DOCSLIB.ORG

Molecular and Systemic Functions of the Vertebrate-Specific

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Molecular and Systemic Functions of the Vertebrate-Specific MOLECULAR AND SYSTEMIC FUNCTIONS OF THE VERTEBRATE-SPECIFIC TATA-BINDING PROTEIN N TERMINUS by Olivier Lucas A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Veterinary Molecular Biology MONTANA STATE UNIVERSITY Bozeman, Montana March 2009 ©COPYRIGHT by Olivier Lucas 2009 All Rights Reserved I ii APPROVAL of a dissertation submitted by Olivier Lucas This dissertation has been read by each member of the dissertation committee and has been found to be satisfactory regarding content, English usage, format, citation, bibliographic style, and consistency, and is ready for submission to the Division of Graduate Education. Dr. Edward E. Schmidt Approved for the Department of Veterinary Molecular Biology Dr. Mark Quinn Approved for the Division of Graduate Education Dr. Carl A. Fox I iii STATEMENT OF PERMISSION TO USE In presenting this dissertation in partial fulfillment of the requirements for a doctoral degree at Montana State University, I agree that the Library shall make it available to borrowers under rules of the Library. I further agree that copying of this dissertation is allowable only for scholarly purposes, consistent with “fair use” as prescribed in the U.S. Copyright Law. Requests for extensive copying or reproduction of this dissertation should be referred to ProQuest Information and Learning, 300 North Zeeb Road, Ann Arbor, Michigan 48106, to whom I have granted “the exclusive right to reproduce and distribute my dissertation in and from microform along with the non- exclusive right to reproduce and distribute my abstract in any format in whole or in part.” Olivier Lucas March 2009 I iv ACKNOWLEDGEMENTS First, I would like to thank my parents for providing me moral and financial supports during my studies. They have always encouraged me in my endeavors. In addition, I am lucky to have such a fantastic wife, encouraging me and supporting me through rough seas. I don’t know if I would have made it without her. I came to Bozeman determined to learn about the molecular biology toolbox. For this Ph.D. thesis, I felt that I had the most exciting possible project. I am thankful to my advisor, Dr. Ed Schmidt, to have handed me out such a fantastic study. Dr. Schmidt’s love and dedication for science have been contagious. That study could not have been performed without my labmates and collaborators. I am especially thankful to Dr. Justin Prigge and Dr. Elena Suvorova. Alla Bondareva was and will be a reference to me. Tedious genotyping required the help of Sonya Iverson, Marie-Clare Rollins, Ashley Siders, Stephanie Wallin and Carla Weisend. Gayle Callis has been of great help for histological procedures. My gratitude goes toward Jean Kundert for managing our mice colonies and helping me on whole animal procedures anytime I needed it. I feel honored to have generated mutant mice in collaboration with Dr. Mario Capecchi, Nobel Prize of Physiology or Medicine 2007. I am very thankful to Dr. Valérie Copié for her help, encouragements and availability. I am thankful to all my committee members: Dr. Valérie Copié, Dr. Mark Jutila, Dr. Adam Richman, Dr. Michael White and Dr. John Paxton, for their critical comments over the years. I v TABLE OF CONTENTS 1. MOLECULAR ORIGINS OF VERTEBRATE INNOVATIONS ................................ 1 Introduction .................................................................................................................... 1 Canonical Markers ......................................................................................................... 4 Overview ............................................................................................................ 4 Neural Crest Cells .............................................................................................. 4 Placodes.............................................................................................................. 7 Brain ................................................................................................................. 10 Vertebrate Specializations ............................................................................................ 14 Cartilage, Bone, and Teeth in Relation to Predation ........................................ 14 Ear .................................................................................................................... 15 Pharyngeal Arches ........................................................................................... 18 Pharynx Derived Organs .................................................................................. 19 Thyroid ........................................................................................................ 19 Pituitary ....................................................................................................... 20 Pancreas............................................................................................................ 21 Eye.................................................................................................................... 22 Multichambered Heart ..................................................................................... 23 Circulatory System and Endothelial Cells ....................................................... 26 The Adaptive Immune System ......................................................................... 28 Morphological Asymmetry .............................................................................. 30 Liver ................................................................................................................. 32 Novel Molecules .............................................................................................. 