spring/summer 2011

COMMENCEMENT 06 DRINKING THE WIND 16 GEORGE BEVERLY SHEA 18 HOUGHTON COLLEGE VOLUME 86, NO. 1 | SPRING/SUMMER 2011

Houghton magazine welcomes letters, alumni news, and art or photographs for possible inclusion in the magazine. All are subject to editing and the opinions expressed are those of the authors or their subjects and are not necessarily shared by the college or the editor. Send information in care of the editor to the college, or fax 585.567.9668, or e-mail magazine@ houghton.edu. Address changes should be sent to SGD KTLMH1DK@SHNMR.ÉBD 'NTFGSNM"NKKDFD  'NTFGSNM - 8   -DHSGDQ'NTFGSNM "NKKDFDMNQHoughton magazine is responsible for unsolicited mail received by persons who ask that their addresses be printed in the magazine. Written permission is required to reproduce Houghton L@F@YHMDHMVGNKDNQHMO@QS "NMSDMSR© 'NTFGSNM"NKKDFD

HOUGHTON MAGAZINE STAFF $K@HMD3NNKDX’ Editor Brandon Rush Lead Designer & Production Coordinator Elizabeth Mayhle Events & Graphic Designer/Traffic Coordinator #@MHDK-NXDR’ Executive Director of Alumni Relations Editorial Board Bruce Brenneman Cindy Lastoria Ronald Mahurin Daniel Noyes ’93 Elaine Tooley ’05 Bob Van Wicklin ’92 Scott Wade "NMSQHATSNQR Danielle Brenon ’12 CORRECTIONS Darby Emerson ’11 Doug Gaerte 6DL@JDDUDQXDÈNQSSNDMRTQDSG@SHMENQL@SHNMOQDRDMSDCVHSGHMSGHR Michelle Hillman ’08 publication is accurate and timely. The following notes are corrections Ben R. King for the HoughtonL@F@YHMDOTAKHRGDCHME@KKVHMSDQ  Daniel Noyes ’93 Shelley (Smith ’93) Noyes #Q '@QNKC,B-HDKHRRTQUHUDCAX›UDC@TFGSDQR@MC@RNM  Emily Sahm ’12 ,@QH@M2HLLR’V@RNLHSSDCEQNL#Q ,B-HDK’RNAHST@QXO@FD Jillian Sokso Photography Wesley Dean ’10 Mary (Gibson ’06) Dougherty Dan MacMahon (MacMahon Photography) Shirley Mullen ’76 Daniel Noyes ’93 Brandon Rush

Cover photo by Mary (Gibson ’06) Dougherty Printing Boncraft, a Zenger Group Company Buffalo, NY CONTENTS

06 16 18

in this issue 05 PRESIDENT’S MESSAGE 06 COMMENCEMENT 08 EXPRESSION 08 WHAT THE MUSIC’S ALL ABOUT 10 FORSYTH LEARNING COMMONS 12 CULTIVATING AN ARTISTIC COMMUNITY 14 ROOTED DEEP 16 DRINKING THE WIND 18 GEORGE BEVERLY SHEA ’32 22 ERIN BENNETT BANKS ’00 24 MARK VANDERHAAR ’99 26 FACULTY ACCOLADES 27 BOOKSHELF 28 ALUMNI NEWS & NOTES

HOUGHTON | 3 “ When we have learned to express ourselves with such clarity and grace that the light of the Glory of God shines through our lives, we will have done what we were made to do.”

–Shirley Mullen ’76

4 | HOUGHTON PRESIDENT

A WORD FROM THE PRESIDENT

e were made for expression.%QNLNTQ›QRSM@S@KBQXTMSHKNTQK@RSAQD@SG  we strive to communicate authentically the yearnings, the questions, the wonder, the exultations, and the hopes that lie deep within us.

At Houghton, expression is central to our spiritual growth. It is only through trying to translate our Christian faith into the concerns of WSGDBK@RRQNNL SGDBNLODSHSHUDDMUHQNMLDMSNESGD@SGKDSHB›DKC SGDBNMBQDSDL@SDQH@KNE clay, paint and wood, into music and drama, and real opportunities for love and for service that we come to see where the outward expression of ourselves does not match what is inside. The incongruence challenges us to grow. In those moments when there is congruence, we @QDBNM›QLDCVHSG@RDMRDNECHUHMDOKD@RTQD 3G@SSNNB@TRDRTRSNœNTQHRG@MCFQNV

At Houghton, expression is at the heart of learning. “Clear thinking is linked to clear writing,” as one of my former colleagues used to say. Every assignment is an ‘essay’ in the true meaning of that word. It is an attempt to give expression to what we have learned with BK@QHSX@MCOQDBHRHNMVGDSGDQSGD@RRHFMLDMSHR@ONDL @K@AQDONQS @QDRD@QBGO@ODQ  NQ@LTRHB@KBNLONRHSHNM@MCHMSG@SDWOQDRRHNMSNL@JD@BNMSQHATSHNMSNNSGDQR 

At Houghton, expression is more often than not a community and an interdisciplinary enterprise. 2STCDMSRBNNODQ@SDSNOQDRDMSSGDHQSGHMJHMFVGDSGDQSG@SHRHM@MDMRDLAKDKHJDSGD"NKKDFD Choir, the Science Honors Program, the thriving student-led theater culture, or on the athletic ›DKC  S'NTFGSNM XNT@QD@RKHJDKXSNLDDS@OGXRHBRRSTCDMSCHQDBSHMF@OK@X@R@M$MFKHRG major. (In fact, twoOGXRHBRL@INQR@MC@M@QSL@INQCHQDBSDCNMDNESGHRROQHMF’R›MDSGD@SQD OQNCTBSHNMRNMB@LOTRÕ2STCDMSR@KRNBNNODQ@SDHMADHMFSGD@TCHDMBDENQD@BGNSGDQ’RDWOQDRRHNM  6HSMDRRSGDUHAQ@MS@TCHDMBDRTOONQS@SRSTCDMSQDBHS@KR Lanthorn readings, concerts of the "NKKDFD"GNHQ 2XLOGNMHB6HMCR SGD)@YY$MRDLAKD @MCGNMNQRBDKDAQ@SHNMRNE@KKRNQSR 

At Houghton, expressionHR@V@XNEKHEDSG@SDWSDMCRVDKKADXNMCSGDBK@RRQNNL@MCSGD Houghton campus. The love of Christ manifested in individual and communal learning spills over into creative caring for others in Allegany County, in Western New York and around SGDVNQKC )TRSSGHRVDDJ (LDSVHSGQDBDMSFQ@CT@SDRVGNS@KJDC@ANTSGNV'NTFGSNMG@C prepared them to work creatively in new situations that required the translation of their learning into practical opportunities for serving at-risk youth and recent immigrants. This same call to ‘translate’ the love of Christ takes Houghton graduates to concert halls, law NÉBDR GNROHS@KR QDRD@QBGK@ANQ@SNQHDR BGTQBGOTKOHSR @MCDKDLDMS@QXBK@RRQNNLR 

When we have learned to express ourselves with such clarity and grace that the light of the Glory of God RGHMDRSGQNTFGNTQKHUDR VDVHKKG@UDCNMDVG@SVDVDQDL@CDSNCN 3G@SHRVG@S'NTFGSNMHR@ANTS

Shirley A. Mullen ’76

HOUGHTON | 5 COMMENCEMENT 2011 Danielle Brenon ’12

“It would be foolish to say that Houghton COMMENCEMENT is perfect, or that my feet have brought me to a place Class of 2011 where I’ve instantly been restored, or that this is an enchanted emporium of education. No place on Snapshot earth can give us that perfection. But it would be a beautiful truth to say that, at Houghton, I’ve met Co-Valedictorians – Deborah A. people who have given me a way to rest my feet.” Johnson and Katrina E. Koehler Salutatorian – Kristen A. Zingg Beyond the pacing and wandering in search of rest, Emily Rinehart ’11 shared @OD@BD ›KKDCthought not far from the minds of many Houghton graduates. 56 undergraduates RSGDXV@KJDCSGDHQ›M@KRSDORCNVMSGD@HRKDR@MC@BQNRRSGDRS@FDNE achieved double majors 6DRKDX"G@ODK SGD"K@RRNEŽTMCDQFQ@CT@SDR@MC›UDL@RSDQ’R graduates—moved their feet into the next chapter of their lives. 93 graduated with honors

