DOCSLIB.ORG

Molecular Genetics of Neurodegenerative Dementias

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Molecular Genetics of Neurodegenerative Dementias Downloaded from http://cshperspectives.cshlp.org/ on September 27, 2021 - Published by Cold Spring Harbor Laboratory Press Molecular Genetics of Neurodegenerative Dementias Flora I. Hinz1 and Daniel H. Geschwind1,2 1Program in Neurogenetics, Department of Neurology, David Geffen School of Medicine, University of California, Los Angeles, Los Angeles, California 90095 2Center for Autism Research and Treatment and Center for Neurobehavioral Genetics, Semel Institute for Neuroscience and Human Behavior, University of California, Los Angeles, Los Angeles, California 90024 Correspondence: [email protected] Neurodegenerative dementias are clinically heterogeneous, progressive diseases with fre- quently overlapping symptoms, such as cognitive impairments and behavior and movement deficits. Although a majority of cases appear to be sporadic, there is a large genetic compo- nent that has yet to be fully explained. Here, we review the recent genetic and genomic findings pertaining to Alzheimer’s disease, frontotemporal dementia, Lewy body dementia, and prion dementia. In this review, we describe causal and susceptibility genes identified for these dementias and discuss recent research pertaining to the molecular function of these genes. Of particular interest, there is a large overlap in clinical phenotypes, genes, and/or aggregating protein products involved in these diseases, as well as frequent comorbid pre- sentation, indicating that these dementias may represent a continuum of syndromes rather than individual diseases. eurodegenerative dementias are clinically double roughly every 20 years. Of these demen- Nheterogeneous, progressive diseases with tias, AD is by far the most frequent, comprising frequently overlapping symptoms, such as cog- 50%–75% of all cases (Fig. 1) (Prince et al. nitive impairments and behavior and move- 2014). ment deficits. This spectrum of disease includes Over the last few decades, substantial pro- vascular dementia (VaD), Lewy body dementia gress has been made in understanding the (LBD), Alzheimer’s disease (AD), frontotem- molecular genetics of neurodegenerative de- poral dementia (FTD), and prion dementias mentias and identifying the pathologically (Fig. 1). Recent estimates indicate that 5.9%– aggregating proteins involved. In large part, 9.4% of people .65 years of age suffer from this can be attributed to advances in sequenc- dementia, with approximately 44 million affect- ing techniques and bioinformatic analysis ap- ed worldwide (Prince et al. 2014). Moreover, as proaches. Beginning in the early 1990s with the a result of our aging population, the number of identification of microsatellites (also known as people affected with dementia is expected to short tandem repeats) and single nucleotide Editor: Stanley B. Prusiner Additional Perspectives on Prion Biology available at www.cshperspectives.org Copyright # 2017 Cold Spring Harbor Laboratory Press; all rights reserved; doi: 10.1101/cshperspect.a023705 Cite this article as Cold Spring Harb Perspect Biol 2017;9:a023705 1 Downloaded from http://cshperspectives.cshlp.org/ on September 27, 2021 - Published by Cold Spring Harbor Laboratory Press F.I. Hinz and D.H. Geschwind GRN [3%–25%] 0%–50% C9ORF72 [~25%] MAPT Sporadic Familial ~15% 25%–50% 50%–75% APP VaD ~80% 20%–30% FTD Familial PSEN1 5%–15% <5% PSEN2 [~5%] LBD Sporadic 4.2%–7.5% AD SNCA [<1%] 50%–75% Sporadic >95% Figure 1. Frequency of specific neurodegenerative dementias. The inner circle shows the frequency of specific neurodegenerative dementias (indicated by different colors) as an approximate percentage of all cases of disease. The middle circle shows the percentage of patients that show familial or sporadic patterns of inheritance for each disease. The outer circle depicts the approximate percent of patients with familial inheritance patterns that harbor mutations in specific known causal genes. polymorphisms (SNPs), researchers began to analysis, the majority of disease genes involved apply an approach termed linkage analysis. in these familial, often early-onset cases were This technique makes use of these genomic discovered. More recently, genome-wide associ- markers to identify chromosomal regions ation studies (GWAS) have been applied to shared by affected family