33 Steroid Hormones ........................................................................................ 33 Fibrillar Collagen ........................................................................................ 34 Genome Complexity .................................................................................................... 35 Evidence of New Vertebrate-Specific Domains and Proteins ......................... 35 Role of Duplication: .................................................................................... 36 Exonization: ................................................................................................ 38 Alternative and Atypical Splicing: .............................................................. 39 Transposition Events: .................................................................................. 39 Influence of Duplication on PPI Network ........................................................ 39 CRE Duplication and Subfunctionalization ..................................................... 40 Copy Number Variation ................................................................................... 41 MicroRNA ....................................................................................................... 41 Conclusion ................................................................................................................... 42 2. INTRODUCTION ....................................................................................................... 45 Evolutionary Perspectives on Transcriptional Regulation ........................................... 45 Intrinsic Protein Disorder and the TBP N terminus ..................................................... 48 I vi TABLE OF CONTENTS - CONTINUED Function of the TBP N Terminus ................................................................................. 52 Knowledge From the tbp ∆N/ ∆N Mice ............................................................................. 53 3. CO-EVOLUTION OF PITX TRANSCRIPTION FACTORS WITH TBP IN METAZOANS .................................................................................... 56 Introduction .................................................................................................................. 56 Materials and Methods ................................................................................................. 61 Yeast Two-Hybrid ............................................................................................ 61 Isolation of Orthologous cDNAs and Interaction Mapping Tests ................... 64 Mouse Embryonic Fibroblast Isolation and Transfection ................................ 65 RT-PCR and RNase Protection Assays ........................................................... 65 Whole Mount In Situ Hybridization ................................................................ 65 Results .......................................................................................................................... 66 Identification of TBP-Interacting Proteins ....................................................... 66 mPitx2 is a TBP-Binding Protein ..................................................................... 72 The TBP-Pitx Interaction Involves the Metazoan-Specific Domain of TBP ... 74 TBP-N Attenuates Pitx2-Dependent Transcription Activation........................ 76 The TBP Phyla-Specific Region is involved in Nppa Regulation in vivo ....... 79 Discussion .................................................................................................................... 82 Summary .......................................................................................................... 82 Implications .....................................................................................................
Load more

Recommended publications
  • Genome-Wide Analysis of 5-Hmc in the Peripheral Blood of Systemic Lupus Erythematosus Patients Using an Hmedip-Chip
    INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 35: 1467-1479, 2015 Genome-wide analysis of 5-hmC in the peripheral blood of systemic lupus erythematosus patients using an hMeDIP-chip WEIGUO SUI1*, QIUPEI TAN1*, MING YANG1, QIANG YAN1, HUA LIN1, MINGLIN OU1, WEN XUE1, JIEJING CHEN1, TONGXIANG ZOU1, HUANYUN JING1, LI GUO1, CUIHUI CAO1, YUFENG SUN1, ZHENZHEN CUI1 and YONG DAI2 1Guangxi Key Laboratory of Metabolic Diseases Research, Central Laboratory of Guilin 181st Hospital, Guilin, Guangxi 541002; 2Clinical Medical Research Center, the Second Clinical Medical College of Jinan University (Shenzhen People's Hospital), Shenzhen, Guangdong 518020, P.R. China Received July 9, 2014; Accepted February 27, 2015 DOI: 10.3892/ijmm.2015.2149 Abstract. Systemic lupus erythematosus (SLE) is a chronic, Introduction potentially fatal systemic autoimmune disease characterized by the production of autoantibodies against a wide range Systemic lupus erythematosus (SLE) is a typical systemic auto- of self-antigens. To investigate the role of the 5-hmC DNA immune disease, involving diffuse connective tissues (1) and modification with regard to the onset of SLE, we compared is characterized by immune inflammation. SLE has a complex the levels 5-hmC between SLE patients and normal controls. pathogenesis (2), involving genetic, immunologic and envi- Whole blood was obtained from patients, and genomic DNA ronmental factors. Thus, it may result in damage to multiple was extracted. Using the hMeDIP-chip analysis and valida- tissues and organs, especially the kidneys (3). SLE arises from tion by quantitative RT-PCR (RT-qPCR), we identified the a combination of heritable and environmental influences. differentially hydroxymethylated regions that are associated Epigenetics, the study of changes in gene expression with SLE.
