DOCSLIB.ORG

Kinase Prof Iling Services Kinase Profiling / IC50 Services

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Kinase Prof Iling Services Kinase Profiling / IC50 Services Accelerate Your Drug Discovery Process! Kinase Prof iling Services 192 Validated Targets* Kinase Profiling / IC50 Services Massive Kinome Coverage at two ATP concentrations We have expanded our Profiling / IC50 Services to facilitate inhibitor-type determinations by adding optional profiling at 1mM ATP, approaching physiological ATP levels. This important adjunct to our existing services, performed at [ATP]=Km bin., extends to 192 human kinases* (123 TKs including mutants, 69 STKs) and allows the impact of ATP concentration on kinase-inhibitory activity to be rapidly visualized and assessed. A list of kinases available for IC50 determinations using 1mM ATP is shown on the reverse side. Despite the sensitivity offered by performing in vitro assays at ATP concentrations approximating Km, physiological conditions are seldom the same. Inhibitory potency and selectivity may vary with the concentration of ATP available; results contrasting ATP Km bin. vs. 1mM ATP are shown below. * As of May 22 2017 Example of Analysis Differential Kinase Selectivity : ATP Km bin. vs. 1mM ATP Sunitinib vs. TKs at [ATP]=Km bin. Sunitinib vs. TKs at [ATP]=1mM PDGFRB PDGFRA PDGFRB PDGFRA HER2 FMS HER2 FMS TYRO3 EGFR TYRO3 EGFR KIT KIT MER HER4 MER AXL HER4 TK FLT3 AXL TK FLT3 RON HER3/ErbB3 KDR RON HER3/ErbB3 KDR RYK FLT1 MET RYK TYK2 FLT1 MET TYK2 FLT4 TIE1 JAK3 FLT4 TIE1 JAK3 JAK1 FGFR4 JAK1 FGFR4 JAK2 FGFR1 TIE2 JAK2 FGFR3 FGFR1 TIE2 TNK1 FGFR3 TNK1 IGF1R ACK IGF1R IRR ACK LMR1 IRR FGFR2 RET LMR1 LMR2 FGFR2 RET LMR2 INSR INSR FER FES FER FES LMR3 LTK LMR3 LTK ALK ROS ALK ROS BTK BTK EphA10 BMX ITK EphA10 SuRTK106 BMX ITK SuRTK106 CCK4 TXK CSK CCK4 TXK CSK EphB6 PYK2 EphB6 PYK2 TEC CTK ZAP70 TEC CTK ZAP70 FAK EphA1 FAK SRM EphA1 SYK SRM SYK ABL ABL BRK ROR2 BRK ROR2 ROR1 ARG ROR1 ARG MUSK FRK EphA2 MUSK FRK EphA2 BLK DDR1 DDR2 TRKA BLK DDR1 DDR2 TRKA LCK EphA8 IC50 (nM) LCK EphA8 HCK TRKC HCK TRKC LYN FGR TRKB LYN FGR TRKB EphB4 EphB4 SRC FYN EphA6 SRC FYN EphA6 YES EphB3 EphB1 YES EphB3 EphB1 EphA7 EphA7 EphB2 HIPK2 EphB2 EphA4 EphA4 EphA3 0.1 1 10 100 1,000>10,000 EphA3 EphA5 EphA5 Applicable for screening inhibitors that are non-competitive for the ATP binding site, the apparent selectivity of the inhibitor when measured at [ATP] Km bin. was further enhanced at 1mM ATP, in this experiment. Higher ATP concentrations, approaching physiological, provide conditions similar to cellular proliferation assays for ligands targeted to activated kinases. Having both ATP Km bin. and 1mM ATP assays provides insight to in vivo pharmacological behavior. Ready to start? Download our convenient Application Form at www.carnabio.com, complete the necessary fields and E-mail your sales representative or [email protected]. Our Application Form for Activity Based Profiling based on our Kinase Panel at [ATP]=Km bin. can also be downloaded