Genetic Regulation of Neuronal Progranulin Reveals a Critical Role for the Autophagy-Lysosome Pathway

Total Page:16

File Type:pdf, Size:1020Kb

Genetic Regulation of Neuronal Progranulin Reveals a Critical Role for the Autophagy-Lysosome Pathway This Accepted Manuscript has not been copyedited and formatted. The final version may differ from this version. Research Articles: Neurobiology of Disease Genetic Regulation of Neuronal Progranulin Reveals a Critical Role for the Autophagy-Lysosome Pathway Lisa P. Elia1,2, Amanda R. Mason3, Amela Alijagic2 and Steven Finkbeiner1,2,4 1Center for Systems and Therapeutics and Taube/Koret Center for Neurodegenerative Disease Research, San Francisco, CA 2The J. David Gladstone Institutes, San Francisco, CA 3Keck School of Medicine of USC, Los Angeles, CA 4Departments of Neurology and Physiology, UCSF, San Francisco, CA https://doi.org/10.1523/JNEUROSCI.3498-17.2019 Received: 23 March 2018 Revised: 16 January 2019 Accepted: 16 January 2019 Published: 29 January 2019 Author contributions: L.P.E. designed research; L.P.E. and A.A. performed research; L.P.E. analyzed data; L.P.E. wrote the first draft of the paper; L.P.E., A.R.M., and S.F. edited the paper; L.P.E. wrote the paper. Conflict of Interest: The authors declare that they have no conflicts of interest with the contents of this article. The content is solely the responsibility of the authors and does not necessarily represent the official views of the National Institutes of Health. We thank Robert V. Farese (Harvard Medical School), Andrew D. Nguyen (Harvard Medical School), and Ping Zhou (Gladstone Institute of Cardiovascular Disease) for kindly providing the GRN+/- and GRNR493X/+ mice, and the progranulin rabbit polyclonal antibody. Psammaplysene A (PSA) was a gift from R.G. Kalb (Mojsilovic- Petrovic et al., 2009). We thank Laura Mitic (UCSF), and members of the Finkbeiner lab for discussion and comments on these experiments. We thank Megan Laurance (UCSF) for assistance with Ingenuity Pathway Analysis. We also thank Hui Wang for animal husbandry, Gary Howard for editorial assistance, and Kelley Nelson for administrative assistance. Study funding: 1R21NS093236-01A1, 1P01AG054407, 1RF1AG058476, the Consortium for Frontotemporal Dementia Research, the Taube/Koret Center for Neurodegenerative Disease Research, and the J. David Gladstone Institutes. The Gladstone Institutes received support from a National Center for Research Resources Grant RR18928. Corresponding authors: Lisa P. Elia and Steven Finkbeiner, Gladstone Institutes, 1650 Owens St., San Francisco, California 94158, Telephone: (415) 734-2508; FAX: (415) 355-0824; E-mail: [email protected], [email protected] Cite as: J. Neurosci 2019; 10.1523/JNEUROSCI.3498-17.2019 Alerts: Sign up at www.jneurosci.org/alerts to receive customized email alerts when the fully formatted version of this article is published. Accepted manuscripts are peer-reviewed but have not been through the copyediting, formatting, or proofreading process. Copyright © 2019 the authors 1 Genetic Regulation of Neuronal Progranulin Reveals a Critical Role for the 2 Autophagy-Lysosome Pathway 3 Abbreviated title: Genetic modulators of neuronal progranulin levels 4 5 Author names and affiliations: 6 Lisa P. Elia*1,2, Amanda R. Mason3, Amela Alijagic 2, Steven Finkbeiner*1,2,4 7 8 9 1 Center for Systems and Therapeutics and Taube/Koret Center for Neurodegenerative 10 Disease Research, San Francisco, CA 11 2 The J. David Gladstone Institutes, San Francisco, CA 12 3 Keck School of Medicine of USC, Los Angeles, CA 13 4 Departments of Neurology and Physiology, UCSF, San Francisco, CA 14 15 *Corresponding authors: 16 Lisa P. Elia and Steven Finkbeiner, Gladstone Institutes, 1650 Owens St., San 17 Francisco, California 94158, Telephone: (415) 734-2508; FAX: (415) 355-0824; E-mail: 18 [email protected], [email protected] 19 Number of pages: 46 20 Number of figures: primary figures (8), extended data figures (3), tables (2) 21 Number of words: Abstract (207), Significance Statement (120), Introduction (941), 22 Discussion (836) 23 1 24 Conflict of interest: The authors declare that they have no conflicts of interest with the 25 contents of this article. The content is solely the responsibility of the authors and does 26 not necessarily represent the official views of the National Institutes of Health. 