NH Scholars 493 New Hampshire Scholars is a community-based program that encourages students to take a more rigorous cor Mathematics course of study in high school. The program encourages students to select a curriculum that will adequately prepare them for the challenges they will face in postsecondary pursuits. As of 2014-2015, MVHS is a member of the NH Scholars Program. 28% of the Class of 2019 were recognized as NH Scholars. Merrimack Valley High School does not rank COLLEGE COURSES OFFERED FOR CREDIT students. Latin honors are Advanced Placement Courses (AP) used to recognize and distinguish high academic The Advanced Placement (AP) Program is a cooperative educational endeavor between secondary schools performance. and colleges and universities. It exposes high school students to college-level material and gives them the opportunity to show that they have mastered it by taking an AP exam. Summa Cum Laude Advanced Placement courses offered at Merrimack Valley High School: with highest honors AP English Literature | AP Studio Art – 2-D Design | AP English Language | AP US History | AP Calculus | 4.0 or higher AP Psychology | AP Physics | AP Computer Science Principles Magna Cum Laude Project Lead the Way (PLTW) with great honors 3.75 or higher Project Lead The Way is a challenging and rigorous pre-engineering program comprised of six courses: Introduction to Engineering and Design (IED), Principles of Engineering (POE), Digital Electronics (DE), Cum Laude Computer Integrated Manufacturing (CIM), Bio-Technical Engineering, and the capstone course, Engineering with honors Design and Development (EDD) in which an independent engineering project is required. This program 3.5 or higher emphasizes the use of math and science to solve engineering problems, computer simulations, teamwork, creativity, and mastery of technology. It prepares students to pursue engineering majors in college and offers college credit at the New Hampshire Technical Institute through the Project Running Start Program. Project Running Start (PRS) Project Running Start is a higher education initiative for high school students to enroll in college courses offered by the New Hampshire Technical Institute. Grading Scale We offer the following courses: Level Rubric Letter/ Number Sports Management | Accounting | Advanced Biology | Marketing | TAC Math 4.33 A+ Concord Regional Technical Center (CRTC) 98-100 4.00 A College Level Vocational/Technical education programs are designed