“Today you have become graduates of Houghton College,” President Shirley A. Mullen ’76 Graduates came from 12 told the Class of 2011. “You have been invited to live very large lives…you have been countries including Australia, challenged to use your gifts in service to the church, to your local community, and Barbados, Brazil, Canada, SNSGDVNQKCHMANSGOK@BDRNEONVDQ@MCHMœTDMBD @MCHMOK@BDRVGDQDNMKX&NC China, Great Britain, Guatemala, VHKKRDDXNTL@JHMF@CHÈDQDMBD†XNTG@UDADDMOQDO@QDCVHSGSGDRJHKKRSNAD Honduras, Kenya, Thailand, independent, life-long learners – ready to deal with the changes that will confront Uganda and the United States. you at every stage of your life…you have been prepared with the communication FHESRSNADODNOKDNEHMœTDMBD@MCVHSGSGDBG@Q@BSDQSQ@HSRSNADODNOKDNE The class of 2011 includes Audrey substance…and, you have been charged to be purveyors of hope.” Gillette, the great-niece of George Beverly Shea ’32 and Alton Shea ’36; %QNLSGD&NKCDM'HFGK@MCDQ"K@RR Sharon (Widrig) Karakaian ’61 shared with Shannon Daugherty, the great- the Class of 2011 that “Fifty-four years ago the class of 1961 selected three simple granddaughter of H. Willard words as our class motto: IN HIS STEPS, taken from 1 Peter 2:21. This verse has Ortlip, the artist who painted the been a good reminder for me throughout the years to stay focused on the Lord CTQHMFANSGSGDFNNCSHLDR@MCSGDCHÉBTKSSHLDR ,XGTRA@MC@MC(GNODSG@SXNT mural in the John and Charles VHKKENKKNVHMSGDRSDORNE"GQHRS@MC›MCOD@BD@MCETK›KKLDMSHMSGDC@XR@GD@C  Wesley Chapel; and Michael Pocock, the great-great-great Dr. Evvy Hay Campbell, commencement speaker and chair professor of nephew of Melvin Warburton, HMSDQBTKSTQ@KRSTCHDR@S6GD@SNM"NKKDFD&Q@CT@SD2BGNNK SHSKDCGDQ@CCQDRR Houghton’s first graduate in 1888.  M4MVQHSSDM"G@OSDQ@MCSGD"G@MBDSN&DS(S1HFGS (MGDQBNLLDMSR  RGDDWOK@HMDCGNV&NCHRRSHKKVQHSHMF'HRRSNQX@MCHRHMUHSHMFTRSNAD part of that writing. “Houghton College graduates of the Class of 2011, 01 L to R: Co-Valedictorian Deborah write your chapter well,” Campbell stated. “You have a chance to get it A. Johnson, Salutatorian Kristen A. QHFGS L@JD@CHÈDQDMBD KHUDVHSGINX @MCJMNVSG@SHM@KKNEKHED  Zingg and Co-Valedictorian Katrina E. walking beside you is the risen Christ. Run your race well.” Recognizing Koehler. 02 Board of Trustees Chair GDQQHBG@MCLTKSHE@BDSDCINTQMDXNEE@HSGETKMDRR /QDRHCDMS,TKKDM@MCSGD Bobbie Strand, President Shirley Mullen class of 2011 received her words with hope and honor. Dr. Campbell received ‘76, Commencement speaker Evvy Hay Campbell and General Superintendent an honorary Doctor of Divinity degree from Houghton College in 1996. of The Wesleyan Church Jo Anne Lyon.

6 | HOUGHTON 02

01 HOUGHTON | 7 Expression: What theMusic’s KK ANTS Ben R. King, Professor of Voice Director and Associate Dean, Greatbatch School of Music

a strong connection decades later. The names We sing the human condition. That’s what Finney and Cronk need little explanation to LTRHBH@MRCNVDDWOQDRRHMRG@ODCRNTMC@MCRHKDMBDVG@SHSHRSNAD@GTL@MADHMFŽSN anyone familiar with music here. More recently, HMG@AHS@ANCX SNCVDKKHMSGD"QD@SHNM SNSGHMJ SNEDDK SNE@KK @MCSNRN@Q &NC@OOD@QRSNG@UD Allen, McNiel, Huizenga, Bailey, Brown, made music one of humankind’s greatest gifts to articulate our deepest emotions, yearnings, '@KADQF 1DHFKDR &@KKNV@X 6HKS "NMFCNM  @ROHQ@SHNMR@MCGNODR !HAKHB@KKX LTRHB@OOD@QRSNADVNUDMHMSNSGDE@AQHBANSGNE3HLD@MC Norton, King, and Hijleh join the list of those $SDQMHSX 6D@OOD@QSNADCDRSHMDCSNADLTRHBL@JDQRRNNMDQNQK@SDQ @KKNETR VGDSGDQHM whose service to music and to Houghton is SGHRVNQKCNQSG@SXDSSNAD (S’R@BNMTMCQTLRNE@Q@RD@QSGKXDWODQHDMBDHRBNMBDQMDC LTRHB counted in decades rather than years. unfolds in time. It has to. That’s its inherent nature. Scripture seems to indicate pretty clearly -NV SG@S’RMHBD@MC@KK ATSSGDQD@RNMSGNRD that music is a part of Heaven’s adoration in Eternity. It’s interesting that “When the trumpet ENKJRVDQD@MCQDL@HMGDQDHRADB@TRDNESGD of the Lord shall sound/And Time shall be no more†-NSHLD MNLTRHB$UHCDMSKXMNS  RSTCDMSR VGNG@UDMTLADQDCLNQDSG@M  'NTFGSNMG@RADDM@OK@BDVGDQDLTRHBŽSGHRONVDQETKFHES@MCSNNKŽG@RADDMO@QSHBTK@QKXU@KTDC over the years and who have left Houghton to @MCBDKDAQ@SDCENQSGDFQD@SL@INQHSXNESGDHMRSHSTSHNM’RGHRSNQX 6GX%Q@MJKX HS’RADB@TRDNEJDX make music, teach music, compose music, and ODNOKDVGNG@UDADDMKDCGDQD G@UDBGNRDMSNBNLDGDQD @MCVGNG@UDHMUDRSDCPTHSDKHSDQ@KKX RDQUD@BQNRRSGDFKNADHMV@XR@RCHUDQRD@R centuries of time in fostering the thesis that a rich musical life for Houghton and the surrounding L@XADHL@FHMDC  LNMFSGDL@QD6XBKHÈD BNLLTMHSXV@RVNQSGSGDDÈNQS@MCVNQSGSGDBNRS #TQHMFBQHSHB@KCDB@CDRHMRNKHCHEXHMFLTRHB@S translators, pastors, professors, men and women Houghton, the faculty seems to have had a way of sticking to the place: the Bain Voice Fellowships HMATRHMDRR OGXRHBH@MR GTMCQDCRNELTRHB @QDL@CDONRRHAKDAX@FHESNE6HKEQDC@MC,@QX!@HM VGNENTMCDCSGD"NKKDFD"GNHQ@MCRSHKKEDKS teachers, church musicians, and on and on.

8 | HOUGHTON (’CKHJDSNSDKKXNT@ANTSRNLDNESGD EXPRESSION LNQDQDBDMSENKJR DLAKDL@SHB@MC God appears to have made music one of humankind’s illustrative of all of our music alumni. greatest gifts to articulate our deepest emotions, THE DRUMMER yearnings, aspirations and hopes. Matthew Teodori ’07 came to Houghton from 1HBGLNMC 5@ 'HRODQBTRRHNMA@BJFQNTMCV@R K@BJHMFHMDWODQHDMBDATSGDG@C@QDL@QJ@AKD VNQJDSGHB ,@SSBNTKCADRDDMNESDMHMSGD have known, Emily was forever asking questions. After student teaching she knew that she wanted instrumental rehearsal hall, practicing mallet SNGDKOODNOKDATSV@RKDRRRTQDSG@S@* LTRHBBK@RRQNNLV@RSGDOK@BDRGDRGNTKCCNHS %NQ SDBGMHPTDE@QHMSNSGDMHFGS 'DV@R@AKDSN several years after graduation, Emily worked in the helping professions, singing and playing in VNQJVHSGRTODQAL@INQOQNEDRRNQ )HL3HKKDQ  BKTARNMSGDRHCD %HM@KKXGDQS@KDMSR@MCB@KKHMFRBN@KDRBDC @MCSGHRO@RSE@KK$LHKXL@SQHBTK@SDC principal percussionist of the Rochester in the graduate program in music therapy at SUNY (State University of New York) New Paltz. /GHKG@QLNMHB /QNA@AKXMNQDBDMSFQ@CT@SD has had a higher trajectory of growth from entry to graduation. Matt was accepted to the THE DOCTOR graduate performance program in percussion )DÈ3GNLORNM’UHNKHMHRS OH@MHRS SDMNQ (RTRODBSSG@S)DÈRODMSLNQDSHLDHMSGD"DMSDQENQSGD studies at the University of Texas-Austin and is QSRSG@MHMSGD/@HMD2BHDMBD"DMSDQ@MCV@R@BSHUDHMITRS@ANTSDUDQXLTRHB@KDMCD@UNQ@U@HK@AKD MNVHMSGD›M@KRS@FDRNEGHRCNBSNQ@KOQNFQ@L while completing his pre-med studies, thus earning a Bachelor of Science degree and a contract in percussion performance there while also minor in music. He also served the Houghton Volunteer Fire Department as an EMT. Now an playing professionally with a percussion trio. DLDQFDMBXQNNLOGXRHBH@M )DÈHR@KRN@BSHUD@R@BGTQBGLTRHBH@M@MCODQENQLDQHMSGD!TÈ@KN@QD@