27 28 Acknowledgments: We thank Robert V. Farese (Harvard Medical School), Andrew D. 29 Nguyen (Harvard Medical School), and Ping Zhou (Gladstone Institute of 30 Cardiovascular Disease) for kindly providing the GRN+/- and GRNR493X/+ mice, and the 31 progranulin rabbit polyclonal antibody. Psammaplysene A (PSA) was a gift from R.G. 32 Kalb (Mojsilovic-Petrovic et al., 2009). We thank Laura Mitic (UCSF), and members of 33 the Finkbeiner lab for discussion and comments on these experiments. We thank 34 Megan Laurance (UCSF) for assistance with Ingenuity Pathway Analysis. We also 35 thank Hui Wang for animal husbandry, Gary Howard for editorial assistance, and Kelley 36 Nelson for administrative assistance. Study funding: 1R21NS093236-01A1, 37 1P01AG054407, 1RF1AG058476, the Consortium for Frontotemporal Dementia 38 Research, the Taube/Koret Center for Neurodegenerative Disease Research, and the J. 39 David Gladstone Institutes. The Gladstone Institutes received support from a National 40 Center for Research Resources Grant RR18928. 41 42 43 44 45 46 2 47 Abstract 48 Deficient progranulin levels cause dose-dependent neurological syndromes: 49 haploinsufficiency leads to frontotemporal lobar degeneration (FTLD), and nullizygosity 50 produces adult-onset neuronal ceroid lipofuscinosis. Mechanisms controlling 51 progranulin levels are largely unknown. To better understand progranulin regulation, we 52 performed a genome-wide RNAi screen using an ELISA-based platform to discover 53 genes that regulate progranulin levels in neurons. We identified 830 genes that raise or 54 lower progranulin levels by at least 1.5-fold in Neuro2a cells. When inhibited by siRNA 55 or some by submicromolar concentrations of small-molecule inhibitors, 33 genes of the 56 druggable genome increased progranulin levels in mouse primary cortical neurons; 57 several of these also raised progranulin levels in FTLD-model mouse neurons. “Hit” 58 genes regulated progranulin by transcriptional or post-transcriptional mechanisms. 59 Pathway analysis revealed enrichment of hit genes from the autophagy-lysosome 60 pathway (ALP), suggesting a key role for this pathway in regulating progranulin levels. 61 Progranulin itself regulates lysosome function. We found progranulin-deficiency in 62 neurons increased autophagy and caused abnormally enlarged lysosomes, and 63 boosting progranulin levels restored autophagy and lysosome size to control levels. Our 64 data link the ALP to neuronal progranulin: progranulin levels are regulated by 65 autophagy, and in turn, progranulin regulates the ALP. Restoring progranulin levels by 66 targeting genetic modifiers reversed FTLD functional deficits, opening up potential 67 opportunities for future therapeutics development. 68 69 3 70 Significance statement 71 Progranulin regulates neuron and immune functions, and is implicated in aging. Loss of 72 one functional allele causes haploinsufficiency and leads to frontotemporal lobar 73 degeneration (FTLD), the second leading cause of dementia. Progranulin gene 74 polymorphisms are linked to Alzheimer’s disease (AD) and complete loss of function 75 causes neuronal ceroid lipofuscinosis. Despite the critical role of progranulin levels in 76 neurodegenerative disease risk, almost nothing is known about their regulation. We 77 performed an unbiased screen and identified