    [Show full text]
  • The Rise and Fall of the Bovine Corpus Luteum
    University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Spring 5-6-2017 The Rise and Fall of the Bovine Corpus Luteum Heather Talbott University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Part of the Biochemistry Commons, Molecular Biology Commons, and the Obstetrics and Gynecology Commons Recommended Citation Talbott, Heather, "The Rise and Fall of the Bovine Corpus Luteum" (2017). Theses & Dissertations. 207. https://digitalcommons.unmc.edu/etd/207 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. THE RISE AND FALL OF THE BOVINE CORPUS LUTEUM by Heather Talbott A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Biochemistry and Molecular Biology Graduate Program Under the Supervision of Professor John S. Davis University of Nebraska Medical Center Omaha, Nebraska May, 2017 Supervisory Committee: Carol A. Casey, Ph.D. Andrea S. Cupp, Ph.D. Parmender P. Mehta, Ph.D. Justin L. Mott, Ph.D. i ACKNOWLEDGEMENTS This dissertation was supported by the Agriculture and Food Research Initiative from the USDA National Institute of Food and Agriculture (NIFA) Pre-doctoral award; University of Nebraska Medical Center Graduate Student Assistantship; University of Nebraska Medical Center Exceptional Incoming Graduate Student Award; the VA Nebraska-Western Iowa Health Care System Department of Veterans Affairs; and The Olson Center for Women’s Health, Department of Obstetrics and Gynecology, Nebraska Medical Center.
    [Show full text]
  • Genome-Wide Analysis Reveals Selection Signatures Involved in Meat Traits and Local Adaptation in Semi-Feral Maremmana Cattle
    Genome-Wide Analysis Reveals Selection Signatures Involved in Meat Traits and Local Adaptation in Semi-Feral Maremmana Cattle Slim Ben-Jemaa, Gabriele Senczuk, Elena Ciani, Roberta Ciampolini, Gennaro Catillo, Mekki Boussaha, Fabio Pilla, Baldassare Portolano, Salvatore Mastrangelo To cite this version: Slim Ben-Jemaa, Gabriele Senczuk, Elena Ciani, Roberta Ciampolini, Gennaro Catillo, et al.. Genome-Wide Analysis Reveals Selection Signatures Involved in Meat Traits and Local Adaptation in Semi-Feral Maremmana Cattle. Frontiers in Genetics, Frontiers, 2021, 10.3389/fgene.2021.675569. hal-03210766 HAL Id: hal-03210766 https://hal.inrae.fr/hal-03210766 Submitted on 28 Apr 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution| 4.0 International License ORIGINAL RESEARCH published: 28 April 2021 doi: 10.3389/fgene.2021.675569 Genome-Wide Analysis Reveals Selection Signatures Involved in Meat Traits and Local Adaptation in Semi-Feral Maremmana Cattle Slim Ben-Jemaa 1, Gabriele Senczuk 2, Elena Ciani 3, Roberta
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Supplementary Materials
    1 Supplementary Materials: Supplemental Figure 1. Gene expression profiles of kidneys in the Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice. (A) A heat map of microarray data show the genes that significantly changed up to 2 fold compared between Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice (N=4 mice per group; p<0.05). Data show in log2 (sample/wild-type). 2 Supplemental Figure 2. Sting signaling is essential for immuno-phenotypes of the Fcgr2b-/-lupus mice. (A-C) Flow cytometry analysis of splenocytes isolated from wild-type, Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice at the age of 6-7 months (N= 13-14 per group). Data shown in the percentage of (A) CD4+ ICOS+ cells, (B) B220+ I-Ab+ cells and (C) CD138+ cells. Data show as mean ± SEM (*p < 0.05, **p<0.01 and ***p<0.001). 3 Supplemental Figure 3. Phenotypes of Sting activated dendritic cells. (A) Representative of western blot analysis from immunoprecipitation with Sting of Fcgr2b-/- mice (N= 4). The band was shown in STING protein of activated BMDC with DMXAA at 0, 3 and 6 hr. and phosphorylation of STING at Ser357. (B) Mass spectra of phosphorylation of STING at Ser357 of activated BMDC from Fcgr2b-/- mice after stimulated with DMXAA for 3 hour and followed by immunoprecipitation with STING. (C) Sting-activated BMDC were co-cultured with LYN inhibitor PP2 and analyzed by flow cytometry, which showed the mean fluorescence intensity (MFI) of IAb expressing DC (N = 3 mice per group). 4 Supplemental Table 1. Lists of up and down of regulated proteins Accession No.