members in large identify a multitude of risk variants (mutations families with apparent dominant transmission. with low penetrance) in idiopathic dementia. The assumption is that the pathogenic muta- This new approach was enabled by the develop- tion lies within this shared chromosomal re- ment of comprehensive genome-wide arrays, gion, which carries disease risk, as it segregates allowing for the simultaneous evaluation of with the disease in the family. Linkage analysis millions of SNPs in thousands of samples in a led to the rapid identification of a number of cost-effective manner. GWAS, by comparing highly penetrant disease-causing mutations the SNPs of millions of patients to SNPs from (Kerem et al. 1989; MacDonald et al. 1993; millions of unaffected controls, are used to Ha¨stbacka et al. 1994; Feder et al. 1996; Poorkaj identify genetic variants that are common in et al. 1998; Amir et al. 1999). the population but modulate the risk of disease. However, only a small subset (5%) of Recently, GWAS and, subsequently, meta-anal- neurodegenerative dementia cases show a pat- yses of GWAS,which pool samples from multi- tern of autosomal dominant inheritance, ple studies to increase statistical power, have led whereas most cases appear to be sporadic. Early to the identification of hundreds of mutations on, using genetic approaches such as linkage in so-called susceptibility genes, most with very 2 Cite this article as Cold Spring Harb Perspect Biol 2017;9:a023705 Downloaded from http://cshperspectives.cshlp.org/ on September 27, 2021 - Published by Cold Spring Harbor Laboratory Press Molecular Genetics of Neurodegenerative Dementias small effect sizes (odds ratios usually ,2; for ALZHEIMER’S DISEASE review, see Visscher et al. 2012). Although the By far the most common form of age-related effect size of these variants is not large enough dementia, AD is clinically heterogeneous and to inform disease prediction, these loci may slowly progressive, characterized by a gradual shed light on novel genes and molecular path- decline in memory and other cognitive func- ways dysregulated in disease. However, it is im- tions (such as anomia, agnosia, and apraxia), portant to keep in mind that GWASuse SNPs as depression, and apathy (www.alz.org/research/ proxies for tagging chromosomal regions. Thus, diagnostic_criteria). The brain regions most this type of analysis can determine that a spe- affected by neurodegeneration are the cortex, cific SNP or genomic locus is associated with hippocampus, amygdala, basal forebrain, and disease risk, but does not necessarily mean brainstem (Rademakers and Rovelet-Lecrux that a particular SNP functionally contributes 2009). Progressive atrophy in these regions is to disease risk or which gene in a genomic locus preceded by the accumulation of extracellular may be associated with the pathology. b-amyloid plaques formed by cleavage products In the past few years, with the cost of se- of amyloid precursor protein (APP) and intra- quencing dropping and bioinformatics tech- cellular neurofibrillary tangles (NFTs) com- nology advancing, next-generation sequencing posed of hyperphosphorylated microtubule (NGS) approaches are becoming more com- binding protein tau (MAPT). Plaques and tan- monly used. Rather than limiting sequencing gles have been shown to interfere with calcium to a gene or a small region of the chromosome, signaling and synaptic transmission, to induce a it is now possible to sequence the entire genome persistent inflammatory response, and to lead (whole-genome sequencing, WGS) or only the to synapse loss and ultimately neuronal degen- gene-coding regions, the exons (whole-exome eration. The presence of NFTs is strongly corre- sequencing, WES) (Ng et al. 2009). WES, as a lated with neuronal dysfunction and disease result of focusing on only 2% of the genome, progression (for reviews of AD pathology, see is still considerably cheaper, and the analytical Braak and Braak 1997, 1998; Serrano-Pozo et al. processing power, as well as the storage space 2011). required to handle the data produced, is more AD is classified as early onset (before 65 feasible to acquire for individual laboratories years of age) versus late onset (after 65). Less (Singleton 2011; Wang et al. 2013). Important- than 10% of cases are early onset, and these ly, these NGS approaches allow for the direct usually follow an autosomal dominant inheri- identification of rare