to give students training in a selected 93-97 vocation that will give them the skills to transition into a 2-year or 4-year post-secondary program. Some 3.67 A- students may apply the skills they learn immediately in the job market. Students are invited to apply to the Distinguished Distinguished 90-92 Concord Regional Technology Center in their sophomore year following a guided tour and orientation 3.33 B+ program offered to all students. A committee will review student applications. Most students enroll for both 87-89 their senior and junior year. Some courses have the option for college credit through the New Hampshire 3.00 B 83-86 Technical Institute. All CRTC programs run for the entire school year for 2 credits and most students take the program for two years. Proficient Proficient 2.67 B- 80-82 2.33 C+ 77-79 MVHS SCHOOL COUNSELING STAFF 2.00 C The mission of MVHS Counseling Program is to enable all students, regardless of individual differences, to 73-76 Basic acquire the educational, occupational, and social skills necessary to function in a changing society with 1.67 C- lifelong success. Contact Us - [email protected] - example - [email protected]. 70-72 Not FC 0-69 Mark Ciarametaro (A-F) | Rebecca Kennedy (G-M) | Wendy Reardon (N-Z) | Emily Rider (College and Yet Career) | Amber Violette (MLADC) | Barbara Crouse (SAP) | Jeff Richard (L&A, Special Education) 28 29 2020 Annual Report | Merrimack Valley School District 30 2020 Annual Report | Merrimack Valley School District 0HUULPDFN9DOOH\6FKRRO%RDUG &RPPLWWHH6WUXFWXUH 0XFKRIWKHZRUNRIWKH0HUULPDFN9DOOH\6FKRRO%RDUGLVGHOHJDWHGWRDGYLVRU\VXEFRPPLWWHHVZKLFK RSHUDWHDVSROLF\UHYLHZDQGUHFRPPHQGDWLRQFRPPLWWHHV7KHFRPPLWWHHVDVVHVVWKHQHHGVRIWKHVFKRRO V\VWHPDQGPDNHUHFRPPHQGDWLRQVEDVHGXSRQWKRVHQHHGV7KH)LQDQFH&RPPLWWHHLVXOWLPDWHO\ UHVSRQVLEOHIRURYHUVHHLQJWKHEXGJHWDQGFRQVLGHULQJWKHPRQHWDU\UHFRPPHQGDWLRQVRIWKHRWKHU FRPPLWWHHV$OOILQDOGHFLVLRQVDUHPDGHE\WKH%RDUGDVDZKROHEDVHGRQWKHKDUGZRUNRIWKHYDULRXV FRPPLWWHHV0DQ\RIWKHFRPPLWWHHVEXWQRWDOOPHHWPRQWKO\7KHFRPPLWWHHVJHQHUDOO\KDYHILYHPHPEHUV RQHIURPHDFKFRPPXQLW\3OHDVHDFFHSWWKHIROORZLQJDVDEULHIUHSRUWRIHDFKFRPPLWWHH¶VPDMRUZRUNGXULQJ WKLVSDVW\HDU &RPPLWWHH5HSRUWV )LQDQFH&RPPLWWHH 7KLVFRPPLWWHHLVPDLQO\UHVSRQVLEOHIRUFROODERUDWLQJZLWK'LVWULFWDGPLQLVWUDWLRQWRGHYHORSWKHSURSRVHG EXGJHW,WVUHVSRQVLELOLWLHVH[WHQGEH\RQGWKHWUDGLWLRQDOUROHRIEXGJHWGHYHORSPHQWDVDQDGYLVRU\EXGJHW FRPPLWWHHWRWKH%RDUG7KH)LQDQFH&RPPLWWHHUHYLHZVRQJRLQJEXGJHWVDQGSURYLGHVDILQDOUHYLHZDQG