THE PIANIST-CONDUCTOR THE SINGER-ATHLETE Adam Potter ’07 arrived at Houghton as a Jennifer (Hartenstine ’00) FeltyB@LDSN'NTFGSNMSNRHMF@MCOK@XRNBBDQ 2GDCHCANSGENQ result of his attendance at Houghton’s long- four years and did extraordinarily well. She was the leading scorer on the women’s soccer QTMMHMFRTLLDQ/H@MN"@LO @AKXL@M@FDC team her senior year and was named National Player of the Week and Regional Player of AXOH@MNOQNEDRRNQ1NADQS&@KKNV@X  C@L the Week twice that year, was All-American, won a leading role in Houghton’s production AQNTFGS@MDWTADQ@MSDMDQFX@MCO@M@BGDSN of Carousel her freshman year, and was working professionally in regional musical theater GHRBNMRHCDQ@AKDOH@MNRJHKKR@MCODQENQLHMF ADENQDFQ@CT@SHNMEQNL'NTFGSNM. Following her professional experience, she earned passion. While here he expanded his GDQL@RSDQ’RCDFQDDEQNL/DMM2S@SD@MCHRMNVGD@CNESGD›MD@QSRCDO@QSLDMS@S+HSHSY ODQENQL@MBDRJHKKRSNHMBKTCDBDQSH›B@SHNM "GQHRSH@M2BGNNKVGHKDQ@HRHMF@E@LHKX@MCADFHMMHMFSNBNMRHCDQCNBSNQ@KRSTCHDR HMLTRHBDCTB@SHNM  R@RDMHNQGDADB@LD 3GDRDEDVFKHLORDR@QD@›MDHMCHB@SNQNESGDVGNKDNEVG@S'NTFGSNMLTRHBH@MR convinced that choral music was where do and are in their lives. We are extraordinarily proud of all of them. his future passions lay and enrolled in the &QD@SA@SBG2BGNNKNE,TRHBL@RSDQ’RCDFQDD 3GD@BSHUHSXCHQDBSNQNE'NTFGSNM’RRDMHNQB@QDBDMSDQ  ARNKTS"@QD R@XRSG@SSGD@MMT@KRDQUHBD program as a choral conductor. Following an projects of students in our Music in Christian Perspective course are the highlight of residents’ outstanding graduate tenure, he was quickly C@XR@MCHRRNFQ@SDETKENQSG@SS@MFHAKDBNMSQHATSHNMSNSGDKHUDRNENTQMDHFGANQRSGDQD .MSGD GHQDCHM@+HUHMFRSNM"NTMSX - 8 LTRHB AQN@CDQRB@KD LTRHBDCTB@SHNMHM* HR@ONVDQETKSNNKENQAQHMFHMFRSTCDMSRHMSNDPT@KHSXNE ONRHSHNM 'HRUDQX›QRSXD@QNMSGDINA GHR opportunity through the study and making of music. Tens of thousands of children around the position was made a target for elimination in VNQKCENQ'NTFGSNMLTRHBH@MRSD@BG@BQNRRSGDOK@MDS@QDCQ@VMHMSNSGDG@AHSRNECHRBHOKHMD CHRSQHBSATCFDSBTSR 6GDMSGHRADB@LDJMNVM  @MCOQ@BSHBD HMSN@OOQDBH@SHNMNESGDAD@TSHETK @MCHMSNRJHKKRSG@SSQ@MREDQ@BQNRRL@MX the degree and amount of parent, teacher, and disciplines. Music in the lives of children is an amazing equalizer, whether in Irondequoit student support for the work he was doing Middle School or in Argentina’s massively successful El Sistema !XSGDHQBNMSQHATSHNMRSNLTRHB QDRTKSDCHMSGDONRHSHNMADHMFQDS@HMDC in Christian worship—helping form ‘the churches’ song,’ as Professor Judy Congdon so aptly OTSRHSŽ'NTFGSNMLTRHBH@MR@QDBNMSQHATSHMFSN*HMFCNLKHEDVGDQDSGDX@QDHM@ONVDQETKV@X  THE ECLECTIC assisting those congregations in worship that prepares for service to the world around them. Emily Whittaker ’00HR@MNANHRS $LHKX For these and so many other reasons, we continue to express in shaped sound and is a singer. Emily is a guitarist. Emily is a RHKDMBDVG@SHRSNAD@GTL@MADHMFŽSNHMG@AHS@ANCX SNCVDKKHMSGD"QD@SHNM  songwriter. A music education major with to think, to feel, to fall, and to soar. We sing the human condition. NMDNESGD›MDRS@MCLNRSHMPTHQHMFLHMCR(

HOUGHTON | 9 The Sally and Benn Forsyth

Doug Gaerte, Professor of Communication

The Sally and Benn Forsyth Learning Commons ribbon cutting. L to R: Sally Forsyth, Bruce Forsyth, Benn Forsyth and President Shirley Mullen ’76 NTFGSNMG@R@KV@XRADDM@ EXPRESSION place where creativity thrives. “ What’s most exciting is that this new resource will Generations of music students help students in a range of majors, not just art and have worked under talented BNLLTMHB@SHNM ,TRHB RBHDMBD ATRHMDRR@MCDCTB@SHNM instructors to explore the Hrange of musical expression. Art students have L@INQRVHKKAD@AKDSNADMD›SEQNLSGDRDSNNKR  helped us view the world in new ways through –Nathan Lammey ’12 paint, pastels and clay. Poets and essayists have given voice to powerful emotions and musings, while dramatic performers have AQNTFGSSNKHEDQHBGBG@Q@BSDQRDMF@FDCHM BNMœHBS@MCQDRNKTSHNM 6GHKDRTBGSQ@CHSHNM@K Huth was working with several students. Huth @MC@BDQSH›DC/QN3NNKRHMRSQTBSNQ 'NTFGSNM forms of expression continue to thrive at stepped out into the hall, introduced himself, is one of only three Christian colleges in the Houghton, current students often display their @MCRG@QDCRSNQHDR@ANTSRNLDNESGDBQD@SHUD 4MHSDC2S@SDRSNADCDRHFM@SDC@R@M@TSGNQHYDC work students were doing and the vision for the creativity on a computer monitor, through training partner in Pro Tools. Music and media arts program. Interested in what they had SGDKDMRNE@B@LDQ@ NQNM@LHWHMFAN@QC  communication students apply their creativity RDDM SGD%NQRXSGRADF@M@BNMUDQR@SHNMVHSGSGD to compose, record, edit, and mix music or In 2006 Houghton College committed @CU@MBDLDMSNÉBD SGDCD@M’RNÉBD @MCSGD RNTMC  QSRSTCDMSRVNQJHMFHMSGD+D@QMHMF to expanding the range of opportunities communication department, eventually leading "NLLNMRL@XADVNQJHMFNML@MHOTK@SHMF @U@HK@AKDENQBQD@SHUDDWOQDRRHNM 6HSGSGD to the generous gift that has made the new digital photographs, designing T-shirt graphics, support of colleagues in English and writing, +D@QMHMF"NLLNMR@QD@KHSX  RSGD%NQRXSGR NQBQD@SHMFONRSDQR@MCAQNBGTQDRENQ@FQ@OGHB the communication program launched a expressed it: “What we need is Christian design project, while communication majors new course of study in media arts and visual leadership in society. The only way you’re going @QDKHJDKXSNADDCHSHMFUHCDNENQ@BK@RROQNIDBS communication. David Huth ’91 accepted the to get Christians into the leadership positions of or for creating a promotional video piece for BG@KKDMFDSNINHMSGDE@BTKSX@MCGDKOATHKCSGD ATRHMDRR@MCFNUDQMLDMSHMNQCDQSNRDS@GHFG an international development organization. MDVOQNFQ@L  RL@KKLDCH@K@AV@RRDSTOHM LNQ@KRS@MC@QCHRAXDCTB@SHNM 3GHRK@AVHKK 6HSGSGDMDVQDRNTQBDR@U@HK@AKDHMSGD%NQRXSG space carved out of a traditional classroom, increase the intensity of students’ education and +D@QMHMF"NLLNMR RSTCDMSR@MCE@BTKSXHM @MCHMSGDROQHMFNE RSTCDMSRADF@M encourage them to shoot for a higher plane. That @MDUDMVHCDQQ@MFDNEL@INQRVHKKAD@AKDSN SGDHQ›QRSBK@RRDR 3GDMDWSXD@QRDUDQ@KLNQD is very positive and very good.” The Forsyths use technology to enhance their learning. L@BGHMDRVDQDBQ@LLDCHMSNSGDK@A ATSHS GNODSG@SSGDMDV+D@QMHMF"NLLNMRVHKKAD V@RHLONRRHAKDSNJDDOTOVHSGSGDCDL@MC  attractive to prospective students as well as While Houghton students frequently take Waiting lists for many media classes sometimes enhancing the quality of instruction for those their education outside the classroom, the new DWBDDCDCSGDMTLADQNERSTCDMSRDMQNKKDC (MNÈ current students who will use the new resources. LDCH@SNNKR@U@HK@AKDHMSGD+D@QMHMF"NLLNMR make real-life application even easier. Junior GNTQRVGDMBK@RRDRVDQDMNSLDDSHMFHMSGDK@A  /K@MMHMFENQSGDMDV+D@QMHMF"NLLNMRADF@M Bethany Josephs and sophomore Andrew Jones, students from across campus came in to use the in earnest during the Fall 2010 semester, and for example, under the direction of Professor K@AENQSGDHQNVMBQD@SHUDVNQJDCHSHMFUHCDNR as campus cleared out for the Thanksgiving 1X@M3GNLORNM BQD@SDC@VDARHSDENQSGDHQWeb SNOQDRDMS@S2/.3NQSNB@OSTQDSGDLDLNQHDR AQD@J @BST@KBNMRSQTBSHNMADF@M 3GQNTFG Communication class that attracted the attention of a mission trip, preparing entries for the SGD›M@KVDDJRNESGDE@KKRDLDRSDQ@MCHMSN of potential donors and resulted in a $500 gift to Houghton College Film Festival, doing layout SGD›QRSVDDJRNESGDROQHMF SGD%NQRXSG a local charity. Houghton students are not only work for the Star, or designing media projects +D@QMHMF"NLLNMRADF@MSNS@JD›M@KENQL  BQD@SHUDATSL@MXG@UD@O@RRHNMENQTRHMFSGNRD for class assignments in departments across @MCAXLHC %DAQT@QX RSTCDMSRVDQD›M@KKX RJHKKRSNL@JD@CHÈDQDMBDHMSGDBNLLTMHSX campus. Some semesters, one-third of media @AKDSNADFHMVNQJHMFHMSGDMDVK@A  K@ATRDQR QDOQDRDMSHMF@VHCDQ@MFDNEL@INQR  Thanks to the generosity of Benn and Sally 3GQDDCDO@QSLDMSRBTQQDMSKXNÈDQBK@RRDRHM were not even enrolled in a media course. Forsyth, the talent and vision of gifted faculty, the Commons: art, music and communication. and the energy and creativity of Houghton As often happens in times of need, God provides. O@QSMDQRGHOADSVDDMSGD&QD@SA@SBG2BGNNK students, the next generation of Houghton In the summer of 2009, Benn and Sally Forsyth, of Music and the communication department who have long had a passion for Christian higher allows students to take a sequence of audio RSTCDMSRVHKKADVDKKOQDO@QDCSNRSDOENQV@QC education, arranged a tour of campus with an recording courses using Pro Tools software. @MCL@JD@CHÈDQDMBDENQ"GQHRSHMSGDVNQKC  @CU@MBDLDMSNÉBDQ #TQHMFSGDB@LOTRSNTQ Kevin Jackson, who teaches the courses, is the Forsyths walked past the K@AVGDQD/QNEDRRNQ the college’s director of sound and recording