variants in disease, with- tance pattern in which mutations in a single out prior linkage or GWAS. As compared to gene can cause the disease. Late-onset AD is WES, WGS has the advantage of better coverage much more common and far more genetically of the exome, owing in part to longer reads and complex, possibly involving concurrent muta- more consistent read depth. Furthermore, WGS tions in multiple genes and interactions among can be used to investigate regulatory variants, these susceptibility genes with each other, as which are increasingly thought to play a signifi- well as unknown environmental factors. Al- cant role in the cause of and risk for neurode- though late-onset AD is largely idiopathic, there generative disease (Wang et al. 2013). is still a significant genetic contribution to sus- Despite these advances, much of the genetic ceptibility, with twin
Load more

Recommended publications
  • Mutations in CHMP2B in Lower Motor Neuron Predominant Amyotrophic Lateral Sclerosis (ALS)
    This is a repository copy of Mutations in CHMP2B in lower motor neuron predominant amyotrophic lateral sclerosis (ALS). White Rose Research Online URL for this paper: http://eprints.whiterose.ac.uk/10846/ Article: Cox, L.E., Ferraiuolo, L., Goodall, E.F. et al. (13 more authors) (2010) Mutations in CHMP2B in lower motor neuron predominant amyotrophic lateral sclerosis (ALS). Plos One, 5 (3). Art no.e9872. ISSN 1932-6203 https://doi.org/10.1371/journal.pone.0009872 Reuse Unless indicated otherwise, fulltext items are protected by copyright with all rights reserved. The copyright exception in section 29 of the Copyright, Designs and Patents Act 1988 allows the making of a single copy solely for the purpose of non-commercial research or private study within the limits of fair dealing. The publisher or other rights-holder may allow further reproduction and re-use of this version - refer to the White Rose Research Online record for this item. Where records identify the publisher as the copyright holder, users can verify any specific terms of use on the publisher’s website. Takedown If you consider content in White Rose Research Online to be in breach of UK law, please notify us by emailing [email protected] including the URL of the record and the reason for the withdrawal request. [email protected] https://eprints.whiterose.ac.uk/ Mutations in CHMP2B in Lower Motor Neuron Predominant Amyotrophic Lateral Sclerosis (ALS) Laura E. Cox1, Laura Ferraiuolo1, Emily F. Goodall1, Paul R. Heath1, Adrian Higginbottom1, Heather Mortiboys1, Hannah C. Hollinger1, Judith A. Hartley1, Alice Brockington1, Christine E.
    [Show full text]
  • Genetic Screen Identifies Serpin5 As a Regulator of the Toll Pathway and CHMP2B Toxicity Associated with Frontotemporal Dementia
    Genetic screen identifies serpin5 as a regulator of the toll pathway and CHMP2B toxicity associated with frontotemporal dementia S. Tariq Ahmada, Sean T. Sweeneyb, Jin-A Leea, Neal T. Sweeneya,c,1, and Fen-Biao Gaoa,c,2 aGladstone Institute of Neurological Disease, San Francisco, CA 94158; bDepartment of Biology, University of York, P.O. Box 373, York YO10 5YW, United Kingdom; and cNeuroscience Graduate Program, University of California, San Francisco, CA 94158 Edited by Yuh Nung Jan, University of California School of Medicine, San Francisco, CA, and approved May 18, 2009 (received for review March 23, 2009) Frontotemporal dementia (FTD) is the most common form of demen- gain-of-function mechanism. However, animal models of FTD3 tia before 60 years of age. Rare pathogenic mutations in CHMP2B, have not been reported, and the signaling pathways that are which encodes a component of the endosomal sorting complex misregulated in vivo remain to be identified. required for transport (ESCRT-III), are associated with FTD linked to In recent years, Drosophila models have been instrumental in chromosome 3 (FTD3). Animal models of FTD3 have not yet been uncovering molecular pathways that contribute to the pathogenesis reported, and what signaling pathways are misregulated by mutant of neurodegenerative diseases (17, 18). In this study, we modeled CHMP2B in vivo is unknown. Here we report the establishment of a the effect of CHMP2B in human FTD3 using a gain-of-function Drosophila model of FTD3 and show the genetic interactions between approach, which is similar to the approach that gives effects in mutant CHMP2B and other components of ESCRT.