UHFRPPHQGDWLRQWRWKH%RDUGRIDQ\ILQDQFLDOUHFRPPHQGDWLRQVIURPRWKHUFRPPLWWHHV,WDOVRGHDOVZLWKRWKHU ILQDQFLDOLVVXHVWKDWFRPHXSVXFKDVWKHGLVSRVLWLRQRIWKHHQGRI\HDUIXQGEDODQFHRUOXQFKSULFHV 7KH)LQDQFH&RPPLWWHHLVGLIIHUHQWIURPRWKHUFRPPLWWHHVLQWKDWHDFKRIWKHILYHPHPEHUWRZQVKDYHWREH UHSUHVHQWHGPHDQLQJWKDWWKHILYHPHPEHUVRIWKHFRPPLWWHHHDFKFRPHIURPDGLIIHUHQWWRZQ,WDOVRGLIIHUV LQWKDWLWKDVDGHILQLWHEXV\SHULRGIURPDURXQG2FWREHUWR-DQXDU\ZKHQWKHEXGJHWLVEHLQJJHQHUDWHGDQG PHHWVRQO\DVLVVXHVDULVHWKURXJKWKHUHVWRIWKH\HDU &XUULFXOXP&RPPLWWHH 7KH&XUULFXOXP&RPPLWWHHLVUHVSRQVLEOHIRUWKHFXUULFXOXPGHYHORSPHQWSURFHVVLQWKH'LVWULFWLQFOXGLQJWKH GHYHORSPHQWPRQLWRULQJDQGDVVHVVPHQWRIWKHFXUULFXOXP7KHFRPPLWWHHDOVRRYHUVHHVWKH'LVWULFW¶VVWDII GHYHORSPHQWSURJUDPPRQLWRUVHQUROOPHQWDQGFODVVVL]HVDQGPDNHVUHFRPPHQGDWLRQVIRUIDFXOW\VWDIILQJ OHYHOV .H\GLVFXVVLRQVDQGDFWLYLWLHVRIWKHSDVW\HDUKDYHLQFOXGHG Ɣ 'LVWULFWZLGHDFFUHGLWDWLRQSURFHVV Ɣ 9LVLRQRIDJUDGXDWH Ɣ %XVLQHVVSDUWQHUVKLSVDQGILQDQFLDOOLWHUDF\ Ɣ 6WXGHQWV7DNLQJ$FWLYH5ROHV 67$5 SURJUDPSRWHQWLDODW09+6 Ɣ &RPPXQLW\VXUYH\DERXWGHVLUDEOHVNLOOVDQGDWWULEXWHVRIRXUJUDGXDWHV Ɣ&35FHUWLILFDWLRQFRXUVHDYDLODEOHIRUDOOIUHVKPHQVWXGHQWV )DFLOLWLHV&RPPLWWHH 7KLVFRPPLWWHHGHDOVZLWKRYHUVLJKWRIWKHFXUUHQWEXLOGLQJVDQGJURXQGVVDIHW\DQGVHFXULW\RIRXUIDFLOLWLHV PDLQWHQDQFHSURJUDPVFXVWRGLDODQGPDLQWHQDQFHLVVXHVDQGSODQVIRUIXWXUHIDFLOLW\QHHGV 3URWHFWLQJVHFXULQJPDLQWDLQLQJDQGLPSURYLQJRXUIDFLOLWLHVDQGJURXQGVLVDQHQRUPRXVDQGLPSRUWDQW XQGHUWDNLQJ(QVXULQJRXUVWXGHQWVDQGDGXOWVDUHDIIRUGHGVDIHVHFXUHDQGHIILFLHQWOHDUQLQJHQYLURQPHQWV DUHQRQQHJRWLDEOHLWHPV096'KDVDSSUR[LPDWHO\VTXDUHIHHWRIEXLOGLQJVWRPDLQWDLQRQDGDLO\ 31 2020 Annual Report | Merrimack Valley School District EDVLV2XUIDFLOLWLHVDQGLQIUDVWUXFWXUHVPXVWDOORZIRUVWFHQWXU\SURJUDPPLQJDQGIOH[LEOHOHDUQLQJ HQYLURQPHQWV2XUEXLOGLQJVDQGJURXQGVDUHWUHPHQGRXVDVVHWVWRRXUHGXFDWLRQDOHIIRUWVDQGFRPPXQLWLHV :HWDNHWKHUHVSRQVLELOLW\RIRXUVWHZDUGVKLSDQGFDUHRIWKHVHDVVHWVYHU\VHULRXVO\ .H\SURMHFWVDQGWRSLFVRIGLVFXVVLRQWKLV\HDUKDYHLQFOXGHG Ɣ &RQWLQXHG&DSLWDO,PSURYHPHQW3ODQQLQJ Ɣ 6HFXULW\HQKDQFHPHQWV Ɣ %XLOGLQJJHQHUDWRUV /RQJ5DQJH3ODQQLQJ&RPPLWWHH 7KLVFRPPLWWHHLVUHVSRQVLEOHIRUWKHGHYHORSPHQWRIWKH'LVWULFWORQJUDQJHVWUDWHJLFSODQQLQJSURFHVVHVDQG IRUIRVWHULQJFRPPXQLFDWLRQVZLWKWKHFRPPXQLW\ 3ULRULW\DUHDVIRUWKH 6WUDWHJLF3ODQLQFOXGH Ɣ &RPPXQLFDWLRQ Ɣ 6DIHW\DQG6HFXULW\ Ɣ &XUULFXOXP 7KHVHIRFXVDUHDVRYHUDUFKQLQH DUWLFXODWHGREMHFWLYHVLQWKH 6WUDWHJLF3ODQ7RLGHQWLI\WKH 'LVWULFW¶VSURJUHVVLQWKHVHJRDOVDQGREMHFWLYHVZHKDYHLQFOXGHGD5HSRUW&DUGLQWKHVXEVHTXHQWSDJHVRI WKLV$QQXDO5HSRUW 3ROLF\&RPPLWWHH 