specific pathways controlling progranulin 78 levels in neurons. Modulation of these pathways restored levels in progranulin-deficient 79 neurons and reversed FTLD phenotypes. We provide a new comprehensive 80 understanding of the genetic regulation of progranulin levels, and identify potential 81 targets to treat FTLD and other neurodegenerative diseases, including AD. 82 83 Introduction 84 Progranulin is a widely expressed secreted protein encoded by the GRN gene. In the 85 brain, progranulin is expressed primarily by neurons and microglia, involved in neuronal 86 survival, neurite outgrowth, and synaptogenesis, and a key regulator of 87 neuroinflammation (Ahmed et al., 2007; Chitramuthu et al., 2010; Cenik et al., 2012; 88 Gass et al., 2012; Petkau et al., 2012; Petoukhov et al., 2013; Petkau and Leavitt, 89 2014). Over 60 mutations leading to haploinsufficiency of GRN have been identified and 90 result in decreased progranulin levels. People with GRN haploinsufficiency develop the 91 fatal neurodegenerative disease frontotemporal lobar degeneration (FTLD), the second 92 most common cause of early onset dementia after Alzheimer’s disease (AD) (Rabinovici 4 93 and Miller, 2010; Rademakers et al., 2012; Riedl et al., 2014). Rare individuals 94 nullizygous for GRN develop neuronal ceroid lipofuscinosis (NCL), with onset much 95 earlier than FTLD (Smith et al., 2012; Gotzl et al., 2014). Recently, polymorphisms that 96 decrease GRN expression were linked to increased risk for AD, and boosting levels of 97 progranulin in mouse models of AD suppresses neuroinflammatory-, pathological-, and 98 cognitive-based disease phenotypes (Pereson et al., 2009; Hsiung et al., 2011; 99 Kamalainen et al., 2013; Perry et al., 2013; Minami et al., 2014; Chen et al., 2015; 100 Hosokawa et al., 2015; Xu et al., 2016). Thus, differing levels of progranulin deficiency 101 in the brain lead to different neurodegenerative syndromes, showing that loss of 102 progranulin function contributes to disease development. 103 104 Although progranulin
Recommended publications
  • GRN (Human) Recombinant Protein (Q01)
    GRN (Human) Recombinant Protein and PC cell-derived growth factor. Cleavage of the (Q01) signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. Catalog Number: H00002896-Q01 These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are Regulation Status: For research use only (RUO) synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell Product Description: Human GRN partial ORF ( growth. However, different members of the granulin NP_002078, 494 a.a. - 593 a.a.) recombinant protein protein family may act as inhibitors, stimulators, or have with GST-tag at N-terminal. dual actions on cell growth. Granulin family members are important in normal development, wound healing, and Sequence: tumorigenesis. [provided by RefSeq] SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHD NQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGF References: RCAARGTKCLRREAPRWDAPLRDPALRQLL 1. Progranulin Does Not Bind Tumor Necrosis Factor (TNF) Receptors and Is Not a Direct Regulator of Host: Wheat Germ (in vitro) TNF-Dependent Signaling or Bioactivity in Immune or Neuronal Cells. Chen X, Chang J, Deng Q, Xu J, Theoretical MW (kDa): 36.74 Nguyen TA, Martens LH, Cenik B, Taylor G, Hudson KF, Chung J, Yu K, Yu P, Herz J, Farese RV Jr, Kukar T, Applications: AP, Array, ELISA, WB-Re Tansey MG. J Neurosci. 2013 May 22;33(21):9202-13 (See our web site product page for detailed applications 2. The neurotrophic properties of progranulin depend on information) the granulin E domain but do not require sortilin binding. Protocols: See our web site at De Muynck L, Herdewyn S, Beel S, Scheveneels W, Van http://www.abnova.com/support/protocols.asp or product Den Bosch L, Robberecht W, Van Damme P Neurobiol page for detailed protocols Aging.