from our website. If you are a new customer, we recommend executing a CDA to assure complete confidentiality. Km bin. 1mM Carna's wholly-owned subsidiary Carna Biosciences, Inc. CarnaBio USA, Inc. BMA 3F, 1-5-5 Minatojima-Minamimachi, Chuo-ku, Kobe 650-0047 JAPAN 209 West Central Street, Suite 307, Natick, MA 01760 USA TEL： 078-302-7091 / FAX： 078-302-7086 TEL: +1-508-650-1244 / Toll-Free: +1-888-645-1233 E-mail： [email protected] E-mail: [email protected] / FAX: +1-508-650-1722 www.carnabio.com ©2009 Carna Biosciences, Inc. QuickScout™ Custom Profiling from Carna Biosciences, Inc. 192 human kinases (123 TKs, 69 STKs) for 1mM ATP We test your drug candidates against any or all of the 192 Kinases shown below using ATP at a concentration of 1mM. Our service is the industry's most complete specificity and selectivity assessment, based on IC50 values. Additional information on each kinase and assay conditions can be obtained by visiting www.carnabio.com and downloading our Kinase Profiling Book. Tyrosine Kinases Tyrosine Kinases Serine/Threonine Kinases ABL(ABL1) FYN [isoform a] AKT1 ABL(ABL1) [E255K] FYN [isoform b] AMPKα1/β1/γ1(PRKAA1/B1/G1) ABL(ABL1) [T315I] HCK AurA(AURKA) ACK(TNK2) HER2(ERBB2) AurB(AURKB)/INCENP ALK HER4(ERBB4) AurC(AURKC) ALK [C1156Y] IGF1R BRSK1 ALK [F1174L] INSR CaMK4 ALK [G1202R] IRR(INSRR) CDC2/CycB1 ALK [G1269A] ITK CDC7/ASK ALK [L1196M] JAK1 CDK2/CycA2 ALK [R1275Q] JAK2 CDK2/CycE1 ALK [T1151_L1152insT] JAK3 CDK4/CycD3 ARG(ABL2) KDR CDK5/p25 AXL KIT CDK6/CycD3 BLK KIT [D816E] CDK7/CycH/MAT1 BMX KIT [D816V] CDK9/CycT1 BRK(PTK6) KIT [D816Y] CHK1(CHEK1) BTK KIT [T670I] CHK2(CHEK2) BTK[C481S] KIT [V560G] CK1α(CSNK1A1) CSK KIT [V654A] CK1ε(CSNK1E) DDR1 LCK CK2α1/β(CSNK2A1/B) DDR2 LTK CLK1 EGFR LYNa CLK2 EGFR [d746-750] LYNb DAPK1 EGFR [d746-750/T790M] MER(MERTK) DYRK1A EGFR [L858R] MET DYRK1B EGFR [L861Q] MET [D1228H] Erk1(MAPK3) EGFR [T790M] MET [M1250T] Erk2(MAPK1) EGFR [T790M/L858R] MET [Y1235D] GSK3α(GSK3A) EML4-ALK MUSK GSK3β(GSK3B) EPHA1 NPM1-ALK HIPK4 EPHA2 PDGFRα(PDGFRA) HGK(MAP4K4) EPHA3 PDGFRα(PDGFRA) [D842V] IKKβ(IKBKB) EPHA4 PDGFRα(PDGFRA) [T674I] JNK1(MAPK8) EPHA5 PDGFRα(PDGFRA) [V561D] JNK2(MAPK9) EPHA6 PDGFRβ(PDGFRB) JNK3(MAPK10) EPHA7 PYK2(PTK2B) MAPKAPK2 EPHA8 RET MINK(MINK1) EPHB1 RET [G691S] MST1(STK4) EPHB2 RET [M918T] NEK1 EPHB3 RET [S891A] NEK2 EPHB4 RET [Y791F] NEK6 FAK(PTK2) RON(MST1R) NEK7 FER ROS(ROS1) NEK9 FES SRC p38α(MAPK14) FGFR1 SRM(SRMS) p38β(MAPK11) FGFR1 [V561M] SYK p38γ(MAPK12) FGFR2 TEC p38δ(MAPK13) FGFR2 [V564I] TIE2(TEK) p70S6K(RPS6KB1) FGFR3 TNK1 PAK2 FGFR3 [K650E] TRKA(NTRK1) PBK FGFR3 [K650M] TRKB(NTRK2) PDK1(PDPK1) FGFR3 [V555L] TRKC(NTRK3) PIM1 FGFR3 [V555M] TXK PIM2 FGFR4 TYK2 PKACα(PRKACA) FGFR4 [N535K] TYRO3 PKCα(PRKCA) FGFR4 [V550E] YES(YES1) PKCε(PRKCE) FGFR4 [V550L] YES(YES1) [T348I] PKD2(PRKD2) FGR ZAP70 PLK1 FLT1 PLK3 FLT3 Tyrosine Kinases 123 QIK(SNF1LK2) FLT4 Serine/Threonine Kinases 69 ROCK1 FMS(CSF1R) Total 192 targets RSK1(RPS6KA1) FRK RSK3(RPS6KA2) Updated: 2017/5/22 RSK4(RPS6KA6) SGK SIK(SNF1LK) TNIK TSSK1.