3ROLF\PDNLQJLVDPDMRUIXQFWLRQRIWKH6FKRRO%RDUG7KHUHVSRQVLELOLWLHVRIWKLVFRPPLWWHHLQFOXGHWKH GHYHORSPHQWUHYLHZDQGUHYLVLRQRI6FKRRO'LVWULFWSROLFLHVWKDWFOHDUO\GHILQHWKHYLVLRQRIWKH6FKRRO'LVWULFW DQGRIWHQFKDUWDVSHFLILFFRXUVHRIDFWLRQIRUKRZWKH'LVWULFWRSHUDWHV7KHZULWLQJDQGUHYLVLRQRISROLFLHVLV LQLWLDWHGDVDUHVXOWRIWKHQHHGWRFRPSO\ZLWKQHZODZVRUFRXUWGHFLVLRQVDQGFKDQJLQJQHHGVRIWKHVFKRRO V\VWHP .H\GLVFXVVLRQVSROLF\ZULWLQJDQGSROLF\UHYLVLRQVWKLV\HDULQFOXGHG Ɣ -/&):HOOQHVV3ROLF\ Ɣ $&$'HSDUWPHQWRI$JULFXOWXUH 86'$ 1RQGLVFULPLQDWLRQ6WDWHPHQW Ɣ '$)$GPLQLVWUDWLRQRI)HGHUDO*UDQWV Ɣ .((:HEVLWH$FFHVVLELOLW\DQG*ULHYDQFH Ɣ *&&%&)DPLO\DQG0HGLFDO/HDYH$FW Ɣ -/&.6SHFLDO3K\VLFDO+HDOWK1HHGVRI6WXGHQWV Ɣ %*%RDUG3ROLF\'HYHORSPHQW 7UDQVSRUWDWLRQ&RPPLWWHH 7KLV%RDUGLVUHVSRQVLEOHIRUWKHRYHUDOOPRQLWRULQJRIWKHWUDQVSRUWDWLRQV\VWHPLQFOXGLQJWUDQVSRUWDWLRQ URXWHVEXVVWRSVYHKLFOHSXUFKDVHEXVGULYHUVEXVGLVFLSOLQHWUDQVSRUWDWLRQV\VWHPQHHGVHWF7KH FRPPLWWHH¶VIRFXVWKLV\HDUKDVEHHQRQUHYLHZLQJDQGZRUNLQJZLWKSDUHQWVRQEXVVWRSUHTXHVWV$FRQWLQXHG IRFXVRQWKHIOHHWDQGDSURDFWLYHDSSURDFKWRDQWLFLSDWLQJUHSODFHPHQWQHHGVFRQWLQXHVWREHYHU\EHQHILFLDO 2XUWUDQVSRUWDWLRQVHUYLFHVUHSUHVHQWWKHEHJLQQLQJDQGHQGRIHYHU\VFKRROGD\IRUPDQ\RIRXUVWXGHQWVDQG RXUJRDOLVWRPDNHWKHVHWULSVVDIHDQGUHVSHFWIXOIRUERWKVWXGHQWVDQGDGXOWV 32 2020 Annual Report | Merrimack Valley School District 0HUULPDFN 9DOOH\ 6FKRRO 'LVWULFW 096' /RQJ5DQJH3ODQ6WUDWHJLF*RDOV3URJUHVV5HSRUW 7KLVUHSRUWSURYLGHVDTXLFNXSGDWHRQWKH'LVWULFW VRQJRLQJSURJUHVVLQWKHDUHDVRI&RPPXQLFDWLRQ6DIHW\ DQG6HFXULW\ DQG &XUULFXOXP DV GHILQHG LQ WKH 6WUDWHJLF *RDOV 7KHVH DQQXDO WDUJHWV SURYLGH DQLPSRUWDQWIRFXVWRRXUZRUNLQWKH'LVWULFW7KHGLVFUHWHZRUNLVSDUVHGRXWWRYDULRXV'LVWULFW&RPPLWWHHV ZKLOHWKHIRFXVDUHDVSURYLGHYDOXDEOHJXLGDQFHIRUEXGJHWLQJDQGJRDOVHWWLQJWKURXJKRXWWKH'LVWULFW &RPPXQLFDWLRQ ,Q 7R%H $FWLRQ3ODQ 0HW 3URJUHVV $GGUHVVHG 096'RQOLQHGDVKERDUG ; ,PSURYH0906DQG09+6WHDFKHUFRPPXQLFDWLRQ ; 1HZ'LVWULFWPLVVLRQYLVLRQVWDWHPHQW ; 6DIHW\DQG6HFXULW\ ,Q 7R%H $FWLRQ3ODQ 0HW 3URJUHVV $GGUHVVHG &RRUGLQDWH DQG KROG 09+6 FDPSXV VHFXULW\ H[HUFLVH ; 6DIHW\DQGVHFXULW\XSJUDGHVRI096'EXLOGLQJV ; &XUULFXOXP ,Q 7R%H $FWLRQ3ODQ 0HW 3URJUHVV $GGUHVVHG ,PSURYH DQG LQFUHDVH ILQDQFLDO OLWHUDF\ DQG OLIH VNLOOV ; )RFXVRQHIIHFWLYHXVHRIWHFKQRORJ\LQLQVWUXFWLRQDQGDVVHVVPHQW ; ,PSURYHDQGLQFUHDVHEXVLQHVVFRQQHFWLRQV ; /HDUQHU)UDPHZRUN3RUWUDLWRID*UDGXDWH ; 7KHSXUSRVHRIDQRQOLQHGDVKERDUGLVWRSURYLGHDQLQWHUDFWLYHSDJHZLWKYDULRXV'LVWULFWPHWULFV DFDGHPLF RSHUDWLRQDOGHPRJUDSKLFEXGJHWDU\« 7KLVZLOODOORZWKH'LVWULFWWRSXWIRUWKGDWDWRRXUFRQVWLWXHQWVWKDW