    [Show full text]
  • Processing of Progranulin Into Granulins Involves Multiple Lysosomal Proteases and Is Affected in Frontotemporal Lobar Degeneration
    Processing of progranulin into granulins involves multiple lysosomal proteases and is affected in frontotemporal lobar degeneration Swetha Mohan University of California San Francisco Paul J. Sampognaro University of California San Francisco Andrea R. Argouarch University of California San Francisco Jason C. Maynard University of California San Francisco Anand Patwardhan University of California San Francisco Emma C. Courtney University of California San Francisco Amanda Mason University of California San Francisco Kathy H. Li University of California San Francisco William W. Seeley University of California San Francisco Bruce L. Miller University of California San Francisco Alma Burlingame University of California San Francisco Mathew P. Jacobson University of California San Francisco Aimee Kao ( [email protected] ) University of California San Francisco https://orcid.org/0000-0002-7686-7968 Research article Keywords: Progranulin, granulin, frontotemporal lobar degeneration, lysosome, protease, pH, asparagine endopeptidase Page 1/31 Posted Date: July 29th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-44128/v2 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Version of Record: A version of this preprint was published at Molecular Neurodegeneration on August 3rd, 2021. See the published version at https://doi.org/10.1186/s13024-021-00472-1. Page 2/31 Abstract Background - Progranulin loss-of-function mutations are linked to frontotemporal lobar degeneration with TDP-43 positive inclusions (FTLD-TDP-Pgrn). Progranulin (PGRN) is an intracellular and secreted pro- protein that is proteolytically cleaved into individual granulin peptides, which are increasingly thought to contribute to FTLD-TDP-Pgrn disease pathophysiology. Intracellular PGRN is processed into granulins in the endo-lysosomal compartments.
    [Show full text]
  • Granulin: an Invasive and Survival-Determining Marker in Colorectal Cancer Patients
    International Journal of Molecular Sciences Article Granulin: An Invasive and Survival-Determining Marker in Colorectal Cancer Patients Fee Klupp 1,*, Christoph Kahlert 2, Clemens Franz 1, Niels Halama 3, Nikolai Schleussner 1, Naita M. Wirsik 4, Arne Warth 5, Thomas Schmidt 1,4 and Alexis B. Ulrich 1,6 1 Department of General, Visceral and Transplantation Surgery, University of Heidelberg, Im Neuenheimer Feld 420, 69120 Heidelberg, Germany; [email protected] (C.F.); [email protected] (N.S.); [email protected] (T.S.); [email protected] (A.B.U.) 2 Department of Visceral, Thoracic and Vascular Surgery, University of Dresden, Fetscherstr. 74, 01307 Dresden, Germany; [email protected] 3 National Center for Tumor Diseases, Medical Oncology and Internal Medicine VI, Tissue Imaging and Analysis Center, Bioquant, University of Heidelberg, Im Neuenheimer Feld 267, 69120 Heidelberg, Germany; [email protected] 4 Department of General, Visceral und Tumor Surgery, University Hospital Cologne, Kerpener Straße 62, 50937 Cologne, Germany; [email protected] 5 Institute of Pathology, University of Heidelberg, Im Neuenheimer Feld 224, 69120 Heidelberg, Germany; [email protected] 6 Department of General and Visceral Surgery, Lukas Hospital Neuss, Preußenstr. 84, 41464 Neuss, Germany * Correspondence: [email protected]; Tel.: +49-6221-566-110; Fax: +49-6221-565-506 Abstract: Background: Granulin is a secreted, glycosylated peptide—originated by cleavage from a precursor protein—which is involved in cell growth, tumor invasion and angiogenesis. However, Citation: Klupp, F.; Kahlert, C.; the specific prognostic impact of granulin in human colorectal cancer has only been studied to a Franz, C.; Halama, N.; Schleussner, limited extent.