HOUGHTON | 11 HOW WE ENCOURAGE THE EXPRESSION OF CHRISTIANITY THROUGH THE VISUAL ARTS Jillian Sokso, Assistant Professor of Art

QD@KKXKNUDLXNÉBD (S’RBNYXBQNVCDC BG@QLHMFKXLDRRXNJ BNKNRR@KKXRN@MCETKKNE South, to manila grown in southeast Asia, to SGHMFRSG@S(B@QDCDDOKX@ANTS 5NKTLDRNMSGD@KKTQDNESGDG@MCL@CD@MC@ARSQ@BSO@HMSDQR LTKADQQX@MCF@LOHEQNL)@O@M 1HFGSMNV SG@SHMœTDMBDCLXTMCDQFQ@CT@SDVNQJ LX,DMMNMHSDGXLM@K VNQJRHMOQNFQDRR SNNKR SGDX@QDVNQJHMFNMDLADKKHRGHMF@ONQSHNM ENQAHMCHMFANNJR @MCOHBSTQDRNELXBGHKCQDM@RHME@MSRNBBTOX@KLNRSDUDQXRTQE@BD  NESGDHQDÈNQSR LDSHBTKNTRKXDLANRRHMF  3GDEQNMSV@KKHRL@CDNEVHMCNVRSG@SKNNJNTSHMSNSGDOQHMSL@JHMFRSTCHN @MCADXNMC L@QAKHMF OQHMSHMF@MCBNLAHMFCDBNQ@SHNMR SG@S@V@KKNEVHMCNVRKNNJNTSNMSNSGDGHKKRHCD@MCCNVMSNSI GD"DMSDQENQSGD QSRATHKCHMF  NMSNU@QHNTRRGDDSR +@SDQHMSGDSDQL SGDX’KK There’s not a lot of privacy here, and I rarely close my door. The students come and go, working, HMBNQONQ@SDSGDRDO@ODQRHMSNG@MCL@CDANNJR ATHKCHMF BG@SSHMF @MCRSTCXHMFSNFDSGDQ 6D’QD@GNCFDONCFDNE@QSHRSR@MCNARDQUDQR L@JDQR@MC with illustrations, printed text and various @RRHRS@MSR /DNOKD@RJHE(LHMCSG@SLXNÉBDRO@BDHRHMRTBG@OTAKHB@QD@ 3GDANTMC@QXADSVDDM BNMRSQTBSHNMR@MCAHMCHMFRSG@SFHUDSGDUHDVDQ SGDNÉBD@MCRSTCHNHRAKTQQDC @MCSGDQDHRMDUDQ@MXCNTAS@RSNVG@S(’L@SSDMCHMFSNHMGDQD a glimpse of the content within. Tomorrow sometimes reading, drawing, often considering a wall of prints or comparing student assignments. VD’KKRHS@QNTMC@AQN@C BNTMSDQ GDHFGSS@AKD during our class, sharing and comparing the 6GXRGNTKCSGDQDAD@ANTMC@QX.EBNTQRDVDB@M@KKTRDOQHU@BX @PTHDSOK@BDSNB@KKNTQNVM results and ooohhing and aaahhhing over the ENQQDœDBSHNMNQUDQXENBTRDCVNQJ 3QTKXSGNTFG HE(VDQDM’SHMSGDSGHBJNEHS (LHFGSLHRRRNLD DÈNQSRNESGDRDK@RSVDDJRNNGGR@MC@@GR  of the most exciting things that happen here. The real magic of the studio class often happens NEBNTQRD NAKHF@SNQX (SVHKKAD@BQHSHPTDATS outside of the class meeting time. I’m rather interested in seeing what the students do when it will have the feeling of a potluck meal in a they are left to their own devices. From my seat here I can survey the minute-to-minute daily fellowship hall. We’ll all walk away feeling full. QHST@KSG@SLXRSTCDMSRNARDQUD 3GDQD’R@QGXSGLSNSGDC@XSG@SB@QQHDRLDSGQNTFG @MCHS has so much to do with the visual feast that takes place just outside my door and windows. When I watch, as I am now, a student lower a sugeta (Japanese papermaking mould and (’LKNNJHMFNTSMNVNM@QNNLATRSKHMFVHSGSGD@BSHUHSXNE@MD@QCD@CKHMDENQLX@QSHRSR’ANNJ deckle) into a cloudy vat of hand-pounded @MCO@ODQBNTQRD .UDQSGDK@RSENTQVDDJRSGDRDRSTCDMSRG@UDL@CDNUDQ RGDDSRNE6DRSDQM ›ADQR@MCOTKKHSTO RG@JHMFSGDOTKO@QNTMC  @MC$@RSDQMO@ODQ VHSG›ADQRQ@MFHMFEQNLBNSSNM@MCGDLOBTKSHU@SDCHMSGD-NQSG LDQHB@M CQ@HMHMFNÈSGDV@SDQAXSHKSHMFSGDLNTKCSN