LOOXVWUDWHVRXULPSDFWHIILFLHQFLHVDQGDUHDVRIQHHGHGLPSURYHPHQW:HDUHZRUNLQJZLWKDSODWIRUPWRSXEOLVK WKLV2WKHUFRPPXQLFDWLRQLQLWLDWLYHVLQFOXGHWKHQHZ³096'6SRWOLJKW´LQFUHDVHGFRPPXQLFDWLRQVQHZVOHWWHUV DQGVRFLDOPHGLDSRVWVIURPWKHVFKRROVDORQJZLWKFRQWLQXRXVO\XSGDWHGZHEVLWHV&ROODERUDWLYHVWDNHKROGHU FRQYHUVDWLRQVRQWKH096'PLVVLRQYLVLRQVWDWHPHQWDUHSODQQHGIRUWKHVHFRQGKDOIRIWKH\HDU 7KH'LVWULFW³PHW´WKHDQWLFLSDWHG6HFXULW\JRDOVIRUWKH VFKRRO\HDU7KHVHLQFOXGHFRQWLQXHGEXLOGLQJ DFFHVVSURMHFWVDQGVXUYHLOODQFHDQGDOHUWLQJXSJUDGHV7KHVFKRRO\HDUZLOOVHHIXUWKHUZRUN DFFRPSOLVKHGLQWKLVUHDOP:HFRQWLQXHRXUZRUNZLWKWKH&RQFRUG3ROLFH'HSDUWPHQW &3' LQSODQQLQJDIXOO VFDOHVHFXULW\H[HUFLVHIRU09+6WREHKHOGLQ0D\RI &XUULFXOXPZRUNKDVIRFXVHGRQILQDQFLDOOLWHUDF\ D³3HUVRQDO)LQDQFH´FRXUVHLVEHLQJEURXJKWIRUZDUGDVD SRWHQWLDOJUDGXDWLRQUHTXLUHPHQW VWD\WXQHG 7KH'LVWULFW¶V GHYLFHLQLWLDWLYHLVLQLWVVHFRQG\HDU:H FRQWLQXHWRHQKDQFHRXUEXVLQHVVFRQQHFWLRQVWKURXJK([WHQGHG/HDUQLQJ2SSRUWXQLWLHV (/2¶V DQG EXUJHRQLQJEXVLQHVVSDUWQHUVKLSV)LQDOO\WKH&XUULFXOXP&RXQFLOLVSURJUHVVLQJZHOOZLWKWKHLU/HDUQHU )UDPHZRUN3RUWUDLWRID*UDGXDWHZRUN LQFRQQHFWLRQZLWK1($6& 7KH096'¶V$QQXDO6WUDWHJLF*RDOVFDQEHIRXQGRQOLQHDWKWWSV ZZZPYVGSULGHRUJVFKRROERDUG 33 Merrimack Valley School District - Long Range Planning Committee Strategic Focus Areas and Action Plans for 2019-2020 School Year Focus Area #1 - Communication Action Plan: 1. Creation and publication of MVSD Online Dashboard to display diverse District metrics and student achievements Measurement: • Inclusion of “MVSD Dashboard” on MVSD website • Analytics and data related to site visits 2. Continue to improve MVMS and MVHS teacher communication with parents (with an increased focus on the ARTS) Measurement: • Professional Development (PD) and continued implementation of Domain IV (Professional Responsibility) of the Professional Growth and Evaluation Model (related to communications) • MVSD District Spotlight • MVHS - “Moments of Pride” • MVMS - Pride Newsletter 3. Development of new District Level Mission/Vision Statement Measurement: • Newly adopted Mission/Vision Statement Focus Area #2 - Safety and Security Action Plan: 4. Coordinate and Hold MVHS Armed Intruder Exercise Measurement: • Completion of the security exercise • Constituent survey feedback from event 5. Continue with physical and operational safety and security upgrades of MVSD buildings • Increased building access security • Updated and expanded monitoring systems and capabilities • Expand emergency alerting capabilities • Connect with Concord Police