    [Show full text]
  • Isolation and Sequence of the Granulin Precursor Cdna from Human Bone
    Proc. Nat!. Acad. Sci. USA Vol. 89, pp. 1715-1719, March 1992 Biochemistry Isolation and sequence of the granulin precursor cDNA from human bone marrow reveals tandem cysteine-rich granulin domains (epithelin/growth factors/kidney/i ion) VIJAY BHANDARI, ROGER G. E. PALFREE, AND ANDREW BATEMAN* Endocrine Laboratory, Royal Victoria Hospital, Department of Medicine, McGill University, Montreal, PQ, H3A lAl, Canada Communicated by Seymour Lieberman, November 15, 1991 (receivedfor review September 17, 1991) ABSTRACT Granulins are candidate growth factors re- mal growth factor (EGF) (14). Some ofthese peptides may be cently discovered in human and rat inflammatory leukocytes involved in initiating or sustaining an inflammatory response and bone marrow. Two granulin homologs, epithelin 1 and 2, (15, 16), in tissue remodeling at the site of a wound by occur in the rat kidney. Epithelin 1, which is probably identical regulating matrix formation (17, 18), and in the recruitment of to rat leukocyte granulin, exhibits proliferative and antipro- neighboring fibroblasts by chemotaxis (19). The similarity liferative effects on epithelial cells in vitro. Here we show by between the molecular biology of wound repair and tumor cDNA analysis that the prepropeptide for the human granulins development has been discussed (20), and it is likely that is a 593-residue glycoprotein, containing seven tandem repeats many of the same regulatory polypeptides are involved in of the 12-cysteine granulin domain. By Northern blot analysis, both processes. gene expression was seen in myelogenous leukemic cell lines of The association of human and rat granulins with inflam- promonocytic, promyelocytic, and proerythroid lineage, in matory leukocytes (7) and the mitogenic properties of epi- fibroblasts and was seen very strongly in epithelial cell lines.
    [Show full text]
  • ©Ferrata Storti Foundation
    Original Articles T-cell/histiocyte-rich large B-cell lymphoma shows transcriptional features suggestive of a tolerogenic host immune response Peter Van Loo,1,2,3 Thomas Tousseyn,4 Vera Vanhentenrijk,4 Daan Dierickx,5 Agnieszka Malecka,6 Isabelle Vanden Bempt,4 Gregor Verhoef,5 Jan Delabie,6 Peter Marynen,1,2 Patrick Matthys,7 and Chris De Wolf-Peeters4 1Department of Molecular and Developmental Genetics, VIB, Leuven, Belgium; 2Department of Human Genetics, K.U.Leuven, Leuven, Belgium; 3Bioinformatics Group, Department of Electrical Engineering, K.U.Leuven, Leuven, Belgium; 4Department of Pathology, University Hospitals K.U.Leuven, Leuven, Belgium; 5Department of Hematology, University Hospitals K.U.Leuven, Leuven, Belgium; 6Department of Pathology, The Norwegian Radium Hospital, University of Oslo, Oslo, Norway, and 7Department of Microbiology and Immunology, Rega Institute for Medical Research, K.U.Leuven, Leuven, Belgium Citation: Van Loo P, Tousseyn T, Vanhentenrijk V, Dierickx D, Malecka A, Vanden Bempt I, Verhoef G, Delabie J, Marynen P, Matthys P, and De Wolf-Peeters C. T-cell/histiocyte-rich large B-cell lymphoma shows transcriptional features suggestive of a tolero- genic host immune response. Haematologica. 2010;95:440-448. doi:10.3324/haematol.2009.009647 The Online Supplementary Tables S1-5 are in separate PDF files Supplementary Design and Methods One microgram of total RNA was reverse transcribed using random primers and SuperScript II (Invitrogen, Merelbeke, Validation of microarray results by real-time quantitative Belgium), as recommended by the manufacturer. Relative reverse transcriptase polymerase chain reaction quantification was subsequently performed using the compar- Ten genes measured by microarray gene expression profil- ative CT method (see User Bulletin #2: Relative Quantitation ing were validated by real-time quantitative reverse transcrip- of Gene Expression, Applied Biosystems).