12 | HOUGHTON EXPRESSION

one side, I have an emotional and spiritual VHSGHMSG@S@ÉQL@SHNMSG@SOQNUHCD@QHBGK@MCRB@ODNEDWOQDRRHNM ,TBGHMSGDV@XSG@SNMDKD@QMR QD@BSHNM 6D’UDS@KJDCHMBK@RR@SKDMFSG@ANTS SGDENQL@KDKDLDMSRNE@QSL@JHMFAXOQ@BSHBHMFS@RJRTMSHKSGNRDDKDLDMSRADBNLDHMSTHSHUD SGD the history and cultural relevance of Japanese studio practitioners interested in visual expressions of faith achieve a genuine connection to their papermaking. We’ve discussed the process of VNQJ@MCSGDHQ@TCHDMBDAXHCDMSHEXHMFV@XRSNBNMMDBSSGDENQL@KDKDLDMSRSNSGDBNMSDMSNESGD BTKSHU@SHNM@MCOQDO@QHMFSGDRD›ADQR V@SBGHMF OHDBD 3GHRBNLLTMHSXSG@SHRENRSDQDCHMSGDRSTCHNAQHMFRRSTCDMSRSNFDSGDQSNV@KJSGQNTFGSGD ›KLR@MCQD@CHMFRDKDBSHNMRNMSGDE@QLHMF  ENQL@K@MCBQ@ES QDK@SDCHRRTDRVGHKDDWOKNQHMFSGDHQODQRNM@KHCDMSHSHDR@MCDRS@AKHRGHMFSGDLDR the harvest, and the steaming and stripping of @MCBNMSDMSQDK@SDCSNSGDHQBTQQDMSODQRNM@KQDK@SHNMRGHORVHSG"GQHRS 6DS@KJ@SKDMFSG@ANTSGNV A@QJ@MCA@RS›ADQ -NV(NARDQUDSGDCDKHB@SD to use our spiritual selves to inspire and inform the process of making images and communicating movements of a student who, in a few short SGNRDHCD@RSN@M@TCHDMBD (SADBNLDR HM@RDMRD @MDU@MFDKHRSHB@OOQN@BGSNSGDRSTCHNOQ@BSHBD  VDDJR G@RF@SGDQDCSGD@AHKHSXSNQDOKHB@SD 3GDRSTCDMSRKD@QM@ANTSGNVSNL@JDHL@FDR ATSSGDX@KRNKD@QMGNVSNSTQMSGHRBNMUDQR@SHNM the practice of a tradition thousands of years into an opportunity to express their ideals and truths to others who may view those images. old. This practice – meditative and graceful, SSHLDRSGDRDBNMSDMSSGDLDR@QDUDQXRODBH›B  RSTCDMSL@XBGNNRDSNVNQJVHSGHL@FDQXSG@S physical yet demanding in mental concentration ROD@JRSN@LHRRHNMDWODQHDMBD $@BG@RRHFMLDMSL@XAD@MHL@FDSG@SQDOQDRDMSRDWODQHDMBDR ADBNLDR@M@BSSG@SHRR@BQ@LDMS@K +HJDL@MX that the students can then share and discuss during late-night studio discussions, class work of the tasks and practices that we undertake ODQHNCR QDUHDVR@MCBQHSHPTD 2NLDSHLDRSGDBNMSDMSHRLTBGKDRRRODBH›B @MCRSTCDMSR HMSGDRSTCHNR HSG@RSGDONVDQSNNÈDQPTHDS BGNNRD@LNQDRTASKDHMSDQOQDS@SHNM RTBG@REDDKHMFRSG@S@QDHMROHQDCAXNARDQUHMFSGDM@STQ@K LDCHS@SHNM@MCQDœDBSHNMVGDMOQ@BSHBDC@KNMD  world. It’s not often that I ask my students to illustrate Scripture. The approach is much more NQ@QNATRS BNKK@ANQ@SHUDDWBG@MFDHM@FQNTO  NQF@MHB ODQRNM@K@MCKDRROQDRBQHOSHUDSG@MSG@S (SENRSDQR@LNQD@TSGDMSHBHMSDQ@BSHNMADSVDDM 3GDRSTCHNRG@UDADBNLD@SHFGSBNNODQ@SHUD the student and his or her pieces, and it helps us all to know one another in a real way. for me and for the students and faculty that 4KSHL@SDKX(GNODSG@SSGDVNQJSG@SSGDRDVNTKC AD@QSHRSRL@JDHRHLONQS@MSSNSGDLSG@S teach and learn here. The physical space and the making of the work is cathartic and revealing. I hope that the act of developing a concept, the work that we do here cultivate a covenant experiencing and understanding media that will help to convey that concept, and executing of sorts, and that covenant is deepened as we a piece that expresses helps them to know themselves and encourages them to ask questions perform tasks, as we discourse, and as we study @ANTSSGHMFRTMJMNVM (SGHMJSG@S@BNLODKKHMFQD@RNMSG@S@QSHRSRBQD@SDHRADB@TRDVD the history and the contemporary contexts of have questions. It’s the conversation, the relationships and interactions that surround those art. The cultivation of skills and the practice questions that fuel a studio practice. Sometimes the artist alone can’t answer these questions, of making artworks – indeed the practice of @MCODQG@ORSGDPTDRSHNMR@QDMNSDUDMLD@MSSNAD@MRVDQDC 3GDBNKK@ANQ@SHUDONRRHAHKHSX ADHMF@M@QSHRSNODMR@AQN@C@UDMTDENQSGD that exists in the studio fuels the conversation, and the relationships and potential connections expression of faith and the illustration of one’s @QDVG@SJDDOTRATRXGDQD 3GDATHKCHMFTONED@BGNSGDQ@MCSGDCQ@VHMFSNFDSGDQNEHCD@R HCD@R@R@LDLADQVHSGHM@ANCXNEADKHDUDQR  are what encourage our expression of Christianity within the visual arts. Indeed, the act of 3GDBK@RRQNNL RSTCHNNQBNNODQ@SHUD ADBNLDR practicing these tasks together is a physical manifestation of a living God among us. @LDLADQRGHORSDDODCHMNTQ@ÉQL@SHNMNESGD KNQCRGHONE)DRTR"GQHRS ATSHSHRNTQCHÈDQDMBDR

HOUGHTON | 13 Darby Emerson ’11 (G@UDADDMFHUDMSNSDRSHEXSNSGDFNNCMDVRHM for Christ to have the supremacy in every EXPRESSION Some people say that LXKHED .MSGDUNKKDXA@KK@MCSQ@BJSD@LRGDQD  aspect of my life. It was in the context of the 'NTFGSNMHR@ATAAKD (KHJDSN (V@RAKDRRDCAXVDDJKXSD@LCDUNSHNM@KRSG@S classroom that I recognized how the passions think of it as a greenhouse. ›WDCNTQDXDRTONMSGD+NQC 6DCD@KSVHSG SG@S(V@RFHUDMENQ@O@QSHBTK@QHMSDQDRSBNTKCAD successes and failures –the challenges and congruent with His plan for my life. In this I was As I looked for a place to spend my four INXRNEADHMFO@QSNE@ANCXVNQJHMFSNFDSGDQ given a deeper sense of calling to my vocation. XD@QRNETMCDQFQ@C (JMDV(V@MSDCSNAD ENQ@BNLLNMFN@K ,XFN@KRVDQDQD›MDC@MC As we gathered together in chapel, I experienced somewhere where I could grow not only QDCD›MDC -NKNMFDQCN(V@MSSNAD@CNBSNQ the gift of community with intentionality. The @B@CDLHB@KKX@MC@SGKDSHB@KKXATS@KRN ENQSGDR@JDNEADHMF@CNBSNQ -NV(RDDLX friends and acquaintances here at Houghton ROHQHST@KKX 3GD+NQCOQNUHCDC'NTFGSNM@R aspirations as part of the race I am supposed to who came alongside me and pressed me on SGDOK@BDENQSG@SRDDCKHMFNECDRHQDSNAKNNL  QTMGDQDHMLXAQHDEKHED (GNODSNTRDVG@SDUDQ were part of a direct mode of grace God gave to career path I choose for “the task of testifying .TQ"QD@SNQG@ROQNUHCDCLDVHSG@CDDO LD (VHKK@KV@XRADSG@MJETKENQSGHR'NTFGSNM to the good news of God’s grace” (Acts 20:24). appreciation and awe for Him for as long as I community that helped to shape me. In my B@MQDLDLADQ &QNVHMFTONM@Q@MBGA@BJ (MSGDBK@RRQNNLOQNEDRRNQRSG@MJDCSGD+NQC time here at Houghton, I have grown to see home in Colorado, I saw the majesty of His for keen minds as they pushed us to the potential what that stewardship looks like in my own creation in the land, crops and animals. I of our intellect. Coaches, professors, advisors KHEDOTSSHMFLX,@RSDQ@MC'HRJHMFCNL›QRS JMDVVDVDQDRTOONRDCSNADFNNCRSDV@QCR @MCRTODQUHRNQRNMB@LOTRG@UDAK@YDC@SQ@HK HM@KK(CN (SHRVHSGSGDNTSœNVNEFQ@SHSTCD of the gifts that God had given us there on for me to follow. My organic chemistry professor that I press on in my day-to-day duties. SGDQ@MBG 'HRBQD@SHNMV@RSNADGNMNQDC in particular was a woman who I respected In a greenhouse, tender young plants are AXTR "NLHMFSN'NTFGSNM (ENTMCSG@S( deeply. Dr. Karen Torraca ’93 took interest in intentionally placed for growth to occur. MDDCDCSNQDCD›MDRSDV@QCRGHO 2TCCDMKX me and agreed to meet with me on a weekly They are rooted deep in good soil and (V@RRTQQNTMCDCAXODDQRVGNR@VSGDMDDC A@RHRNUDQSGDK@RSSVNXD@QRNELXSHLDGDQD@S MNTQHRGDCAXSGDHQJDDODQVHSGNMKXSGDLNRS ENQSGDHQ@AHKHSHDRSNADRSDV@QCDCVHRDKX  Houghton. In our interactions we discussed ADMD›BH@KSGHMFR 3GDX@QDMNSHMSDMCDCSN matters of life, our relationship with God, and 5NKKDXA@KK@MCSQ@BJSD@LL@SDRQDLHMCDCD@BG stay in the greenhouse forever. It is a place of how we are to live out practically this faith that NSGDQSG@S†XNTQANCXHR@SDLOKDNESGD'NKX preparation, not procrastination. As I go now G@RADDMFHUDMSNTR  R(V@RRG@QODMDCANSG Spirit, who is in you, whom you have received from Houghton, I look forward to continuing in and out of the classroom, I soon came to EQNL&NC†8NT@QDMNSXNTQNVMXNTVDQD the good work that God has started in my realize that my life isn’t compartmentalized ANTFGS@S@OQHBD 3GDQDENQDGNMNQ&NCVHSGXNTQ KHED (G@UDMNSADDMG@QCDMDCSNSGDVNQKCNQ into ‘school,’ ‘work,’ ‘friends,’ and ‘recreation.’ ANCX"NQ  "N@BGDRRDSSGDDW@LOKDSG@S L@CDRB@QDCNEHSRENQBDR (MRSD@C(G@UDADDM (MSGHR(B@LDSN@OOQDBH@SDSG@S†VG@SDUDQ NTQODQENQL@MBDV@RTKSHL@SDKXMNS@ANTSTR  rooted deep, holding fast to my Anchor. you do, whether in word or deed, do it all in the ATS@ANTSSGD+NQC 6DVDQDITRSTRHMF'HRFHESR M@LDNESGD+NQC)DRTR FHUHMFSG@MJRSN&NC AX'HROQNUHRHNMENQ'HROTQONRDR (SV@R @MC the Father through him” (Col. 3:17). I longed @KV@XRG@RADDM @BKD@QLHRRHNMSNSGD'NTFGSNM SD@LRSG@SVDVDQDSNAD@VHSMDRRENQSGD+NQC to the people we played against and in front of. The gifts we were given athletically allowed us to share with people whom we normally “ In my time here at Houghton, wouldn’t: referees, other teams, coaches, and spectators. Simple sportsmanship, prayer, I have grown to see what that songs together, and hospitality to visiting institutions initiated many opportunities to stewardship looks like in my share. Houghton teams even took mission trips across the world to reach other athletes own life – putting my Master and who share a common love for sports. 'HRJHMFCNL›QRSHM@KK(CN  %QNLSGD›QRSSNSGDK@RSOQ@BSHBDCTQHMFLXSHLD -Darby Emerson ’11 at Houghton, our performances meant more SG@M@VHMNQKNRRNM@RBNQDAN@QC (MRSD@C( learned the importance of using every avenue