    [Show full text]
  • Progranulin Mutations in Dutch Familial Frontotemporal Lobar Degeneration
    European Journal of Human Genetics (2007) 15, 369–374 & 2007 Nature Publishing Group All rights reserved 1018-4813/07 $30.00 www.nature.com/ejhg ARTICLE Progranulin mutations in Dutch familial frontotemporal lobar degeneration Iraad F Bronner1,2,4, Patrizia Rizzu*,1,2,4, Harro Seelaar3, Saskia E van Mil1,2, Burcu Anar1,2, Asma Azmani3, Laura Donker Kaat3, Sonia Rosso3, Peter Heutink1,2 and John C van Swieten3 1Department of Human Genetics, Section Medical Genomics, VU University Medical Center and VU University, Amsterdam, The Netherlands; 2Center for Neurogenomics and Cognitive Research, VU University Medical Center and VU University, Amsterdam, The Netherlands; 3Department of Neurology, Erasmus MC University Medical Center, Rotterdam, The Netherlands Mutations in the progranulin (PGRN) gene have recently been identified in frontotemporal lobar degeneration with ubiquitin inclusions linked to chromosome 17q21. We report here the finding of two novel frameshift mutations and three possible pathogenic missense mutations in the PGRN gene. Furthermore, we determined the frequency of PGRN mutations in familial cases recruited from a large population-based study of frontotemporal lobar degeneration carried out in The Netherlands. European Journal of Human Genetics (2007) 15, 369–374. doi:10.1038/sj.ejhg.5201772; published online 17 January 2007 Keywords: PGRN; FTLD; mutations; neurodegeneration Introduction dentate gyrus of the hippocampus and in the superficial The term frontotemporal lobar degeneration (FTLD) refers layers of the frontal
    [Show full text]
  • GRN (Human) Recombinant Protein (Q01)
    GRN (Human) Recombinant Protein and PC cell-derived growth factor. Cleavage of the (Q01) signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. Catalog Number: H00002896-Q01 These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are Regulation Status: For research use only (RUO) synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell Product Description: Human GRN partial ORF ( growth. However, different members of the granulin NP_002078, 494 a.a. - 593 a.a.) recombinant protein protein family may act as inhibitors, stimulators, or have with GST-tag at N-terminal. dual actions on cell growth. Granulin family members are important in normal development, wound healing, and Sequence: tumorigenesis. [provided by RefSeq] SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHD NQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGF References: RCAARGTKCLRREAPRWDAPLRDPALRQLL 1. Progranulin Does Not Bind Tumor Necrosis Factor (TNF) Receptors and Is Not a Direct Regulator of Host: Wheat Germ (in vitro) TNF-Dependent Signaling or Bioactivity in Immune or Neuronal Cells. Chen X, Chang J, Deng Q, Xu J, Theoretical MW (kDa): 36.74 Nguyen TA, Martens LH, Cenik B, Taylor G, Hudson KF, Chung J, Yu K, Yu P, Herz J, Farese RV Jr, Kukar T, Applications: AP, Array, ELISA, WB-Re Tansey MG. J Neurosci. 2013 May 22;33(21):9202-13 (See our web site product page for detailed applications 2. The neurotrophic properties of progranulin depend on information) the granulin E domain but do not require sortilin binding. Protocols: See our web site at De Muynck L, Herdewyn S, Beel S, Scheveneels W, Van http://www.abnova.com/support/protocols.asp or product Den Bosch L, Robberecht W, Van Damme P Neurobiol page for detailed protocols Aging.
