The Roles of Progranulin and Tmem106b in Lysosomal
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
GRN (Human) Recombinant Protein (Q01)
GRN (Human) Recombinant Protein and PC cell-derived growth factor. Cleavage of the (Q01) signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. Catalog Number: H00002896-Q01 These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are Regulation Status: For research use only (RUO) synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell Product Description: Human GRN partial ORF ( growth. However, different members of the granulin NP_002078, 494 a.a. - 593 a.a.) recombinant protein protein family may act as inhibitors, stimulators, or have with GST-tag at N-terminal. dual actions on cell growth. Granulin family members are important in normal development, wound healing, and Sequence: tumorigenesis. [provided by RefSeq] SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHD NQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGF References: RCAARGTKCLRREAPRWDAPLRDPALRQLL 1. Progranulin Does Not Bind Tumor Necrosis Factor (TNF) Receptors and Is Not a Direct Regulator of Host: Wheat Germ (in vitro) TNF-Dependent Signaling or Bioactivity in Immune or Neuronal Cells. Chen X, Chang J, Deng Q, Xu J, Theoretical MW (kDa): 36.74 Nguyen TA, Martens LH, Cenik B, Taylor G, Hudson KF, Chung J, Yu K, Yu P, Herz J, Farese RV Jr, Kukar T, Applications: AP, Array, ELISA, WB-Re Tansey MG. J Neurosci. 2013 May 22;33(21):9202-13 (See our web site product page for detailed applications 2. The neurotrophic properties of progranulin depend on information) the granulin E domain but do not require sortilin binding. Protocols: See our web site at De Muynck L, Herdewyn S, Beel S, Scheveneels W, Van http://www.abnova.com/support/protocols.asp or product Den Bosch L, Robberecht W, Van Damme P Neurobiol page for detailed protocols Aging. -
Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model
Downloaded from http://www.jimmunol.org/ by guest on September 25, 2021 T + is online at: average * The Journal of Immunology , 34 of which you can access for free at: 2016; 197:1477-1488; Prepublished online 1 July from submission to initial decision 4 weeks from acceptance to publication 2016; doi: 10.4049/jimmunol.1600589 http://www.jimmunol.org/content/197/4/1477 Molecular Profile of Tumor-Specific CD8 Cell Hypofunction in a Transplantable Murine Cancer Model Katherine A. Waugh, Sonia M. Leach, Brandon L. Moore, Tullia C. Bruno, Jonathan D. Buhrman and Jill E. Slansky J Immunol cites 95 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2016/07/01/jimmunol.160058 9.DCSupplemental This article http://www.jimmunol.org/content/197/4/1477.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 25, 2021. The Journal of Immunology Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model Katherine A. -
Sphingolipid Metabolism Diseases ⁎ Thomas Kolter, Konrad Sandhoff
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Biochimica et Biophysica Acta 1758 (2006) 2057–2079 www.elsevier.com/locate/bbamem Review Sphingolipid metabolism diseases ⁎ Thomas Kolter, Konrad Sandhoff Kekulé-Institut für Organische Chemie und Biochemie der Universität, Gerhard-Domagk-Str. 1, D-53121 Bonn, Germany Received 23 December 2005; received in revised form 26 April 2006; accepted 23 May 2006 Available online 14 June 2006 Abstract Human diseases caused by alterations in the metabolism of sphingolipids or glycosphingolipids are mainly disorders of the degradation of these compounds. The sphingolipidoses are a group of monogenic inherited diseases caused by defects in the system of lysosomal sphingolipid degradation, with subsequent accumulation of non-degradable storage material in one or more organs. Most sphingolipidoses are associated with high mortality. Both, the ratio of substrate influx into the lysosomes and the reduced degradative capacity can be addressed by therapeutic approaches. In addition to symptomatic treatments, the current strategies for restoration of the reduced substrate degradation within the lysosome are enzyme replacement therapy (ERT), cell-mediated therapy (CMT) including bone marrow transplantation (BMT) and cell-mediated “cross correction”, gene therapy, and enzyme-enhancement therapy with chemical chaperones. The reduction of substrate influx into the lysosomes can be achieved by substrate reduction therapy. Patients suffering from the attenuated form (type 1) of Gaucher disease and from Fabry disease have been successfully treated with ERT. © 2006 Elsevier B.V. All rights reserved. Keywords: Ceramide; Lysosomal storage disease; Saposin; Sphingolipidose Contents 1. Sphingolipid structure, function and biosynthesis ..........................................2058 1.1. -
Evolutionary Plasticity in Detoxification Gene Modules: the Preservation
