NDUFB6 (Human) Recombinant Protein (P01)

Catalog # : H00004712-P01 規格 : [ 10 ug ] [ 25 ug ] List All

Specification Application Image

Product Human NDUFB6 full-length ORF ( AAH29247, 1 a.a. - 128 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFW protein) NKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIV EKKSRIFPGDTILETGEVIPPMKEFPDQHH Antibody Production

Host: Wheat Germ (in vitro) Protein Array

Theoretical MW 39.82 (kDa):

Preparation in vitro wheat germ expression system Method:

Purification: Glutathione Sepharose 4 Fast Flow

Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing:

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction:

Note: Best use within three months from the date of receipt of this protein.

MSDS: Download

Datasheet: Download

Applications

Enzyme-linked Immunoabsorbent Assay

Western Blot (Recombinant protein)

Antibody Production

Page 1 of 2 2016/5/21 Protein Array

Gene Information

Entrez GeneID: 4712

GeneBank BC029247 Accession#:

Protein AAH29247 Accession#:

Gene Name: NDUFB6

Gene Alias: B17,CI,MGC13675

Gene NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa Description:

Omim ID: 603322

Gene Ontology: Hyperlink

Gene Summary: The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq

Other NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, Designations: B17),NADH-ubiquinone oxidoreductase B17 subunit,NADH-ubiquinone oxidoreductase beta subunit, 6,OTTHUMP00000021179,OTTHUMP00000021180,complex I, mitochondrial respiratory chain, B17 subunit

Gene Pathway Alzheimer's disease Huntington's disease Metabolic pathways Oxidative phosphorylation Parkinson's disease

Related Disease Diabetes Mellitus, Type 2 Genetic Predisposition to Disease Prostatic Neoplasms

Page 2 of 2 2016/5/21