HOUGHTON | 15 Memoirs of an EQHB@M.CXRRDX Jon Arensen, Professor of Intercultural Studies Illustrations by Kendra Inglis ’11

It was 1946 when Jon Arensen arrived on the African BNMSHMDMSVHSGGHRO@QDMSR &QNVHMFTOHMSGD EQHB@MATRG GD V@RœTDMSHMSGD*HRTJTL@K@MFT@FDADENQDGDRONJD$MFKHRG  After attending college in the United States, he returned to Africa to teach, learn more and raise his own family. Since then he has introduced hundreds of college students to the life and rich culture EQHB@NÈDQRSGQNTFGGHRB@OSHU@SHMFRSNQXSDKKHMF@MCRDLDRSDQ long trips to Tanzania. Now Jon Arensen invites you to live the adventure through his memoir Drinking the Wind: Memoirs of an African Odyssey.3GHRAQHDEDWBDQOSHKKTRSQ@SDRGNV)NM@MCGHRVHED!@QA  HMSQNCTBDC@VQHSSDMK@MFT@FDSNSGD,TQKDODNOKD@MCBNM›QLRSG@S VDB@M›MCBNLLNM@KHSHDRSGQNTFGSGDDWOQDRRHNMNEK@MFT@FD  GD›QRSENTQXD@QRVDKHUDCHM/HANQMNNSGDQDWO@SQH@SDRKHUDCMD@QTR 6D To translate religious terminology I needed EXPRESSION spent most of this time learning the language and culture of the Murle a thorough understanding of the Murle people. We worked under the auspices of the Ministry of Education to traditional religion. This focused on worship QDCTBDSGD,TQKDK@MFT@FDSNVQHSHMF@MCOQNCTBDKHSDQ@BXANNJR 6D of the high God. The Murle people referred to G@CSNRS@QS@SSGDADFHMMHMF 3NFDSODNOKDTRDCSNANNJR@MCOHBSTQDR  God as Tammu. This word could also mean Sky Twe laid out National Geographic and Africana magazines in our living room and hung or Rain depending on the context and spelling color pictures of African animals on the walls. When Murle people came to visit, we NESGDVNQC  S›QRS(VNMCDQDCHESGDXG@C VDKBNLDCSGDLHMSNNTQKHUHMFQNNL 6DHMHSH@KKXG@CQTFR@MCRJHMRNMSGDBDLDMSœNNQ  just some vague concept of God all mixed up ATSSGD,TQKDVDMSSNFQD@SBNMSNQSHNMRSN@UNHCRSDOOHMFNMSGDL 3GDXQDF@QCDCSGDL with Sky and Rain. As I studied the linguistic @RRKDDOHMFL@SR@MCMNANCXRSDORNM@ODQRNM’RRKDDOHMFL@S 6DOHBJDCSGDLTO@MC underpinnings of the word, I discovered three ODNOKDEDKSLTBGLNQDBNLENQS@AKDHMNTQKHUHMFQNNL 6DG@MCDCNTQUHRHSNQRL@F@YHMDR distinct concepts. When the Murle talked @MCSGDXKD@EDCSGQNTFGSGDLKNNJHMF@SSGDBNKNQR .ESDMSGDXGDKCSGDLTORHCD CNVM  @ANTS1@HM SGDXR@HCatiil tammu 3GDUDQAatiil not recognizing anything on the pages. I pointed at the pictures on the walls and asked referred to the falling action of the Rain coming PTDRSHNMR@ANTSSGD EQHB@M@MHL@KRCDOHBSDCHMSGDOHBSTQDR (RNNMQD@KHYDCSG@SLNRS down from the heavens. By contrast when they Murle could not identify an elephant in a color photo. They were not used to seeing the referred to the Sky itself, they used the word world in two dimensions or miniaturized like the elephant portrayed on paper. When I tamma 3GDRTÉW–a at the end of the word was SQ@BDCSGDDKDOG@MSVHSGLX›MFDQ@MCONHMSDCNTSSGDU@QHNTRED@STQDRNESGDDKDOG@MS a location marker. This left the word Tammu like the trunk, tusks and ears, they suddenly would ‘see’ it. They gasped in recognition and SNQDOQDRDMS&NC +@SDQ@R(SQ@MRBQHADC,TQKD proudly showed the elephant in the picture to the next person who came into the room. folk tales, I noticed that when the Murle talked /DNOKDRNNMKD@QMDCSNRDDSGDLD@MHMFHMOHBSTQDR@MCVDLNUDCNMSN@KOG@ADSKDSSDQR  @ANTS@M@MHL@KHMHSR@MHL@KRS@SD SGDXTRDC 6DCDRHFMDC@M@KOG@ADSG@UHMFKDSSDQRVHSGD@BGKDSSDQDPT@KHMFNMKXNMDRNTMC 6D nana kireer(RDD@I@BJ@K 6GDMSGDXSNKC@ VQNSDSGDK@MFT@FDOGNMDSHB@KKX@MCSGDRODKKHMFV@R@ARNKTSDKXQDFTK@Q  MXNMDVGN folk story with jackal as a character in the story, KD@QMDCSGDRNTMCRNESGD@KOG@ADSKDSSDQRBNTKCRNTMCNTS@MXVNQCVQHSSDMCNVM they anthropomorphized the jackal, giving it human characteristics. Whenever they did this !@QAOQNCTBDC@KHSDQ@BXANNJVHSG@KOG@ADSKDSSDQR RSNQHDR@MCCQ@VHMFRSG@SBNUDQDCSGD SGDX@CCDCSGDRTÉW–u to the word kireer, as in A@RHBRJHKKRMDBDRR@QXENQQD@CHMFSGD,TQKDK@MFT@FD .MBDSGDKHSDQ@BXANNJV@RQD@CX  Maa acin kireeru, “The lion sees (Mr.) jackal.” !@QASDRSDCHSNM@RL@KKFQNTONE,TQKDSDDM@FDQR $UDMSGNTFG+NLNMF@MC,@BG@QVDQD The –uRTÉWF@UDSGDI@BJ@K@ODQRNM@KHSX (M adults, they insisted on joining the class. This little school met every afternoon under the the same way, the term Tammu incorporated RG@CDNE@K@QFDA@K@MHSDRSQDD 3GDRSTCDMSRR@SNMKNFRNMSGDFQNTMC@MC!@QAVQNSDNM SGDRTÉW–u and therefore referred to a @AK@BJAN@QCM@HKDCSNSGDSQTMJNESGDSQDD 3GDSDDM@FDQRKD@QMDCSNQD@CUDQXPTHBJKX  God with a character and personality. .MBDSGDXLDLNQHYDCSGDRNTMCRNESGD@KOG@ADSSGDXBNTKCD@RHKXRNTMCNTSSGDA@RHB RSNQHDRHMSGDKHSDQ@BXANNJ 3GDLDMKD@QMDCLNQDRKNVKX 3GDXG@COQNAKDLRVQHSHMF !@QA 3GD,TQKDODNOKDADKHDUDCTammu lived in the G@MCDCNTSO@ODQ@MCRG@QODMDCODMBHKR ATS+NLNMF@MC,@BG@QOTRGDCNMSGDODMBHKR RJXATSRSHKKG@C@M@BSHUDHLO@BSNMSGDVNQKC  RNG@QCSGDXJDOSAQD@JHMFSGDKD@C 3GDXMDUDQ@BPTHQDCSGDFDMSKDSNTBGMDBDRR@QXSN BNLLNMOGQ@RDTRDCAXSGD,TQKDHRTammu write. They spent most of the class time sharpening and resharpening their pencils. toh 3GHRV@RCHÉBTKSSNSQ@MRK@SDKHSDQ@KKXHMSN $MFKHRG ATSHMAQN@CSDQLRHSLD@MS&NC 6DOQNCTBDCRNLDRL@KKQD@CHMFANNJRA@RDCNMENKJS@KDREQNLSGDNKC,TQKD exists.” When a hunter went hunting and killed storytellers. They already knew the stories so the familiarity with the material helped @ATÈ@KNGDVNTKCR@XTammu toh. When a SGDMDVQD@CDQR›FTQDNTSSGDVNQCRHMSGDRSNQHDR 6DTKSHL@SDKXV@MSDCSNSQ@MRK@SD LNSGDQF@UDAHQSGSN@GD@KSGXA@AX RGDVNTKC O@QSRNESGD!HAKDHMSNSGD,TQKDK@MFT@FD 3GHRSNNJRDQHNTRSGNTFGS@MCDÈNQS 3GD say Tammu toh (MANSGB@RDR SGDXSG@MJDC&NC GHRSNQHB@K@MCBTKSTQ@KL@SDQH@KV@RE@HQKXRSQ@HFGSENQV@QCADB@TRDSGDQDV@RLTBG and gave Him credit for their good fortune. NUDQK@OADSVDDM,TQKDBTKSTQD@MCSG@SNESGD.KC3DRS@LDMS 6DPTHBJKXCHRBNUDQDCSG@S LDS@OGNQRCHCMNSSQ@MRK@SDD@RHKXEQNLNMDK@MFT@FDSN@MNSGDQ  ARSQ@BSBNMBDOSRRTBG To read more, order Jon Arensen’s @RDLNSHNMR@MCUHQSTDRVDQDDRODBH@KKXCHÉBTKS 3NSQ@MRK@SDSGDBNMBDOSNE@FQDDCX ANNJ@SNKC@EQHB@L@F@YHMD BNL person, I had to use the phrase ziniz ci appe NQAHFGD@QS 3GDFQDDCXODQRNM’RGD@QS V@RK@QFDADB@TRDGDVNTKCMNSRG@QD @MCGDJDOS@KKGHRONRRDRRHNMRHMGHRGD@QS (M contrast they referred to a generous person as having a ziniz ci miliny, or “small heart.” 3GDFDMDQNTRODQRNM’RGD@QSV@RRL@KKADB@TRDGDF@UDDUDQXSGHMF@V@X 2HLHK@QKX@ patient man had a cold heart, or ziniz ci alal ADB@TRDGDQDL@HMDCB@KL@MCPTHDS 