International Journal of Molecular Sciences Article Evolutionary Plasticity in Detoxification Gene Modules: The Preservation and Loss of the Pregnane X Receptor in Chondrichthyes Lineages Elza S. S. Fonseca 1,2, Raquel Ruivo 1 , André M. Machado 1 , Francisca Conrado 1, Boon-Hui Tay 3, Byrappa Venkatesh 3, Miguel M. Santos 1,2 and L. Filipe C. Castro 1,2,* 1 CIIMAR/CIMAR—Interdisciplinary Centre of Marine and Environmental Research, 4450-208 Matosinhos, Portugal; [email protected] (E.S.S.F.); [email protected] (R.R.); [email protected] (A.M.M.); fi[email protected] (F.C.); [email protected] (M.M.S.) 2 FCUP—Faculty of Sciences, Department of Biology, University of Porto, 4150-177 Porto, Portugal 3 Comparative Genomics Laboratory, Institute of Molecular and Cell Biology, A*STAR (Agency for Science, Technology and Research), Biopolis, Singapore 138673, Singapore; [email protected] (B.-H.T.); [email protected] (B.V.) * Correspondence: fi[email protected]; Tel.: +351-22-3401800 Received: 25 February 2019; Accepted: 6 May 2019; Published: 10 May 2019 Abstract: To appraise how evolutionary processes, such as gene duplication and loss, influence an organism’s xenobiotic sensitivity is a critical question in toxicology. Of particular importance are gene families involved in the mediation of detoxification responses, such as members of the nuclear receptor subfamily 1 group I (NR1I), the pregnane X receptor (PXR), and the constitutive androstane receptor (CAR). While documented in multiple vertebrate genomes, PXR and CAR display an intriguing gene distribution. PXR is absent in birds and reptiles, while CAR shows a tetrapod-specific occurrence. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Characterization of a Mutation in a Family with Saposin B Deficiency
Proc. Nadl. Acad. Sci. USA Vol. 87, pp. 2541-2544, April 1990 Genetics Characterization of a mutation in a family with saposin B deficiency: A glycosylation site defect (sphingolipid activator protein/SAP-1/metachromatic leukodystrophy/arylsulfatase A) KEITH A. KRETZ*, GEOFFREY S. CARSON*, SATOSHI MORIMOTO*t, YASUO KISHIMOTO*, ARVAN L. FLUHARTYt, AND JOHN S. O'BPUEN*§ *Department of Neurosciences and Center for Molecular Genetics, University of California, San Diego, School of Medicine, M-034J, La Jolla, CA 92093; and tUniversity of California, Los Angeles, Mental Retardation Research Center Group at Lanterman Developmental Center, Pomona, CA 91766 Communicated by Dan L. Lindsley, January 19, 1990 ABSTRACT Saposins are small, heat-stable glycoproteins these four saposin proteins has now been isolated and their required for the hydrolysis of sphingolipids by specific lyso- activating properties have been determined (3-14). somal hydrolases. Saposins A, B, C, and D are derived by Saposins A and C specifically activate hydrolysis of glu- proteolytic processing from a single precursor protein named cocerebroside byB-glucosylceramidase (D-glucosyl-N-acyl- prosaposin. Saposin B, previously known as SAP-1 and sul- sphingosine glucohydrolase; EC 3.2.1.45) and ofgalactocere- fatide activator, stimulates the hydrolysis of a wide variety of broside by galactosylceramidase (D-galactosyl-N-acyl- substrates including cerebroside sulfate, GM1 ganglioside, and sphingosine galactohydrolase; EC 3.2.1.46) (3, 4). Saposin D globotriaosylceramide by arylsulfatase A, acid 8-galacto- specifically activates the hydrolysis of sphingomyelin by sidase, and a-galactosidase, respectively. Human saposin B sphingomyelin phosphodiesterase (sphingomyelin choline- deficiency, transmitted as an autosomal recessive trait, results phosphohydrolase; EC 3.1.4.12) (5). -
TMEM106B in Humans and Vac7 and Tag1 in Yeast Are Predicted to Be Lipid Transfer Proteins
bioRxiv preprint doi: https://doi.org/10.1101/2021.03.12.435176; this version posted March 12, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. TMEM106B in humans and Vac7 and Tag1 in yeast are predicted to be lipid transfer proteins Tim P. Levine* UCL Institute of Ophthalmology, 11-43 Bath Street, London EC1V 9EL, United Kingdom. ORCID 0000-0002-7231-0775 *Corresponding author and lead contact: [email protected] Data availability statement: The data that support this study are freely available in Harvard Dataverse at https://dataverse.harvard.edu/dataverse/LEA_2. Acknowledgements: work was funded by the Higher Education Funding Council for England and the NIHR Moorfields Biomedical Research Centre Conflict of interest disclosure: the author declares that there is no conflict of interest Keywords: Structural bioinformatics, Lipid transfer protein, LEA_2, TMEM106B, Vac7, YLR173W, Endosome, Lysosome Running Title: TMEM106B & Vac7: lipid transfer proteins 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.03.12.435176; this version posted March 12, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract TMEM106B is an integral membrane protein of late endosomes and lysosomes involved in neuronal function, its over-expression being associated with familial frontotemporal lobar degeneration, and under-expression linked to hypomyelination. It has also been identified in multiple screens for host proteins required for productive SARS-CoV2 infection. Because standard approaches to understand TMEM106B at the sequence level find no homology to other proteins, it has remained a protein of unknown function. -