    [Show full text]
  • Progranulin As a Biomarker and Potential Therapeutic Agent
    Drug Discovery Today Volume 22, Number 10 October 2017 REVIEWS POST SCREEN Progranulin as a biomarker and potential therapeutic agent Reviews 1 2 1 1 Vanessa Abella , Jesús Pino , Morena Scotece , Javier Conde , 3 4 5 Francisca Lago , Miguel Angel Gonzalez-Gay , Antonio Mera , 6 7,8 1 Rodolfo Gómez , Ali Mobasheri and Oreste Gualillo 1 SERGAS (Servizo Galego de Saude) and IDIS (Instituto de Investigación Sanitaria de Santiago), The NEIRID Lab (Neuroendocrine Interactions in Rheumatology and Inflammatory Diseases), Research Laboratory 9, Santiago University Clinical Hospital, Santiago de Compostela, Spain 2 SERGAS (Servizo Galego de Saude), Division of Orthopaedic Surgery and Traumatology, Santiago University Clinical Hospital, Santiago de Compostela, Spain 3 SERGAS (Servizo Galego de Saude) and IDIS (Instituto de Investigación Sanitaria de Santiago), CIBERCV (Centro de Investigación Biomédica en Red de Enfermedades Cardiovasculares), Molecular and Cellular Cardiology, Research Laboratory 7, Santiago University Clinical Hospital, Building C, Travesía da Choupana S/N, Santiago de Compostela 15706, Spain 4 Epidemiology, Genetics and Atherosclerosis Research Group on Systemic Inflammatory Diseases, Universidad de Cantabria and IDIVAL, Santander, Spain 5 SERGAS (Servizo Galego de Saude), Division of Rheumatology, Santiago University Clinical Hospital, Santiago de Compostela, Spain 6 SERGAS (Servizo Galego de Saude) and IDIS (Instituto de Investigación Sanitaria de Santiago), The NEIRID Group, Musculoskeletal Pathology Unit, Santiago University
    [Show full text]
  • Fluid Biomarkers in Frontotemporal Dementia: Past, Present and Future
    Neurodegeneration J Neurol Neurosurg Psychiatry: first published as 10.1136/jnnp-2020-323520 on 13 November 2020. Downloaded from Review Fluid biomarkers in frontotemporal dementia: past, present and future Imogen Joanna Swift ,1 Aitana Sogorb- Esteve,1,2 Carolin Heller ,1 Matthis Synofzik,3,4 Markus Otto ,5 Caroline Graff,6,7 Daniela Galimberti ,8,9 Emily Todd,2 Amanda J Heslegrave,1 Emma Louise van der Ende ,10 John Cornelis Van Swieten ,10 Henrik Zetterberg,1,11 Jonathan Daniel Rohrer 2 ► Additional material is ABSTRACT into a behavioural form (behavioural variant fron- published online only. To view, The frontotemporal dementia (FTD) spectrum of totemporal dementia (bvFTD)), a language variant please visit the journal online (primary progressive aphasia (PPA)) and a motor (http:// dx. doi. org/ 10. 1136/ neurodegenerative disorders includes a heterogeneous jnnp- 2020- 323520). group of conditions. However, following on from a series presentation (either FTD with amyotrophic lateral of important molecular studies in the early 2000s, major sclerosis (FTD- ALS) or an atypical parkinsonian For numbered affiliations see advances have now been made in the understanding disorder). Neuroanatomically, the FTD spectrum end of article. of the pathological and genetic underpinnings of the is characteristically associated with dysfunction and disease. In turn, alongside the development of novel neuronal loss in the frontal and temporal lobes, but Correspondence to more widespread cortical, subcortical, cerebellar Dr Jonathan Daniel Rohrer, methodologies for measuring proteins and other Dementia Research molecules in biological fluids, the last 10 years have and brainstem involvement is now recognised. Centre, Department of seen a huge increase in biomarker studies within FTD.