    [Show full text]
  • Processing of Progranulin Into Granulins Involves Multiple Lysosomal Proteases and Is Affected in Frontotemporal Lobar Degeneration
    Processing of progranulin into granulins involves multiple lysosomal proteases and is affected in frontotemporal lobar degeneration Swetha Mohan University of California San Francisco Paul J. Sampognaro University of California San Francisco Andrea R. Argouarch University of California San Francisco Jason C. Maynard University of California San Francisco Anand Patwardhan University of California San Francisco Emma C. Courtney University of California San Francisco Amanda Mason University of California San Francisco Kathy H. Li University of California San Francisco William W. Seeley University of California San Francisco Bruce L. Miller University of California San Francisco Alma Burlingame University of California San Francisco Mathew P. Jacobson University of California San Francisco Aimee Kao ( [email protected] ) University of California San Francisco https://orcid.org/0000-0002-7686-7968 Research article Keywords: Progranulin, granulin, frontotemporal lobar degeneration, lysosome, protease, pH, asparagine endopeptidase Page 1/31 Posted Date: July 29th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-44128/v2 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Version of Record: A version of this preprint was published at Molecular Neurodegeneration on August 3rd, 2021. See the published version at https://doi.org/10.1186/s13024-021-00472-1. Page 2/31 Abstract Background - Progranulin loss-of-function mutations are linked to frontotemporal lobar degeneration with TDP-43 positive inclusions (FTLD-TDP-Pgrn). Progranulin (PGRN) is an intracellular and secreted pro- protein that is proteolytically cleaved into individual granulin peptides, which are increasingly thought to contribute to FTLD-TDP-Pgrn disease pathophysiology. Intracellular PGRN is processed into granulins in the endo-lysosomal compartments.
    [Show full text]
  • CHMP2B Regulates TDP-43 Phosphorylation and Proteotoxicity Via Modulating
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.04.133546; this version posted June 5, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Linking CHMP2B to pTDP-43 via CK1_Sun et al 1 CHMP2B regulates TDP-43 phosphorylation and proteotoxicity via modulating 2 CK1 turnover independent of the autophagy-lysosomal pathway 3 Xing Sun1,2,5, Xue Deng1,2,5, Rirong Hu1,2, Yongjia Duan1, Kai Zhang1,2, Jihong Cui1, Jiangxia Ni1,2, 4 Qiangqiang Wang1, Yelin Chen1,2, Ang Li3,4*, and Yanshan Fang1,2*. 5 1Interdisciplinary Research Center on Biology and Chemistry, Shanghai Institute of Organic 6 Chemistry, Chinese Academy of Sciences, Shanghai 201210, China 7 2University of Chinese Academy of Sciences, Beijing 100049, China 8 3Guangdong-Hong Kong-Macau Institute of CNS Regeneration, Joint International Research 9 Laboratory of CNS Regeneration Ministry of Education, Jinan University, Guangzhou 510632, 10 China 11 4Guangzhou Regenerative Medicine and Health Guangdong Laboratory, Guangzhou 510005, 12 China 13 5These authors contributed equally 14 *Correspondence to: 15 Ang Li: [email protected] 16 Yanshan Fang: [email protected] 17 Tel: +86-21-6858.2510 18 ORCID: https://orcid.org/0000-0002-4123-0174 19 Short title: Linking CHMP2B to pTDP-43 via CK1 20 Keywords (5~10): ALS, FTD, ESCRT, CHMP2B, TDP-43, phosphorylation, CK1, UPS 21 This PDF file includes: 22 Main text: ~7,500 words (excluding the title page and references) 23 Figures 1 to 6 24 Supplemental Figures S1 to S6 25 Page 1 / 34 bioRxiv preprint doi: https://doi.org/10.1101/2020.06.04.133546; this version posted June 5, 2020.