    [Show full text]
  • Comparative Analysis of a Teleost Skeleton Transcriptome Provides Insight Into Its Regulation
    Accepted Manuscript Comparative analysis of a teleost skeleton transcriptome provides insight into its regulation Florbela A. Vieira, M.A.S. Thorne, K. Stueber, M. Darias, R. Reinhardt, M.S. Clark, E. Gisbert, D.M. Power PII: S0016-6480(13)00264-5 DOI: http://dx.doi.org/10.1016/j.ygcen.2013.05.025 Reference: YGCEN 11541 To appear in: General and Comparative Endocrinology Please cite this article as: Vieira, F.A., Thorne, M.A.S., Stueber, K., Darias, M., Reinhardt, R., Clark, M.S., Gisbert, E., Power, D.M., Comparative analysis of a teleost skeleton transcriptome provides insight into its regulation, General and Comparative Endocrinology (2013), doi: http://dx.doi.org/10.1016/j.ygcen.2013.05.025 This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain. 1 Comparative analysis of a teleost skeleton transcriptome 2 provides insight into its regulation 3 4 Florbela A. Vieira1§, M. A. S. Thorne2, K. Stueber3, M. Darias4,5, R. Reinhardt3, M. 5 S. Clark2, E. Gisbert4 and D. M. Power1 6 7 1Center of Marine Sciences, Universidade do Algarve, Faro, Portugal. 8 2British Antarctic Survey – Natural Environment Research Council, High Cross, 9 Madingley Road, Cambridge, CB3 0ET, UK.
    [Show full text]
  • Transcriptional Control of Tissue-Resident Memory T Cell Generation
    Transcriptional control of tissue-resident memory T cell generation Filip Cvetkovski Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2019 © 2019 Filip Cvetkovski All rights reserved ABSTRACT Transcriptional control of tissue-resident memory T cell generation Filip Cvetkovski Tissue-resident memory T cells (TRM) are a non-circulating subset of memory that are maintained at sites of pathogen entry and mediate optimal protection against reinfection. Lung TRM can be generated in response to respiratory infection or vaccination, however, the molecular pathways involved in CD4+TRM establishment have not been defined. Here, we performed transcriptional profiling of influenza-specific lung CD4+TRM following influenza infection to identify pathways implicated in CD4+TRM generation and homeostasis. Lung CD4+TRM displayed a unique transcriptional profile distinct from spleen memory, including up-regulation of a gene network induced by the transcription factor IRF4, a known regulator of effector T cell differentiation. In addition, the gene expression profile of lung CD4+TRM was enriched in gene sets previously described in tissue-resident regulatory T cells. Up-regulation of immunomodulatory molecules such as CTLA-4, PD-1, and ICOS, suggested a potential regulatory role for CD4+TRM in tissues. Using loss-of-function genetic experiments in mice, we demonstrate that IRF4 is required for the generation of lung-localized pathogen-specific effector CD4+T cells during acute influenza infection. Influenza-specific IRF4−/− T cells failed to fully express CD44, and maintained high levels of CD62L compared to wild type, suggesting a defect in complete differentiation into lung-tropic effector T cells.