    [Show full text]
  • Uncorrected Proof
    Progress in Neurobiology xxx (2018) xxx-xxx Contents lists available at ScienceDirect Progress in Neurobiology journal homepage: www.elsevier.com Review article Oligodendrogliopathy in neurodegenerative diseases with abnormal protein aggregates: The forgotten partner Isidro Ferrera⁠ ,⁠ b⁠ ,⁠ c⁠ ,⁠ d⁠ ,⁠ ⁎⁠ a Department of Pathology and Experimental Therapeutics, University of Barcelona, Hospitalet de Llobregat, Spain b Service of Pathology, Bellvitge University Hospital, IDIBELL, Hospitalet de Llobregat, Spain c CIBERNED (Biomedical Network Research Centre of Neurodegenerative Diseases), Institute of Health Carlos III, Spain d Institute of Neurosciences, University of Barcelona, Spain PROOF ARTICLE INFO ABSTRACT Keywords: Oligodendrocytes are in contact with neurons, wrap axons with a myelin sheath that protects their structural Oligodendrocytes integrity, and facilitate nerve conduction. Oligodendrocytes also form a syncytium with astrocytes which in- Multiple system atrophy teracts with neurons, promoting reciprocal survival mediated by activity and by molecules involved in energy Lewy body diseases metabolism and trophism. Therefore, oligodendrocytes are key elements in the normal functioning of the cen- Tauopathy tral nervous system. Oligodendrocytes are affected following different insults to the central nervous system Alzheimer’s disease including ischemia, traumatism, and inflammation. The term oligodendrogliopathy highlights the prominent Amyotrophic lateral sclerosis Frontotemporal lobar degeneration role of altered oligodendrocytes
    [Show full text]
  • Differential Regulation of Progranulin Derived Granulin Peptides Tingting
    bioRxiv preprint doi: https://doi.org/10.1101/2021.01.08.425959; this version posted January 9, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Differential regulation of progranulin derived granulin peptides Tingting Zhang1, Huan Du1, Mariela Nunez Santos1, Xiaochun Wu1, Thomas Reinheckel2 and Fenghua Hu1# 1Department of Molecular Biology and Genetics, Weill Institute for Cell and Molecular Biology, Cornell University, Ithaca, NY 14853, USA 2Institute of Molecular Medicine and Cell Research, Medical Faculty and BIOSS Centre for Biological Signaling Studies, Albert-Ludwigs-University Freiburg, 79104, Freiburg, Germany *Running Title: Differential regulation of granulin peptides #To whom correspondence should be addressed: Fenghua Hu, 345 Weill Hall, Ithaca, NY 14853, TEL: 607- 2550667, FAX: 607-2555961, Email: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2021.01.08.425959; this version posted January 9, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Haploinsufficiency of progranulin (PGRN) is a leading cause of frontotemporal lobar degeneration (FTLD). PGRN is comprised of 7.5 granulin repeats and the precursor is processed into individual granulin peptides by lysosome proteases. The granulin peptides are also haplo-insufficient in FTLD and proposed to possess unique functions. However, very little is known about the levels and regulations of each granulin peptide in the lysosome due to the lack of reagents to specifically detect each individual granulin peptide. Here we report the generation and characterization of antibodies specific to each granulin peptide.
    [Show full text]
  • Erlotinib Overcomes Paclitaxel-Resistant Cancer Stem
    Lv et al. Oncogenesis (2019) 8:70 https://doi.org/10.1038/s41389-019-0179-2 Oncogenesis ARTICLE Open Access Erlotinib overcomes paclitaxel-resistant cancer stem cells by blocking the EGFR-CREB/GRβ-IL-6 axis in MUC1-positive cervical cancer Yaping Lv1, Wei Cang2,QuanfuLi1, Xiaodong Liao1,MengnaZhan3,HuayunDeng1, Shengze Li1,WeiJin1,ZhiPang1, Xingdi Qiu2, Kewen Zhao4,GuoqiangChen4,LihuaQiu2 and Lei Huang1 Abstract Cancer stem cells (CSCs) are often enriched after chemotherapy and contribute to tumor relapse. While epidermal growth factor receptor (EGFR) tyrosine kinase inhibitors (TKIs) are widely used for the treatment of diverse types of cancer, whether EGFR-TKIs are effective against chemoresistant CSCs in cervical cancer is largely unknown. Here, we reveal that EGFR correlates with reduced disease-free survival in cervical cancer patients with chemotherapy. Erlotinib, an EGFR-TKI, effectively impedes CSCs enrichment in paclitaxel-resistant cells through inhibiting IL-6. In this context, MUC1 induces CSCs enrichment in paclitaxel-resistant cells via activation of EGFR, which directly enhances IL-6 transcription through cAMP response element-binding protein (CREB) and glucocorticoid receptor β (GRβ). Treatment with erlotinib sensitizes CSCs to paclitaxel therapy both in vitro and in vivo. More importantly, positive correlations between the expressions of MUC1, EGFR, and IL-6 were found in 20 cervical cancer patients after chemotherapy. Mining TCGA data sets also uncovered the expressions of MUC1-EGFR-IL-6 correlates with poor disease-free survival in chemo-treated cervical cancer patients. Collectively, our work has demonstrated that the MUC1-EGFR-CREB/GRβ axis 1234567890():,; 1234567890():,; 1234567890():,; 1234567890():,; stimulates IL-6 expression to induce CSCs enrichment and importantly, this effect can be abrogated by erlotinib, uncovering a novel strategy to treat paclitaxel-resistant cervical cancer.