Processing of Progranulin Into Granulins Involves Multiple Lysosomal Proteases and Is Affected in Frontotemporal Lobar Degeneration
Processing of progranulin into granulins involves multiple lysosomal proteases and is affected in frontotemporal lobar degeneration Swetha Mohan University of California San Francisco Paul J. Sampognaro University of California San Francisco Andrea R. Argouarch University of California San Francisco Jason C. Maynard University of California San Francisco Anand Patwardhan University of California San Francisco Emma C. Courtney University of California San Francisco Amanda Mason University of California San Francisco Kathy H. Li University of California San Francisco William W. Seeley University of California San Francisco Bruce L. Miller University of California San Francisco Alma Burlingame University of California San Francisco Mathew P. Jacobson University of California San Francisco Aimee Kao ( [email protected] ) University of California San Francisco https://orcid.org/0000-0002-7686-7968 Research article Keywords: Progranulin, granulin, frontotemporal lobar degeneration, lysosome, protease, pH, asparagine endopeptidase Page 1/31 Posted Date: July 29th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-44128/v2 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Version of Record: A version of this preprint was published at Molecular Neurodegeneration on August 3rd, 2021. See the published version at https://doi.org/10.1186/s13024-021-00472-1. Page 2/31 Abstract Background - Progranulin loss-of-function mutations are linked to frontotemporal lobar degeneration with TDP-43 positive inclusions (FTLD-TDP-Pgrn). Progranulin (PGRN) is an intracellular and secreted pro- protein that is proteolytically cleaved into individual granulin peptides, which are increasingly thought to contribute to FTLD-TDP-Pgrn disease pathophysiology. Intracellular PGRN is processed into granulins in the endo-lysosomal compartments. -
Mouse Tmem106c Knockout Project (CRISPR/Cas9)
https://www.alphaknockout.com Mouse Tmem106c Knockout Project (CRISPR/Cas9) Objective: To create a Tmem106c knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Tmem106c gene (NCBI Reference Sequence: NM_201359 ; Ensembl: ENSMUSG00000052369 ) is located on Mouse chromosome 15. 8 exons are identified, with the ATG start codon in exon 2 and the TAG stop codon in exon 8 (Transcript: ENSMUST00000064200). Exon 2~8 will be selected as target site. Cas9 and gRNA will be co-injected into fertilized eggs for KO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 2 starts from about 0.13% of the coding region. Exon 2~8 covers 100.0% of the coding region. The size of effective KO region: ~4867 bp. The KO region does not have any other known gene. Page 1 of 9 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 2 3 4 5 6 7 8 Legends Exon of mouse Tmem106c Knockout region Page 2 of 9 https://www.alphaknockout.com Overview of the Dot Plot (up) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section upstream of start codon is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the Dot Plot (down) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section downstream of stop codon is aligned with itself to determine if there are tandem repeats. -
A Saposin Deficiency Model in Drosophila: Lysosomal Storage, Progressive Neurodegeneration and Sensory Physiological Decline
This is a repository copy of A saposin deficiency model in Drosophila: Lysosomal storage, progressive neurodegeneration and sensory physiological decline. White Rose Research Online URL for this paper: https://eprints.whiterose.ac.uk/109579/ Version: Published Version Article: Elliott, Christopher John Hazell orcid.org/0000-0002-5805-3645 and Sweeney, Sean orcid.org/0000-0003-2673-9578 (2017) A saposin deficiency model in Drosophila: Lysosomal storage, progressive neurodegeneration and sensory physiological decline. Neurobiology of disease. pp. 77-87. ISSN 1095-953X https://doi.org/10.1016/j.nbd.2016.11.012 Reuse This article is distributed under the terms of the Creative Commons Attribution (CC BY) licence. This licence allows you to distribute, remix, tweak, and build upon the work, even commercially, as long as you credit the authors for the original work. More information and the full terms of the licence here: https://creativecommons.org/licenses/ Takedown If