    [Show full text]
  • Association of Imputed Prostate Cancer Transcriptome with Disease Risk Reveals Novel Mechanisms
    Corrected: Author Correction ARTICLE https://doi.org/10.1038/s41467-019-10808-7 OPEN Association of imputed prostate cancer transcriptome with disease risk reveals novel mechanisms Nima C. Emami1,2, Linda Kachuri2, Travis J. Meyers2, Rajdeep Das3,4, Joshua D. Hoffman2, Thomas J. Hoffmann 2,5, Donglei Hu 5,6,7, Jun Shan8, Felix Y. Feng3,4,7, Elad Ziv5,6,7, Stephen K. Van Den Eeden 3,8 & John S. Witte1,2,3,5,7 1234567890():,; Here we train cis-regulatory models of prostate tissue gene expression and impute expression transcriptome-wide for 233,955 European ancestry men (14,616 prostate cancer (PrCa) cases, 219,339 controls) from two large cohorts. Among 12,014 genes evaluated in the UK Biobank, we identify 38 associated with PrCa, many replicating in the Kaiser Permanente RPGEH. We report the association of elevated TMPRSS2 expression with increased PrCa risk (independent of a previously-reported risk variant) and with increased tumoral expression of the TMPRSS2:ERG fusion-oncogene in The Cancer Genome Atlas, suggesting a novel germline-somatic interaction mechanism. Three novel genes, HOXA4, KLK1, and TIMM23, additionally replicate in the RPGEH cohort. Furthermore, 4 genes, MSMB, NCOA4, PCAT1, and PPP1R14A, are associated with PrCa in a trans-ethnic meta-analysis (N = 9117). Many genes exhibit evidence for allele-specific transcriptional activation by PrCa master-regulators (including androgen receptor) in Position Weight Matrix, Chip-Seq, and Hi-C experimental data, suggesting common regulatory mechanisms for the associated genes. 1 Program in Biological and Medical Informatics, University of California San Francisco, San Francisco, CA 94158, USA.
    [Show full text]
  • Frontotemporal Dementia Caused by CHMP2B Mutation Is Characterised by Neuronal Lysosomal Storage Pathology
    Acta Neuropathol (2015) 130:511–523 DOI 10.1007/s00401-015-1475-3 ORIGINAL PAPER Frontotemporal dementia caused by CHMP2B mutation is characterised by neuronal lysosomal storage pathology Emma L. Clayton1 · Sarah Mizielinska1 · James R. Edgar3 · Troels Tolstrup Nielsen4 · Sarah Marshall1 · Frances E. Norona1 · Miranda Robbins1 · Hana Damirji1 · Ida E. Holm5,6 · Peter Johannsen7 · Jørgen E. Nielsen4,7,8 · Emmanuel A. Asante2 · John Collinge1,2 · The FReJA consortium · Adrian M. Isaacs1 Received: 7 July 2015 / Revised: 1 September 2015 / Accepted: 2 September 2015 / Published online: 10 September 2015 © The Author(s) 2015. This article is published with open access at Springerlink.com Abstract Mutations in the charged multivesicular body controls, indicating that they are a specific pathology protein 2B (CHMP2B) cause frontotemporal dementia caused by mutant CHMP2B. Ultrastructural analysis and (FTD). We report that mice which express FTD-causative immuno-gold labelling confirmed that they are derived mutant CHMP2B at physiological levels develop a novel from the endolysosomal system. Consistent with these lysosomal storage pathology characterised by large neu- findings, CHMP2B mutation patient brains contain mor- ronal autofluorescent aggregates. The aggregates are an phologically similar autofluorescent aggregates. These early and progressive pathology that occur at 3 months aggregates occur significantly more frequently in human of age and increase in both size and number over time. CHMP2B mutation brain than in neurodegenerative disease These autofluorescent aggregates are not observed in or age-matched control brains. These data suggest that lys- mice expressing wild-type CHMP2B, or in non-transgenic osomal storage pathology is the major neuronal pathology in FTD caused by CHMP2B mutation.