    [Show full text]
  • Progranulin and the Receptor Tyrosine Kinase Epha2, Partners in Crime?
    JCB: SpotlightReview Progranulin and the receptor tyrosine kinase EphA2, partners in crime? Babykumari Chitramuthu1,2 and Andrew Bateman1,2 1Department of Medicine, McGill University, Montreal, QC H4A 3J1, Canada 2Centre for Translational Biology, Platform in Experimental Therapeutics and Metabolism, McGill University Health Centre Research Institute, Montreal, QC H4A 3J1, Canada Progranulin is a secreted protein with roles in of biological processes (Toh et al., 2011). It has growth fac- tumorigenesis, inflammation, and neurobiology, but its tor–like properties, stimulating cell proliferation, motility, and survival. It promotes tumorigenesis in vivo, is overexpressed signaling receptors have remained unclear. In this issue, in many cancers, and, as with EphA2, its expression often cor- Neill et al. (2016. J. Cell Biol. https​://doi​.org​/10​.1083​/ relates with more invasive tumors and poor patient outcomes jcb​.201603079) identify the tyrosine kinase EphA2 as a (Zhang and Bateman, 2011). It is angiogenic. Progranulin mod- strong candidate for such a receptor, providing insight ulates inflammation, with progranulin knockout mice display- ing a highly overblown inflammatory response. The loss of a into progranulin and EphA2 signaling. single allele of GRN in humans results in progressive loss of neurons in the frontal and temporal cortex that manifests clin- Occasionally, a paper brings together two seemingly unrelated ically as frontotemporal dementia (Petkau and Leavitt, 2014). strands of research in a new and illuminating fashion. In this Surprisingly, the loss of both GRN alleles does not result in issue, Neill et al. do just that by demonstrating that the EphA2 worsened frontotemporal dementia, as might be expected, but receptor tyrosine kinase is a functional receptor for the secreted instead in a neuronal lysosomal storage disease called neuro- glycoprotein progranulin, a protein that is totally unrelated to nal ceroid lipofuscinosis (Smith et al., 2012).
    [Show full text]
  • Differential Regulation of Progranulin Derived Granulin Peptides Tingting
    bioRxiv preprint doi: https://doi.org/10.1101/2021.01.08.425959; this version posted January 14, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Differential regulation of progranulin derived granulin peptides Tingting Zhang1, Huan Du1, Mariela Nunez Santos1, Xiaochun Wu1, Thomas Reinheckel2 and Fenghua Hu1# 1Department of Molecular Biology and Genetics, Weill Institute for Cell and Molecular Biology, Cornell University, Ithaca, NY 14853, USA 2Institute of Molecular Medicine and Cell Research, Medical Faculty and BIOSS Centre for Biological Signaling Studies, Albert-Ludwigs-University Freiburg, 79104, Freiburg, Germany *Running Title: Differential regulation of granulin peptides #To whom correspondence should be addressed: Fenghua Hu, 345 Weill Hall, Ithaca, NY 14853, TEL: 607- 2550667, FAX: 607-2555961, Email: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2021.01.08.425959; this version posted January 14, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Haploinsufficiency of progranulin (PGRN) is a leading cause of frontotemporal lobar degeneration (FTLD). PGRN is comprised of 7.5 granulin repeats and is processed into individual granulin peptides in the lysosome. However, very little is known about the levels and regulations of individual granulin peptides due to the lack of specific antibodies. Here we report the generation and characterization of antibodies specific to each granulin peptide. We found that the levels of granulins C, E and F are differentially regulated compared to granulins A and B.
    [Show full text]