you consider content in White Rose Research Online to be in breach of UK law, please notify us by emailing [email protected] including the URL of the record and the reason for the withdrawal request. [email protected] https://eprints.whiterose.ac.uk/ Neurobiology of Disease 98 (2017) 77–87 Contents lists available at ScienceDirect Neurobiology of Disease journal homepage: www.elsevier.com/locate/ynbdi Asaposindeficiency model in Drosophila: Lysosomal storage, progressive neurodegeneration and sensory physiological decline Samantha J. Hindle a,1, Sarita Hebbar b,2,DominikSchwudkeb,3, Christopher J.H. Elliott a, Sean T. Sweeney a,⁎ a Department of Biology, University of York, York YO10 5DD, UK b National Centre for Biological Sciences, Tata Institute of Fundamental Research, Bangalore, Karnataka 560065, India article info abstract Article history: Saposin deficiency is a childhood neurodegenerative lysosomal storage disorder (LSD) that can cause premature Received 1 September 2016 death within three months of life. -
Structure of Saposin a Lipoprotein Discs
Structure of saposin A lipoprotein discs Konstantin Popovica, John Holyoakeb,c, Régis Pomèsb,d, and Gilbert G. Privéa,c,d,1 aDepartment of Medical Biophysics, University of Toronto, Toronto, ON, Canada M5G 2M9; bMolecular Structure and Function, Hospital for Sick Children, Toronto, ON, Canada M5G 1X8; cOntario Cancer Institute, Campbell Family Institute for Cancer Research, Toronto, ON, Canada M5G 1L7; and dDepartment of Biochemistry, University of Toronto, Toronto, ON, Canada, M5S 1A8 Edited by Donald Engelman, Yale University, New Haven, CT, and approved December 17, 2011 (received for review September 23, 2011) The saposins are small, membrane-active proteins that exist in both functions to activate the sphingolipid hydrolysis reaction. How- soluble and lipid-bound states. Saposin A has roles in sphingolipid ever, structural flexibility is a crucial feature for the membrane catabolism and transport and is required for the breakdown of surface binding and lipid-solubilizing abilities of the saposin pro- galactosylceramide by β-galactosylceramidase. In the absence of teins (3, 18, 19). lipid, saposin A adopts a closed monomeric apo conformation Here, we characterize the interactions of saposin A with var- typical of this family. To study a lipid-bound state of this protein, ious amphiphiles. Saposin A undergoes a conformational change we determined the crystal structure of saposin A in the presence of in the presence of lipids and detergents and forms small lipo- detergent to 1.9 Å resolution. The structure reveals two chains of protein particles with a wide range of lipids. The 1.9 Å crystal saposin A in an open conformation encapsulating 40 internally structure of saposin A in complex with zwitterionic detergent bound detergent molecules organized in a highly ordered bilayer- lauryldimethylamine-N-oxide (LDAO) reveals two saposin chains like hydrophobic core. -
Exploring the Relationship Between Gut Microbiota and Major Depressive Disorders
E3S Web of Conferences 271, 03055 (2021) https://doi.org/10.1051/e3sconf/202127103055 ICEPE 2021 Exploring the Relationship between Gut Microbiota and Major Depressive Disorders Catherine Tian1 1Shanghai American School, Shanghai, China Abstract. Major Depressive Disorder (MDD) is a psychiatric disorder accompanied with a high rate of suicide, morbidity and mortality. With the symptom of an increasing or decreasing appetite, there is a possibility that MDD may have certain connections with gut microbiota, the colonies of microbes which reside in the human digestive system. In recent years, more and more studies started to demonstrate the links between MDD and gut microbiota from animal disease models and human metabolism studies. However, this relationship is still largely understudied, but it is very innovative since functional dissection of this relationship would furnish a new train of thought for more effective treatment of MDD. In this study, by using multiple genetic analytic tools including Allen Brain Atlas, genetic function analytical tools, and MicrobiomeAnalyst, I explored the genes that shows both expression in the brain and the digestive system to affirm that there is a connection between gut microbiota and the MDD. My approach finally identified 7 MDD genes likely to be associated with gut microbiota, implicating 3 molecular pathways: (1) Wnt Signaling, (2) citric acid cycle in the aerobic respiration, and (3) extracellular exosome signaling. These findings may shed light on new directions to understand the mechanism of MDD, potentially facilitating the development of probiotics for better psychiatric disorder treatment. 1 Introduction 1.1 Major Depressive Disorder Major Depressive Disorder (MDD) is a mood disorder that will affect the mood, behavior and other physical parts.