Load more

Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • Gene Symbol Gene Description ACVR1B Activin a Receptor, Type IB
    Table S1. Kinase clones included in human kinase cDNA library for yeast two-hybrid screening Gene Symbol Gene Description ACVR1B activin A receptor, type IB ADCK2 aarF domain containing kinase 2 ADCK4 aarF domain containing kinase 4 AGK multiple substrate lipid kinase;MULK AK1 adenylate kinase 1 AK3 adenylate kinase 3 like 1 AK3L1 adenylate kinase 3 ALDH18A1 aldehyde dehydrogenase 18 family, member A1;ALDH18A1 ALK anaplastic lymphoma kinase (Ki-1) ALPK1 alpha-kinase 1 ALPK2 alpha-kinase 2 AMHR2 anti-Mullerian hormone receptor, type II ARAF v-raf murine sarcoma 3611 viral oncogene homolog 1 ARSG arylsulfatase G;ARSG AURKB aurora kinase B AURKC aurora kinase C BCKDK branched chain alpha-ketoacid dehydrogenase kinase BMPR1A bone morphogenetic protein receptor, type IA BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) BRAF v-raf murine sarcoma viral oncogene homolog B1 BRD3 bromodomain containing 3 BRD4 bromodomain containing 4 BTK Bruton agammaglobulinemia tyrosine kinase BUB1 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) BUB1B BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast) C9orf98 chromosome 9 open reading frame 98;C9orf98 CABC1 chaperone, ABC1 activity of bc1 complex like (S. pombe) CALM1 calmodulin 1 (phosphorylase kinase, delta) CALM2 calmodulin 2 (phosphorylase kinase, delta) CALM3 calmodulin 3 (phosphorylase kinase, delta) CAMK1 calcium/calmodulin-dependent protein kinase I CAMK2A calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha CAMK2B calcium/calmodulin-dependent
    [Show full text]
  • Review Tec Kinases: a Family with Multiple Roles in Immunity
    Immunity, Vol. 12, 373±382, April, 2000, Copyright 2000 by Cell Press Tec Kinases: A Family Review with Multiple Roles in Immunity Wen-Chin Yang,*³§ Yves Collette,*³ inositol phosphates, but they are thought to be relevant Jacques A. NuneÁ s,*³ and Daniel Olive*² for binding of PtdIns lipids to the same sites. In most *INSERM U119 cases, PH domains bind preferentially to PtdIns (4,5)P2 Universite de la Me diterrane e and inositol (1,4,5) P3 (Ins (1,4,5) P3). However, the Btk 13009 Marseille PH domain binds PtdIns (3,4,5)P3 and Ins (1, 3, 4, 5)P4 France the tightest. PtdIns (3, 4, 5)P3, one of the products of the action of PI3K, is thought to act as a second messen- ger to recruit regulatory proteins to the plasma mem- brane via their PH domains (see below). Many of the Antigen receptors on T, B, and mast cells are multimo- mutations in Btk that lead to XLA are point mutations lecular complexes that are activated by interactions with that cluster at one end of the PH domain and could be external signals. These signals are then transmitted to predicted to impair binding to Ins (3,4,5)P (for review regulate gene expression and posttranscriptional modi- 3 see Satterthwaite et al., 1998a) (Figure 1b). Similarly, fications. Nonreceptor tyrosine kinases (NRTK) are key CBA/N xid mice carry an R28C mutation in the Btk PH players that relay and integrate these signals. NRTK are domain. The recent structure of the PH domain from divided into distinct families defined by a prototypic Btk complexed with Ins (1,3,4,5)P4 provides an explana- member: Src, Tec, Syk, Csk, Fes, Abl, Jak, Fak, Ack, tion for several mutations associated with XLA: mis- Brk, and Srm (Bolen and Brugge, 1997).
