OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG203256
Ethe1 (NM_023154) Mouse Tagged ORF Clone Product data:
Product Type: Expression Plasmids Product Name: Ethe1 (NM_023154) Mouse Tagged ORF Clone Tag: TurboGFP Symbol: Ethe1 Synonyms: 0610025L15Rik; Hsco Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG203256 representing NM_023154 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC
ATGGCGAGCGCGGTCGTCAGGGTCGCCGGGCGGCGGCTGAGCCAGCAAAGCGCATCCGGAGCCCCGGTCC TCCTGCGGCAGATGTTTGAACCCAAGAGCTGCACCTATACCTACCTTCTGGGTGACCGGGAGTCAAGAGA GGCAGTTCTGATCGACCCCGTTCTGGAGACAGCGCATCGGGATGCTCAGTTGATTAAGGAGCTGGGGCTC AAGCTGTTGTACGCTGTGAACACTCACTGCCATGCTGACCACATCACCGGCACGGGGGTTCTCCGGTCCC TGCTCCCGGGCTGCCAGTCTGTCATCTCCCGCCTCAGCGGAGCCCAGGCTGATTTGCATATCGGGGAAGG TGATTCCATCCGCTTTGGACGCTTTGCTTTGGAGACTCGAGCCAGCCCTGGCCACACTCCAGGCTGTGTC ACCTTTGTCCTGAACGACCAGAGCATGGCCTTCACTGGAGATGCCCTGCTGATCCGAGGGTGTGGACGGA CAGACTTCCAACAAGGCTGTGCTAAGACTTTGTACCACTCTGTGCACGAGAAGATCTTCACACTTCCAGG CAACTGTCTAATCTACCCGGCTCACGATTACCACGGGCTCACAGTTTCTACTGTGGAGGAGGAACGGACT CTGAACCCACGGCTTACCCTCAGCTGTGAGGAATTTATCAAGGTCATGGACAACCTGAACTTGCCCAAGC CACAGCAGATAGACATTGCTGTTCCTGCAAATATGCGCTGTGGGGTCCAGACTCCACCCTCC
ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Ethe1 (NM_023154) Mouse Tagged ORF Clone – MG203256
Protein Sequence: >MG203256 representing NM_023154 Red=Cloning site Green=Tags(s)
MASAVVRVAGRRLSQQSASGAPVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAHRDAQLIKELGL KLLYAVNTHCHADHITGTGVLRSLLPGCQSVISRLSGAQADLHIGEGDSIRFGRFALETRASPGHTPGCV TFVLNDQSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERT LNPRLTLSCEEFIKVMDNLNLPKPQQIDIAVPANMRCGVQTPPS
TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI Cloning Scheme:
Plasmid Map:
ACCN: NM_023154 ORF Size: 762 bp
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Ethe1 (NM_023154) Mouse Tagged ORF Clone – MG203256
OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_023154.4 RefSeq Size: 1497 bp
RefSeq ORF: 765 bp Locus ID: 66071 UniProt ID: Q9DCM0 Gene Summary: First described as a protein that can shuttle between the nucleus and the cytoplasm and suppress p53-induced apoptosis by sequestering the transcription factor RELA/NFKB3 in the cytoplasm and preventing its accumulation in the nucleus (By similarity). Sulfur dioxygenase that plays an essential role in hydrogen sulfide catabolism in the mitochondrial matrix. Hydrogen sulfide (H(2)S) is first oxidized by SQRDL, giving rise to cysteine persulfide residues. ETHE1 consumes molecular oxygen to catalyze the oxidation of the persulfide, once it has been transferred to a thiophilic acceptor, such as glutathione (R-SSH). Plays an important role in metabolic homeostasis in mitochondria by metabolizing hydrogen sulfide and preventing the accumulation of supraphysiological H(2)S levels that have toxic effects, due to the inhibition of cytochrome c oxidase.[UniProtKB/Swiss-Prot Function]
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3