    [Show full text]
  • Granulin: an Invasive and Survival-Determining Marker in Colorectal Cancer Patients
    International Journal of Molecular Sciences Article Granulin: An Invasive and Survival-Determining Marker in Colorectal Cancer Patients Fee Klupp 1,*, Christoph Kahlert 2, Clemens Franz 1, Niels Halama 3, Nikolai Schleussner 1, Naita M. Wirsik 4, Arne Warth 5, Thomas Schmidt 1,4 and Alexis B. Ulrich 1,6 1 Department of General, Visceral and Transplantation Surgery, University of Heidelberg, Im Neuenheimer Feld 420, 69120 Heidelberg, Germany; [email protected] (C.F.); [email protected] (N.S.); [email protected] (T.S.); [email protected] (A.B.U.) 2 Department of Visceral, Thoracic and Vascular Surgery, University of Dresden, Fetscherstr. 74, 01307 Dresden, Germany; [email protected] 3 National Center for Tumor Diseases, Medical Oncology and Internal Medicine VI, Tissue Imaging and Analysis Center, Bioquant, University of Heidelberg, Im Neuenheimer Feld 267, 69120 Heidelberg, Germany; [email protected] 4 Department of General, Visceral und Tumor Surgery, University Hospital Cologne, Kerpener Straße 62, 50937 Cologne, Germany; [email protected] 5 Institute of Pathology, University of Heidelberg, Im Neuenheimer Feld 224, 69120 Heidelberg, Germany; [email protected] 6 Department of General and Visceral Surgery, Lukas Hospital Neuss, Preußenstr. 84, 41464 Neuss, Germany * Correspondence: [email protected]; Tel.: +49-6221-566-110; Fax: +49-6221-565-506 Abstract: Background: Granulin is a secreted, glycosylated peptide—originated by cleavage from a precursor protein—which is involved in cell growth, tumor invasion and angiogenesis. However, Citation: Klupp, F.; Kahlert, C.; the specific prognostic impact of granulin in human colorectal cancer has only been studied to a Franz, C.; Halama, N.; Schleussner, limited extent.
    [Show full text]
  • CHMP2B (NM 001244644) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC231958 CHMP2B (NM_001244644) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CHMP2B (NM_001244644) Human Tagged ORF Clone Tag: Myc-DDK Symbol: CHMP2B Synonyms: ALS17; CHMP2.5; DMT1; FTDALS7; VPS2-2; VPS2B Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC231958 representing NM_001244644 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAATTAGAAATTAAGAAAATGGCCAAGATTGGTAATAAGGAAGCTTGCAAAGTTTTAGCCAAACAAC TTGTGCATCTACGGAAACAGAAGACGAGAACTTTTGCTGTAAGTTCAAAAGTTACTTCTATGTCTACACA AACAAAAGTGATGAATTCCCAAATGAAGATGGCTGGAGCAATGTCTACTACAGCAAAAACAATGCAGGCA GTTAACAAGAAGATGGATCCACAAAAGACATTACAAACAATGCAGAATTTCCAGAAGGAAAACATGAAAA TGGAAATGACTGAAGAAATGATCAATGATACACTTGATGACATCTTTGACGGTTCTGATGACGAAGAAGA AAGCCAGGATATTGTGAATCAAGTTCTTGATGAAATTGGAATTGAAATTTCTGGAAAGATGGCCAAAGCT CCATCAGCTGCTCGAAGCTTACCATCTGCCTCTACTTCAAAGGCTACAATCTCAGATGAAGAGATTGAAC GGCAACTCAAGGCTTTAGGAGTAGAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC231958 representing NM_001244644 Red=Cloning site Green=Tags(s) MELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQA VNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKA
    [Show full text]
  • Isolation and Sequence of the Granulin Precursor Cdna from Human Bone