    [Show full text]
  • Transcriptional Regulation of Kinases Downstream of the T Cell Receptor
    Petrillo et al. BMC Pharmacology and Toxicology 2014, 15:35 http://www.biomedcentral.com/2050-6511/15/35 RESEARCH ARTICLE Open Access Transcriptional regulation of kinases downstream of the T cell receptor: another immunomodulatory mechanism of glucocorticoids Maria Grazia Petrillo1†, Katia Fettucciari2†, Paolo Montuschi3†, Simona Ronchetti1, Luigi Cari1, Graziella Migliorati1, Emanuela Mazzon4, Oxana Bereshchenko1, Stefano Bruscoli1, Giuseppe Nocentini1,5* and Carlo Riccardi1 Abstract Background: Glucocorticoids affect peripheral immune responses, including modulation of T-cell activation, differentiation, and apoptosis. The quantity and quality of T-cell receptor (TCR)-triggered intracellular signals modulate T-cell function. Thus, glucocorticoids may affect T cells by interfering with the TCR signaling cascade. The purpose of the study was to search for glucocorticoid-modulated kinases downstream of the TCR. Methods: Gene modulation in lymphoid cells either treated with glucocorticoids or from glucocorticoid-treated mice was studied using a RNase protection assay, real-time PCR, and western blotting. The sensitivity of genetically modified thymocytes to glucocorticoid-induced apoptosis was studied by performing hypotonic propidium iodide staining and flow cytometry. The Student’s t-test was employed for statistical evaluation. Results: We found that transcription of Itk, a non-receptor tyrosine kinase of the Tec family, was up-regulated in a mouse T-cell hybridoma by the synthetic glucocorticoid dexamethasone. In contrast, dexamethasone down-regulated the expression of Txk, a Tec kinase that functions redundantly with Itk, and Lck, the Src kinase immediately downstream of the TCR. We investigated the expression of Itk, Txk,andLck in thymocytes and mature lymphocytes following in vitro and in vivo dexamethasone treatment at different time points and doses.
    [Show full text]
  • Itk Tyrosine Kinase Substrate Docking Is Mediated by a Nonclassical SH2 Domain Surface of PLC␥1
    Itk tyrosine kinase substrate docking is mediated by a nonclassical SH2 domain surface of PLC␥1 Lie Min, Raji E. Joseph, D. Bruce Fulton, and Amy H. Andreotti1 Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, Ames, IA 50011 Edited by Susan S. Taylor, University of California at San Diego, La Jolla, CA, and approved October 20, 2009 (received for review October 1, 2009) Interleukin-2 tyrosine kinase (Itk) is a Tec family tyrosine kinase that We have previously shown that the PLC␥1 SH2C domain mediates signaling processes after T cell receptor engagement. Acti- (spanning residues 659–756 within full-length PLC␥1) binds di- vation of Itk requires recruitment to the membrane via its pleckstrin rectly to the Itk kinase domain and is required for efficient homology domain, phosphorylation of Itk by the Src kinase, Lck, and phosphorylation of Y783 by Itk (26). Fragments of PLC␥1 that binding of Itk to the SLP-76/LAT adapter complex. After activation, Itk contain Y783 but not the SH2C domain are not efficiently phos- phosphorylates and activates phospholipase C-␥1 (PLC-␥1), leading to phorylated by Itk. Moreover, phosphorylation of PLC␥1 substrate production of two second messengers, DAG and IP3. We have previ- fragments that contain both SH2C and Y783 (spanning 659–789, ously shown that phosphorylation of PLC-␥1 by Itk requires a direct, hereafter referred to as PLC␥1 SH2C-linker) can be inhibited by phosphotyrosine-independent interaction between the Src homol- titration with isolated PLC␥1 SH2C domain (26). The excess, free ogy 2 (SH2) domain of PLC-␥1 and the kinase domain of Itk.