Department (CPD) and Concord School District (CSD) to establish emergency communications protocol and expectations Measurement: • Completed security-related projects from the Capital Improvement Plan (CIP) • Articulated communication protocol with the Concord Police Department (CPD) and the Concord School District (CSD) 34 /GTTKOCEM8CNNG[5EJQQN&KUVTKEV.QPI4CPIG2NCPPKPI%QOOKVVGG Strategic Focus Areas and Action Plans for 2019-2020 School Year Focus Area #3 - Curriculum Action Plan: 6. Improve and increaseƂPCPEKCNNKVGTCE[CPFNKHGUMKNN offerings: • Through work with the Curriculum Instruction & Assessment (CIA) committee: • Ài>ÌiÃV«i>`ÃiµÕiVivw>V>ÌiÀ>VÞ>`Ài>Ìi`viÃà • As is necessary, make adjustments to programming/offerings in the 2020-2021 school year Measurement: • Articulated scope and sequence • Established point-person at MVMS and MVHS • Potential new course offerings 7. Increased focus on effective use of technology in instruction and assessment • 1:1 - (one device per student) technology implementation • Year 2 of implementation (starting in grades 5 and 9) • Blizzard Bag Days - preparing for the potential of 2-days • PD - ongoing training in GSuite (including Classroom) and other relevant topics/applications • Data Privacy Agreements (DPAs) Measurement: • 1:1 implementation survey of students, teachers, and parents • Survey of stakeholders (students, teachers, parents) regarding Blizzard Bag Days • Student attendance data on Blizzard Bag Days • Administrative classroom evaluations (elements related to effective technology use) • PD offerings (and associated processes...e.g. - goal setting via Individual Professional Development Plan - IPDP) related to effective technology use in student engagment, instruction, and assessment 8. Improve and increase business connections to prepare a work ready workforce • Scope and Sequence identifying where this is already taking place k-12 • wÀ«Ì«iÀÃÜÌ i>V VÕÃi}`i«>ÀÌiÌ>`ÃV ``i>` } ®Ì >ÌÜ>i appropriate connections with businesses and local business organizations. Include these business connections in school and district-based emails (as is appropriate) and activities (5th grade exhibitions, 8th grade project, senior project, awards nights, MVLC programming…) • À}i"vwV> ÕÃiÃÃ*>ÀÌiÀà «Ã Measurement: • Articulated scope of connections via school counseling curriculum • Established point-person at MVMS and MVHS • Publicize and foster ongoing connections and look to expand and create new business connections 9. New