HOUGHTON | 17

EXPRESSION

Dan Noyes ’93, Executive Director of Alumni Relations

The year was 1917,@MC@XNTMF!DUDQKX2GD@ @KNMFVHSG@ANXGNNCEQHDMC"@QK2SDRR  came upon the valve that controlled the Houghton water supply. “I saw this stick coming up from the FQNTMC @MC(G@CSNRDDVG@SHSCHC QDLDLADQR2GD@ .UDQS@JDMAXANXGNNCBTQHNRHSX SGDSVNRNNM ENTMCSGDLRDKUDRQDRONMRHAKDENQB@TRHMF@LHMNQœNNC +@SDQHMGHRKHED &DNQFD!DUDQKX2GD@RDQUDC@RNMDNESGDBG@MMDKRENQ@LTBGK@QFDQœNNCŽSGHRNMD musical—that reached more than 220 million people over the course of 50 years with a story of love, grace, and salvation through Jesus Christ.

GD@STQMDCSGHRO@RS%DAQT@QX HR@KRNHLLDCH@SDKXUHRHAKDHMSGDQNNL (EXNT here. For Shea, singing is a response to what he and resides in Montreat, N.C. with ask, he will show you the two Grammy awards ADKHDUDR @MCHSRDDLR@KLNRSHMUNKTMS@QX 'DHR his wife, Karlene. He is not far GDVNM NMDHMENQGHR@KATLSouthland a serious student of music, having taken formal from Billy Graham, with whom Favorites@MCSGDNSGDQITRSSGHRO@RS%DAQT@QX UNHBDKDRRNMRENQXD@QRNEGHRKHED ATSSGDQDG@R Shea ministered since they met ENQKHEDSHLD@BGHDUDLDMS 'DRSHKKOK@XRANSG @KV@XRADDMLTBGLNQDSG@MSGDCDDOA@QHSNMD inS 1943 when Shea was 31 and Graham 21. He piano and organ and has also played the violin. GDG@RADBNLDJMNVMENQVNQKCVHCD 2HMFHMFHR moves quite well for a man who has passed the But one cannot truly understand Mr. Shea’s who he is and what he was created to do, and to century mark and has a mastery of the details of QDK@SHNMRGHOVHSGLTRHBVHSGNTSADHMFVHSGGHL DWODQHDMBDHSHMODQRNMHRSNNARDQUDRNLDNMD BNTMSKDRRRSNQHDRFNHMFA@BJSND@QKXBGHKCGNNC  VGDMHSHRADHMFOK@XDCNQODQENQLDC 'HRDMDQFX knee-deep in his calling. It is hard not to smile. It does not take long when visiting Shea’s home KDUDKCNTAKDR GHRRLHKDFQNVRVHCDQ @MCGHR 'DM@LDRL@MXHMœTDMBDRHMSGDCHRBNUDQX SNTMCDQRS@MCSG@SLTRHBHR@MCG@RADDM@ arms move with the melody. He does not recite and development of this calling to sing, and L@INQO@QSNEGHRKHED 3GD›QRSSGHMFXNTGD@Q GHRE@UNQHSDGXLMRATSQ@SGDQRHMFRSGDL @MC among them are family, friends, and Houghton when you enter is classical music from speakers HSVNTKCADHM@BBTQ@SDSNB@KKHSODQENQL@MBD  "NKKDFD &DNQFD!DUDQKX2GD@V@RANQMHM stationed under a Steinway Piano that also Under some circumstances it might seem  SGDENTQSGNEDHFGSRHAKHMFR SN1DU  C@L provides shelter to a life-sized replica of RCA RSQ@MFDSNG@UDRNLDNMDAQD@JHMSNRNMFHM J. Shea and Maude Whitney Shea. The Shea record’s canine mascot, a gift from the record SGDLHCRSNE@BNMUDQR@SHNM DUDMNMD@ANTS family moved to Houghton in 1917 from his company. An organ, one of three in the house, R@BQDCLTRHB ATSSGDQDHRMNRTBG@VJV@QCMDRR