    [Show full text]
  • Novel Protein-Tyrosine Kinase Gene (Hck) Preferentially Expressed in Cells of Hematopoietic Origin STEVEN F
    MOLECULAR AND CELLULAR BIOLOGY, June 1987, p. 2276-2285 Vol. 7, No. 6 0270-7306/87/062276-10$02.00/0 Copyright © 1987, American Society for Microbiology Novel Protein-Tyrosine Kinase Gene (hck) Preferentially Expressed in Cells of Hematopoietic Origin STEVEN F. ZIEGLER,"12 JAMEY D. MARTH,"', DAVID B. LEWIS,4 AND ROGER M. PERLMUTTER' 2,5* Howard Hughes Medical Institute' and the Departments ofBiochemistry,2 Medicine,s Pediatrics,4 and Pharmacology,3 University of Washington School of Medicine, Seattle, Washington 98195 Received 16 December 1986/Accepted 18 March 1987 Protein-tyrosine kinases are implicated in the control of cell growth by virtue of their frequent appearance as products of retroviral oncogenes and as components of growth factor receptors. Here we report the characterization of a novel human protein-tyrosine kinase gene (hck) that is primarily expressed in hematopoietic cells, particularly granulocytes. The hck gene encodes a 505-residue polypeptide that is closely related to pp56kk, a lymphocyte-specific protein-tyrosine kinase. The exon breakpoints of the hck gene, partially defined by using murine genomic clones, demonstrate that hck is a member of the src gene family and has been subjected to strong selection pressure during mammalian evolution. High-level expression of hck transcripts in granulocytes is especially provocative since these cells are terminally differentiated and typically survive in vivo for only a few hours. Thus the hck gene, like other members of the src gene family, appears to function primarily in cells with little growth potential. Specific phosphorylation of proteins on tyrosine residues line Ml induces monocytoid differentiation (18), presumably was first detected in lysates of cells infected with acutely as a result of activation of endogenous pp60csrc (7).
    [Show full text]
  • Src-Family Kinases Impact Prognosis and Targeted Therapy in Flt3-ITD+ Acute Myeloid Leukemia
    Src-Family Kinases Impact Prognosis and Targeted Therapy in Flt3-ITD+ Acute Myeloid Leukemia Title Page by Ravi K. Patel Bachelor of Science, University of Minnesota, 2013 Submitted to the Graduate Faculty of School of Medicine in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Pittsburgh 2019 Commi ttee Membership Pa UNIVERSITY OF PITTSBURGH SCHOOL OF MEDICINE Commi ttee Membership Page This dissertation was presented by Ravi K. Patel It was defended on May 31, 2019 and approved by Qiming (Jane) Wang, Associate Professor Pharmacology and Chemical Biology Vaughn S. Cooper, Professor of Microbiology and Molecular Genetics Adrian Lee, Professor of Pharmacology and Chemical Biology Laura Stabile, Research Associate Professor of Pharmacology and Chemical Biology Thomas E. Smithgall, Dissertation Director, Professor and Chair of Microbiology and Molecular Genetics ii Copyright © by Ravi K. Patel 2019 iii Abstract Src-Family Kinases Play an Important Role in Flt3-ITD Acute Myeloid Leukemia Prognosis and Drug Efficacy Ravi K. Patel, PhD University of Pittsburgh, 2019 Abstract Acute myelogenous leukemia (AML) is a disease characterized by undifferentiated bone-marrow progenitor cells dominating the bone marrow. Currently the five-year survival rate for AML patients is 27.4 percent. Meanwhile the standard of care for most AML patients has not changed for nearly 50 years. We now know that AML is a genetically heterogeneous disease and therefore it is unlikely that all AML patients will respond to therapy the same way. Upregulation of protein-tyrosine kinase signaling pathways is one common feature of some AML tumors, offering opportunities for targeted therapy.
    [Show full text]
  • Inhibition of Src Family Kinases and Receptor Tyrosine Kinases by Dasatinib: Possible Combinations in Solid Tumors
    Published OnlineFirst June 13, 2011; DOI: 10.1158/1078-0432.CCR-10-2616 Clinical Cancer Molecular Pathways Research Inhibition of Src Family Kinases and Receptor Tyrosine Kinases by Dasatinib: Possible Combinations in Solid Tumors Juan Carlos Montero1, Samuel Seoane1, Alberto Ocaña2,3, and Atanasio Pandiella1 Abstract Dasatinib is a small molecule tyrosine kinase inhibitor that targets a wide variety of tyrosine kinases implicated in the pathophysiology of several neoplasias. Among the most sensitive dasatinib targets are ABL, the SRC family kinases (SRC, LCK, HCK, FYN, YES, FGR, BLK, LYN, and FRK), and the receptor tyrosine kinases c-KIT, platelet-derived growth factor receptor (PDGFR) a and b, discoidin domain receptor 1 (DDR1), c-FMS, and ephrin receptors. Dasatinib inhibits cell duplication, migration, and invasion, and it triggers apoptosis of tumoral cells. As a consequence, dasatinib reduces tumoral mass and decreases the metastatic dissemination of tumoral cells. Dasatinib also acts on the tumoral microenvironment, which is particularly important in the bone, where dasatinib inhibits osteoclastic activity and favors osteogenesis, exerting a bone-protecting effect. Several preclinical studies have shown that dasatinib potentiates the antitumoral action of various drugs used in the oncology clinic, paving the way for the initiation of clinical trials of dasatinib in combination with standard-of-care treatments for the therapy of various neoplasias. Trials using combinations of dasatinib with ErbB/HER receptor antagonists are being explored in breast, head and neck, and colorectal cancers. In hormone receptor–positive breast cancer, trials using combina- tions of dasatinib with antihormonal therapies are ongoing. Dasatinib combinations with chemother- apeutic agents are also under development in prostate cancer (dasatinib plus docetaxel), melanoma (dasatinib plus dacarbazine), and colorectal cancer (dasatinib plus oxaliplatin plus capecitabine).
