GRN (Human) Recombinant Protein (Q01)
Total Page:16
File Type:pdf, Size:1020Kb
GRN (Human) Recombinant Protein and PC cell-derived growth factor. Cleavage of the (Q01) signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. Catalog Number: H00002896-Q01 These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are Regulation Status: For research use only (RUO) synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell Product Description: Human GRN partial ORF ( growth. However, different members of the granulin NP_002078, 494 a.a. - 593 a.a.) recombinant protein protein family may act as inhibitors, stimulators, or have with GST-tag at N-terminal. dual actions on cell growth. Granulin family members are important in normal development, wound healing, and Sequence: tumorigenesis. [provided by RefSeq] SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHD NQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGF References: RCAARGTKCLRREAPRWDAPLRDPALRQLL 1. Progranulin Does Not Bind Tumor Necrosis Factor (TNF) Receptors and Is Not a Direct Regulator of Host: Wheat Germ (in vitro) TNF-Dependent Signaling or Bioactivity in Immune or Neuronal Cells. Chen X, Chang J, Deng Q, Xu J, Theoretical MW (kDa): 36.74 Nguyen TA, Martens LH, Cenik B, Taylor G, Hudson KF, Chung J, Yu K, Yu P, Herz J, Farese RV Jr, Kukar T, Applications: AP, Array, ELISA, WB-Re Tansey MG. J Neurosci. 2013 May 22;33(21):9202-13 (See our web site product page for detailed applications 2. The neurotrophic properties of progranulin depend on information) the granulin E domain but do not require sortilin binding. Protocols: See our web site at De Muynck L, Herdewyn S, Beel S, Scheveneels W, Van http://www.abnova.com/support/protocols.asp or product Den Bosch L, Robberecht W, Van Damme P Neurobiol page for detailed protocols Aging. 2013 May 24. pii: S0197-4580(13)00187-5. doi: 10.1016/j.neurobiolaging.2013.04.022. Preparation Method: in vitro wheat germ expression 3. Progranulin functions as a neurotrophic factor to system regulate neurite outgrowth and enhance neuronal survival. Van Damme P, Van Hoecke A, Lambrechts D, Purification: Glutathione Sepharose 4 Fast Flow Vanacker P, Bogaert E, van Swieten J, Carmeliet P, Van Den Bosch L, Robberecht W. J Cell Biol. 2008 Apr Storage Buffer: 50 mM Tris-HCI, 10 mM reduced 7;181(1):37-41. Epub 2008 Mar 31. Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 2896 Gene Symbol: GRN Gene Alias: GEP, GP88, PCDGF, PEPI, PGRN Gene Summary: Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin Page 1/1 Powered by TCPDF (www.tcpdf.org).