    Proc. Nat!. Acad. Sci. USA Vol. 89, pp. 1715-1719, March 1992 Biochemistry Isolation and sequence of the granulin precursor cDNA from human bone marrow reveals tandem cysteine-rich granulin domains (epithelin/growth factors/kidney/i ion) VIJAY BHANDARI, ROGER G. E. PALFREE, AND ANDREW BATEMAN* Endocrine Laboratory, Royal Victoria Hospital, Department of Medicine, McGill University, Montreal, PQ, H3A lAl, Canada Communicated by Seymour Lieberman, November 15, 1991 (receivedfor review September 17, 1991) ABSTRACT Granulins are candidate growth factors re- mal growth factor (EGF) (14). Some ofthese peptides may be cently discovered in human and rat inflammatory leukocytes involved in initiating or sustaining an inflammatory response and bone marrow. Two granulin homologs, epithelin 1 and 2, (15, 16), in tissue remodeling at the site of a wound by occur in the rat kidney. Epithelin 1, which is probably identical regulating matrix formation (17, 18), and in the recruitment of to rat leukocyte granulin, exhibits proliferative and antipro- neighboring fibroblasts by chemotaxis (19). The similarity liferative effects on epithelial cells in vitro. Here we show by between the molecular biology of wound repair and tumor cDNA analysis that the prepropeptide for the human granulins development has been discussed (20), and it is likely that is a 593-residue glycoprotein, containing seven tandem repeats many of the same regulatory polypeptides are involved in of the 12-cysteine granulin domain. By Northern blot analysis, both processes. gene expression was seen in myelogenous leukemic cell lines of The association of human and rat granulins with inflam- promonocytic, promyelocytic, and proerythroid lineage, in matory leukocytes (7) and the mitogenic properties of epi- fibroblasts and was seen very strongly in epithelial cell lines.
    [Show full text]
  • ©Ferrata Storti Foundation
    Original Articles T-cell/histiocyte-rich large B-cell lymphoma shows transcriptional features suggestive of a tolerogenic host immune response Peter Van Loo,1,2,3 Thomas Tousseyn,4 Vera Vanhentenrijk,4 Daan Dierickx,5 Agnieszka Malecka,6 Isabelle Vanden Bempt,4 Gregor Verhoef,5 Jan Delabie,6 Peter Marynen,1,2 Patrick Matthys,7 and Chris De Wolf-Peeters4 1Department of Molecular and Developmental Genetics, VIB, Leuven, Belgium; 2Department of Human Genetics, K.U.Leuven, Leuven, Belgium; 3Bioinformatics Group, Department of Electrical Engineering, K.U.Leuven, Leuven, Belgium; 4Department of Pathology, University Hospitals K.U.Leuven, Leuven, Belgium; 5Department of Hematology, University Hospitals K.U.Leuven, Leuven, Belgium; 6Department of Pathology, The Norwegian Radium Hospital, University of Oslo, Oslo, Norway, and 7Department of Microbiology and Immunology, Rega Institute for Medical Research, K.U.Leuven, Leuven, Belgium Citation: Van Loo P, Tousseyn T, Vanhentenrijk V, Dierickx D, Malecka A, Vanden Bempt I, Verhoef G, Delabie J, Marynen P, Matthys P, and De Wolf-Peeters C. T-cell/histiocyte-rich large B-cell lymphoma shows transcriptional features suggestive of a tolero- genic host immune response. Haematologica. 2010;95:440-448. doi:10.3324/haematol.2009.009647 The Online Supplementary Tables S1-5 are in separate PDF files Supplementary Design and Methods One microgram of total RNA was reverse transcribed using random primers and SuperScript II (Invitrogen, Merelbeke, Validation of microarray results by real-time quantitative Belgium), as recommended by the manufacturer. Relative reverse transcriptase polymerase chain reaction quantification was subsequently performed using the compar- Ten genes measured by microarray gene expression profil- ative CT method (see User Bulletin #2: Relative Quantitation ing were validated by real-time quantitative reverse transcrip- of Gene Expression, Applied Biosystems).
    [Show full text]