    [Show full text]
  • Molecular Mechanisms Regulating Mammalian Forebrain Development
    Molecular Mechanisms Regulating Mammalian Forebrain Development By David Chun Cheong Tsui A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Institute of Medical Science University of Toronto © Copyright by David Chun Cheong Tsui (2013) Title: Molecular Mechanisms Regulating Mammalian Forebrain Development Name: David Chun Cheong Tsui Degree: Doctor of Philosophy, 2013 Department: Institute of Medical Sciences, University of Toronto ABSTRACT While the extrinsic factors regulating neurogenesis in the developing forebrain have been widely studied, the mechanisms downstream of the various signaling pathways are relatively ill-defined. In particular, we focused on proteins that have been implicated in cognitive dysfunction. Here, we ask what role two cell intrinsic factors play in the development of two different neurogenic compartments in the forebrain. In the first part of the thesis, the transcription factor FoxP2, which is mutated in individuals who have specific language deficits, was identified to regulate neurogenesis in the developing cortex, in part by regulating the transition from the radial precursors to the transit amplifying intermediate progenitors. Moreover, we found that ectopic expression of the human homologue of the protein promotes neurogenesis in the murine cortex, thereby acting as a gain-of-function isoform. In the second part of the thesis, the histone acetyltransferase CREB-binding protein (CBP) was identified as regulating the generation of neurons from medial ganglionic eminence precursors, similar to its role in the developing cortex. But CBP also plays a more substantial role in the expression of late interneuron markers, suggesting that it is continuously required for the various stages of neurogenesis at least in the ventral neurogenic niche.
    [Show full text]
  • Downloaded from USCS Tables (
    bioRxiv preprint doi: https://doi.org/10.1101/318329; this version posted February 4, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. The selection arena in early human blastocysts resolves the pluripotent inner cell mass Manvendra Singh1, Thomas J. Widmann2, Vikas Bansal7, Jose L. Cortes2, Gerald G. Schumann3, Stephanie Wunderlich4, Ulrich Martin4, Marta Garcia-Canadas2, Jose L. Garcia- Perez2,5*, Laurence D. Hurst6*#, Zsuzsanna Izsvák1* 1 Max-Delbrück-Center for Molecular Medicine in the Helmholtz Society, Robert-Rössle- Strasse 10, 13125 Berlin, Germany. 2 GENYO. Centre for Genomics and Oncological Research: Pfizer/University of Granada/Andalusian Regional Government, PTS Granada, 18016 Granada, Spain. 3 Paul-Ehrlich-Institute, Division of Medical Biotechnology, Paul-Ehrlich-Strasse 51-59, 63225 Langen, Germany. 4Center for Regenerative Medicine Hannover Medical School (MHH) Carl-Neuberg-Str.1, Building J11, D-30625 Hannover, Germany 5Institute of Genetics and Molecular Medicine (IGMM), University of Edinburgh, Crewe Road, Edinburgh EH4 2XU, United Kingdom 6 The Milner Centre for Evolution, Department of Biology and Biochemistry, University of Bath, Bath, Somerset, UK, BA2 7AY. 7 Institute of Medical Systems Biology, Center for Molecular Neurobiology (ZMNH), University Medical Center Hamburg-Eppendorf (UKE), 20246, Hamburg, Germany. *Corresponding authors *Zsuzsanna Izsvák Max Delbrück Center for Molecular Medicine Robert Rössle Strasse 10, 13092 Berlin, Germany Telefon: +49 030-9406-3510 Fax: +49 030-9406-2547 email: [email protected] http://www.mdcberlin.de/en/research/research_teams/mobile_dna/index.html and *Laurence D.