MVSD, K-12, .GCTPGT(TCOGYQTM2QTVTCKVQHC)TCFWCVG • Establish a K-12 Learner Framework to connect academic and other efforts throughout the District • Include Third-Party Validation Measurement: • Articulated Plan • Schedule of Third-Party Visitations Merrimack Valley School District • 105 Community Drive • Penacook, NH 03303 603.753.6561 (phone) • 603.753.6023 (fax) http://www.mvsdpride.org 35 2020 Annual Report | Merrimack Valley School District 0HUULPDFN9DOOH\6FKRRO'LVWULFW 2FWREHUVW(QUROOPHQW %RVFDZHQ /RXGRQ 3HQDFRRN . . . 3UHVFKRRO 3UHVFKRRO 7RWDO 7RWDO 7RWDO 6DOLVEXU\ :HEVWHU . . 7RWDO 7RWDO 0LGGOH6FKRRO +LJK6FKRRO 7RWDO 7RWDO (152//0(176800$5< (OHPHQWDU\ 0LGGOH6FKRRO +LJK6FKRRO 7RWDOV 36 2020 Annual Report | Merrimack Valley School District RETIRING Faculty & Staff Cathy Klapproth Diana Muzzey Donna Williams Joanne Davis Nanci Plimpton Phyllis West Ray Bailey Tom Burke Wendy Follansbee 37 Merrimack Valley School District 2020-2021 School Calendar August/September February M T W T F M T W T F (26) (27) X 1 2 3 4 5 21 *31* 1 2 3 X 15 8 9 10 11 12 Days X 8 9 10 11 Days 15 16 17 18 19 14 15 16 17 18 X X X X X 21 22 23 24 25 28 29 30 October March M T W T F M T W T F 1 2 1 2 3 4 5 20 5 6 7 8 (9) 22 8 9 10 11 12 Days X 13 14 15 16 Days 15 16 17 18 (19) 19 20 21 22 23 22 23 24 25 26 26 27 28 29 30 29 30 31 November April M T W T F M T W T F 2 3 4 5 6 1 2 9 10 X 12 13 17 5 6 7 8 9 17 16 17 18 19 20 Days 12 13 14 15 16 Days 23 24 X X X 19 20 21 22 23 30 X X X X X December May M T W T F M T W T F 1 2 3 4 3 4 5 6 7 16 7 8 9 10 11 10 11 12 13 14 Days 14 15 16 17 18 20 17 18 19 20 21 21 22 X X X Days 24 25 26 27 28 X X X X X January June M T W T F M T W T F X 1 2 3 4 18 4 5 6 7 8 14 7 8 9 10 11 Days 11 12 13 14 15 Days 14 15 16 17 *18* X 19 20 21 22 (#) # # # # 25 26 27 28 (29) 28 29 92 88 August 26-27 Teacher Workshop February 22-26 Winter Recess August 31 First Day for Students March 19 Teacher Workshop September 4-7 Labor Day Weekend April 26-30 Spring Recess October 9 Teacher Workshop May 31 Memorial Day October 12 Columbus Day June 18th Tentative Last Day for Students November 11 Veterans Day Teacher Workshop Day to Follow Last Student Day November 25-27 Thanksgiving Recess ( ) = Teacher Workshop Days/No School for Students December 23-31 Holiday Recess X = No School for Students or Staff January 1 New Year’s Day # = Snow days, if necessary January 18 Martin Luther King, Jr. Day Approved by the MV School Board - 1.13.2020 January 29 Teacher Workshop