    [Show full text]
  • Second Generation Inhibitors of BCR- ABL for the Treatment of Imatinib- Resistant Chronic Myeloid Leukaemia
    REVIEWS Second generation inhibitors of BCR- ABL for the treatment of imatinib- resistant chronic myeloid leukaemia Ellen Weisberg*, Paul W. Manley‡, Sandra W. Cowan-Jacob§, Andreas Hochhaus|| and James D. Griffin¶ Abstract | Imatinib, a small-molecule ABL kinase inhibitor, is a highly effective therapy for early-phase chronic myeloid leukaemia (CML), which has constitutively active ABL kinase activity owing to the expression of the BCR-ABL fusion protein. However, there is a high relapse rate among advanced- and blast-crisis-phase patients owing to the development of mutations in the ABL kinase domain that cause drug resistance. Several second-generation ABL kinase inhibitors have been or are being developed for the treatment of imatinib- resistant CML. Here, we describe the mechanism of action of imatinib in CML, the structural basis of imatinib resistance, and the potential of second-generation BCR-ABL inhibitors to circumvent resistance. The BCR-ABL oncogene, which is the product of the design of new drugs to circumvent resistance, and Philadelphia chromosome (Ph) 22q, encodes a chimeric several new agents have been developed specifically BCR-ABL protein that has constitutively activated ABL for this purpose. These compounds have been well tyrosine kinase activity; it is the underlying cause of characterized for efficacy against the mutant enzymes chronic myeloid leukaemia (CML)1–3. Whereas the 210 in preclinical studies, and impressive therapeutic activ- kDa BCR-ABL protein is expressed in patients with ity has now been reported for two second generation CML, a 190 kDa BCR-ABL protein, resulting from an drugs in phase I and II clinical trials in patients with *Dana Farber Cancer alternative breakpoint in the BCR gene, is expressed in imatinib-resistant CML.
    [Show full text]
  • Supplementary Table 1. in Vitro Side Effect Profiling Study for LDN/OSU-0212320. Neurotransmitter Related Steroids
    Supplementary Table 1. In vitro side effect profiling study for LDN/OSU-0212320. Percent Inhibition Receptor 10 µM Neurotransmitter Related Adenosine, Non-selective 7.29% Adrenergic, Alpha 1, Non-selective 24.98% Adrenergic, Alpha 2, Non-selective 27.18% Adrenergic, Beta, Non-selective -20.94% Dopamine Transporter 8.69% Dopamine, D1 (h) 8.48% Dopamine, D2s (h) 4.06% GABA A, Agonist Site -16.15% GABA A, BDZ, alpha 1 site 12.73% GABA-B 13.60% Glutamate, AMPA Site (Ionotropic) 12.06% Glutamate, Kainate Site (Ionotropic) -1.03% Glutamate, NMDA Agonist Site (Ionotropic) 0.12% Glutamate, NMDA, Glycine (Stry-insens Site) 9.84% (Ionotropic) Glycine, Strychnine-sensitive 0.99% Histamine, H1 -5.54% Histamine, H2 16.54% Histamine, H3 4.80% Melatonin, Non-selective -5.54% Muscarinic, M1 (hr) -1.88% Muscarinic, M2 (h) 0.82% Muscarinic, Non-selective, Central 29.04% Muscarinic, Non-selective, Peripheral 0.29% Nicotinic, Neuronal (-BnTx insensitive) 7.85% Norepinephrine Transporter 2.87% Opioid, Non-selective -0.09% Opioid, Orphanin, ORL1 (h) 11.55% Serotonin Transporter -3.02% Serotonin, Non-selective 26.33% Sigma, Non-Selective 10.19% Steroids Estrogen 11.16% 1 Percent Inhibition Receptor 10 µM Testosterone (cytosolic) (h) 12.50% Ion Channels Calcium Channel, Type L (Dihydropyridine Site) 43.18% Calcium Channel, Type N 4.15% Potassium Channel, ATP-Sensitive -4.05% Potassium Channel, Ca2+ Act., VI 17.80% Potassium Channel, I(Kr) (hERG) (h) -6.44% Sodium, Site 2 -0.39% Second Messengers Nitric Oxide, NOS (Neuronal-Binding) -17.09% Prostaglandins Leukotriene,
    [Show full text]
  • Antigen Receptor Signaling: Integration of Protein Tyrosine Kinase Functions