    [Show full text]
  • Chromosomal Rearrangements Are Commonly Post-Transcriptionally Attenuated in Cancer
    bioRxiv preprint doi: https://doi.org/10.1101/093369; this version posted February 1, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Chromosomal rearrangements are commonly post-transcriptionally attenuated in cancer 1 3 1 3, 4, 5 Emanuel Gonçalves ,​ Athanassios Fragoulis ,​ Luz Garcia-Alonso ,​ Thorsten Cramer ,​ ​ ​ ​ ​ 1,2# 1# Julio Saez-Rodriguez ,​ Pedro Beltrao ​ ​ 1 ​ European Molecular Biology Laboratory, European Bioinformatics Institute (EMBL-EBI), Wellcome Genome Campus, Cambridge CB10 1SD, UK 2 ​ RWTH Aachen University, Faculty of Medicine, Joint Research Centre for Computational Biomedicine, Aachen 52057, Germany 3 ​ Molecular Tumor Biology, Department of General, Visceral and Transplantation Surgery, RWTH University Hospital, Pauwelsstraße 30, 52074 Aachen, Germany 4 ​ NUTRIM School of Nutrition and Translational Research in Metabolism, Maastricht University, Maastricht, The Netherlands 5 ​ ESCAM – European Surgery Center Aachen Maastricht, Germany and The Netherlands # ​ co-last authors: [email protected]; [email protected] ​ ​ ​ Running title: Chromosomal rearrangement attenuation in cancer Keywords: Cancer; Gene dosage; Proteomics; Copy-number variation; Protein complexes 1 bioRxiv preprint doi: https://doi.org/10.1101/093369; this version posted February 1, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Abstract Chromosomal rearrangements, despite being detrimental, are ubiquitous in cancer and often act as driver events.
    [Show full text]
  • Product Datasheet Qprest
    Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST TMM98 Mass Spectrometry Protein Standard Product Number QPrEST39234 Protein Name Transmembrane protein 98 Uniprot ID Q9Y2Y6 Gene TMEM98 Product Description Stable isotope-labeled standard for absolute protein quantification of Transmembrane protein 98. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding CRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVITNPHIEA fusion tag) ILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVS Theoretical MW 28997 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
    [Show full text]
  • Transposable Elements and Teleost Migratory Behaviour
    International Journal of Molecular Sciences Article Transposable Elements and Teleost Migratory Behaviour Elisa Carotti 1,†, Federica Carducci 1,†, Adriana Canapa 1, Marco Barucca 1,* , Samuele Greco 2 , Marco Gerdol 2 and Maria Assunta Biscotti 1 1 Department of Life and Environmental Sciences, Polytechnic University of Marche, Via Brecce Bianche, 60131 Ancona, Italy; [email protected] (E.C.); [email protected] (F.C.); [email protected] (A.C.); [email protected] (M.A.B.) 2 Department of Life Sciences, University of Trieste, Via L. Giorgieri, 5-34127 Trieste, Italy; [email protected] (S.G.); [email protected] (M.G.) * Correspondence: [email protected] † Equal contribution. Abstract: Transposable elements (TEs) represent a considerable fraction of eukaryotic genomes, thereby contributing to genome size, chromosomal rearrangements, and to the generation of new coding genes or regulatory elements. An increasing number of works have reported a link between the genomic abundance of TEs and the adaptation to specific environmental conditions. Diadromy represents a fascinating feature of fish, protagonists of migratory routes between marine and fresh- water for reproduction. In this work, we investigated the genomes of 24 fish species, including 15 teleosts with a migratory behaviour. The expected higher relative abundance of DNA transposons in ray-finned fish compared with the other fish groups was not confirmed by the analysis of the dataset considered. The relative contribution of different TE types in migratory ray-finned species did not show clear differences between oceanodromous and potamodromous fish. On the contrary, a remarkable relationship between migratory behaviour and the quantitative difference reported for short interspersed nuclear (retro)elements (SINEs) emerged from the comparison between anadro- mous and catadromous species, independently from their phylogenetic position.
    [Show full text]