    Oncogene (1998) 17, 1353 ± 1364 1998 Stockton Press All rights reserved 0950 ± 9232/98 $12.00 http://www.stockton-press.co.uk/onc Antigen receptor signaling: integration of protein tyrosine kinase functions Idan Tamir1 and John C Cambier1 1Division of Basic Sciences, Department of Pediatrics, National Jewish Medical and Research Center, 1400 Jackson Street, Denver, Colorado 80206, USA Antigen receptors on T and B cells function to processing and presentation to T cells, and to transduce signals leading to a variety of biologic transduce signals that lead to multiple, often alter- responses minimally including antigen receptor editing, native responses. This receptor, termed the B cell apoptotic death, developmental progression, cell activa- antigen receptor (BCR), belongs to the family of tion, proliferation and survival. The response to antigen Multichain Immune Recognition Receptors (MIRR), depends upon antigen anity and valence, involvement which includes the T cell receptor (TCR) and receptors of coreceptors in signaling and dierentiative stage of for the Fc portions of IgG (FcgRI, FcgRIIA, FcgRIIC, the responding cell. The requirement that these FcgRIIIA) and IgE (FceRI). Common to this family of receptors integrate signals that drive an array of receptors is an oligomeric structure which uses dierent responses may explain their evolved structural complex- membrane-spanning subunits for the purpose of ity. Antigen receptors are composed of multiple subunits antigen/Ig recognition vs signal transduction. The compartmentalized to provide antigen recognition and BCR is comprised of a membrane-associated form of signal transduction function. In lieu of on-board immunoglobulin (mIg), noncovalently associated with enzymatic activity these receptors rely on associated a disul®de linked CD79a/CD79b heterodimer (Figure Protein Tyrosine Kinases (PTKs) for their signaling 1) (for review see Cambier, 1995a; Gold and function.
    [Show full text]
  • The Genetics of Bipolar Disorder
    Molecular Psychiatry (2008) 13, 742–771 & 2008 Nature Publishing Group All rights reserved 1359-4184/08 $30.00 www.nature.com/mp FEATURE REVIEW The genetics of bipolar disorder: genome ‘hot regions,’ genes, new potential candidates and future directions A Serretti and L Mandelli Institute of Psychiatry, University of Bologna, Bologna, Italy Bipolar disorder (BP) is a complex disorder caused by a number of liability genes interacting with the environment. In recent years, a large number of linkage and association studies have been conducted producing an extremely large number of findings often not replicated or partially replicated. Further, results from linkage and association studies are not always easily comparable. Unfortunately, at present a comprehensive coverage of available evidence is still lacking. In the present paper, we summarized results obtained from both linkage and association studies in BP. Further, we indicated new potential interesting genes, located in genome ‘hot regions’ for BP and being expressed in the brain. We reviewed published studies on the subject till December 2007. We precisely localized regions where positive linkage has been found, by the NCBI Map viewer (http://www.ncbi.nlm.nih.gov/mapview/); further, we identified genes located in interesting areas and expressed in the brain, by the Entrez gene, Unigene databases (http://www.ncbi.nlm.nih.gov/entrez/) and Human Protein Reference Database (http://www.hprd.org); these genes could be of interest in future investigations. The review of association studies gave interesting results, as a number of genes seem to be definitively involved in BP, such as SLC6A4, TPH2, DRD4, SLC6A3, DAOA, DTNBP1, NRG1, DISC1 and BDNF.
    [Show full text]