Left: Portrait by John Howard Sanden HOUGHTON | 19 Singing is who he is and what he was created to do, and EXPRESSION AHQSGOK@BDNE6HMBGDRSDQ .MS@QHN @RGHRE@SGDQ  a Wesleyan minister, traveled the area preaching to experience it in person at churches and camp meetings. During his four childhood years in Houghton, he lived HRSNNARDQUDRNLDNMD MDWSCNNQSN/QDRHCDMS)@LDR2 +TBJDX@MC attended classes in the one-room schoolhouse knee-deep in his calling. on Houghton hill. He can recall living where the Reinhold Campus Center is located now and UHRHSHMFGHRADRSEQHDMCVGNKHUDCTONMSGDGHKK It is hard not to smile. in Steese House. After moving from Houghton, 2GD@QDLDLADQRDMBNTMSDQHMF/QDRHCDMS +TBJDX@F@HMHM VGDM2GD@ SGDM V@R VNQJHMFNM@C@HQXE@QL(QDLDLADQADHMF HMSGDA@QMLHKJHMFBNVR@MCRDDHMF/QDRHCDMS and also learned to play the violin and RTQDSNAQHMFXNTQA@SGHMFRTHS ’'D@CCDC +TBJDX@QQHUDHM@B@QVHSG@RSTCDMSADGHMC the organ, though there were others who with a chuckle that “I should have gone!” encouraged him to develop his gifts as well. the wheel. He was recruiting for the college.” It is easy to forget when you are with George /QDRHCDMS+TBJDX’RSQHOV@RRTBBDRRETK @MC ,QR %QDC2TÉDKC @OH@MNSD@BGDQ@MCE@QLDQ !DUDQKX2GD@SG@SSGHRRDKE DÈ@BHMFTM@RRTLHMF Beverly Shea eventually enrolled in Houghton in HM.MS@QHN "@M@C@ OQNLOSDC2GD@SNV@QCR man has won two Grammys, recorded more the fall of 1928. “I feel very close to Houghton,” GHR›QRSOTAKHBODQENQL@MBD@S@SDMSLDDSHMF  SG@M@KATLR VQHSSDMMTLDQNTRONOTK@Q he said, as he recalled early morning singing “She asked my parents if they could take me GXLMR@MCSGQDDANNJR V@RJMNVM@RSGD lessons with Herman Baker and praying with his @KNMF @MC(QDLDLADQLXUNHBDBQ@BJDCNM BNTMSQX’R‘ADKNUDCFNRODKRHMFDQ’@MCGNKCRSGD roommate Wilfred Bain ’29, who later conducted one of the high notes. She assured me that world record for having sung live to more than SGD›QRS@B@ODKK@BGNHQ@S'NTFGSNMHM  we could simply lower that note for the next 220 million people. He is more likely to tell you .TQADCRVDQDNMNOONRHSDRHCDRNESGDQNNL  ODQENQL@MBD (MRNLDV@XRHSHRQDL@QJ@AKD @ANTSSGDK@TFGGDQDBDHUDC@SGHRNVMDWODMRD @MCVDVNTKC@KV@XROQ@XSNFDSGDQADENQDVD SG@S2GD@ADF@MODQENQLHMF@S@KK 'DG@R during his most recent Grammy speech and went to sleep. He was seeing a girl named Mary MDUDQADDMBNLENQS@AKDROD@JHMFHMEQNMSNE leaves it to his devoted wife to tell you that he and would thank God ‘for how wonderful Mary a crowd. In fact, this was the one question he received a standing ovation from those present. is’ and ‘what a wonderful time they had together’ put to Billy Graham when the young evangelist 6GDM@RJDCGNVGDVNTKCKHJDSNAD TMSHK(G@CSN@RJGHLSNGTQQXTOADENQD(EDKK @RJDC2GD@SNADGHRFNRODKRHMFDQ(SNKC QDLDLADQDC GHR@MRVDQQDœDBSRSGHRR@LD asleep!” Mary Freeman ’31,SGDRTAIDBSNEXNTMF him that all the gospel singers I had heard GTLHKHSX†(V@MSSNADQDLDLADQDC@R@ Wilfred’s prayers, ended up married to Wilfred. would step to the pulpit and speak for a few gospel singer who sang clearly so the words LHMTSDRADENQDSGDXADFHMRHMFHMF 6NTKC( %HUDNE2GD@’RRHAKHMFR@KRN@SSDMCDC'NTFGSNM BNTKCADTMCDQRSNNC 6GDMGDV@RXD@QR G@UDSNCNSG@S&Q@G@L@RRTQDCGHLSG@S Ruth (Shea ’41) Willett, Alton Shea ’36, J. NKC GHRNVMKHEDV@RRG@ODCAXVNQCRVQHSSDM RHMFHMFV@R@KKSG@SVNTKCADQDPTHQDC  6GHSMDX2GD@’ +NHR2GD@’6QHFGS AX1GD@,HKKDQ  ESDQKD@UHMF'NTFGSNMHM and ,@QX1NAHMRNM’2GD@ These By the time he partnered with Billy Graham, CTDSN›M@MBH@KG@QCRGHOR @XNTMF&DNQFD LDLADQRNESGD2GD@E@LHKX @KNMFVHSGSGDHQ Beverly George Shea had decided to reverse the Beverly Shea was working for an insurance spouses, their children, grandchildren and NQCDQNEGHR›QRSSVNM@LDRGDHRRSHKKQDEDQQDC BNLO@MX ,TST@K+HEDNE-DV8NQJ VGHKDGD FQD@S FQ@MCBGHKCQDM G@UDADDMHMSDFQ@KSN SN@R!DUAXE@LHKX@MCEQHDMCR 'DG@CINHMDC contemplated his next steps and attended SGDATHKCHMFNE'NTFGSNM"NKKDFD’RRSQNMF @TMHNMCTQHMFGHRQ@CHNC@XR@MCCDRBQHADR@ numerous auditions. His mother, Maude, left academic reputation and distinctive strengths mailing that helped him come to this decision: Miller’s poem “I’d Rather Have Jesus” on the in areas like music, the visual arts, and world †HSV@R@CCQDRRDCSN,R !DUDQKX2GD@ @MCHS piano, where she knew her son would see it. missions. It was in this family context that invited me to ‘come and meet the other women 2GD@ENTMCSGDONDL V@RLNUDCAXSGDVNQCR !DUDQKX2GD@CDUDKNODCGHRUNB@K@AHKHSHDR HMSGDTMHNMENQ@SHLDNEEDKKNVRGHO†@MCAD @MC SQTDSNGHRB@KKHMF ADF@MSNOTSSGDLSN

20 | HOUGHTON (V@MSSNAD QDLDLADQDC as a gospel

singer who 01 sang clearly so the words BNTKCAD

understood.” 02 –GEORGE BEVERLY SHEA 06

LTRHB (ADF@MSNRHMFSGDVNQCR@MCDWODQHLDMS VHSGLDKNCX  R(R@MF ,NSGDQB@LDTOADGHMC me, crying, and put her hands on my shoulders.” Shea performed this hymn many times in his B@QDDQODQG@ORHSGDKODCGHLL@HMS@HMSGD perspective that he holds today at 102 years old, a world-class performer who would wish for the messenger to disappear in the light of the message. 03

I’d rather have Jesus than men’s applause; 04 I’d rather be faithful to His dear cause; I’d rather have Jesus than worldwide fame; I’d rather be true to His holy name. 05

01-02 George Beverly Shea ’32 at his home with one of his three organs. 03-05 Shea visited Houghton for a performance during Reunion Weekend in the 1970s. 06 Receiving the 2011 Houghton Medal of Honor from President Shirley Mullen ’76 ERIN BENNETT BANKS ’00 Shelley (Smith ’93) Noyes

reelance Illustrator Erin LDSNSGDCDOSG AD@TSX@MCQHBGBNLOKDWHSX SGDNKNFX RNBH@KHRRTDR ODQRNM@KNARDQU@SHNMR  Bennett Banks ’00, is engaging, SG@SHSS@JDRSNAD@"GQHRSH@M@QSHRS 3GDX life experiences, politics, and many other @OOQN@BG@AKD@MCBQ@BJRTOD@RHKX  taught me to live with integrity, all the while interests.” Ted Murphy, professor of art, said: EXPRESSION She is ready to talk intelligently QD@KHYHMFSG@SRNEDVPTDRSHNMRHMKHEDB@MAD “Banks was one of the most gifted students in NM@MXMTLADQNERTAIDBSR @MC CD›MDCVHSG@AK@BJ@MCVGHSD@MRVDQ  design we have ever had at Houghton College. that usually doesn’t include the long list of She had a lively interest in ideas, women’s F When Banks entered Houghton as a freshman, accomplishments and accolades she has to her RSTCHDR VQHSHMF@MCHKKTRSQ@SHNM !NA RGDJMDVRGDV@MSDCSNAD@M@QSHRSATSCHCM’S name. Since graduating from Houghton, Banks Danner, former vice president for student life have a clear expectation for life after graduation. G@RHKKTRSQ@SDCSGQDDM@SHNM@KKXOTAKHRGDC at Houghton College, often encountered Erin “I always had peace that God would put me BGHKCQDM’RANNJR@MCQDBDHUDCRDUDQ@K@V@QCR when she was working for the college dining VGDQDUDQ(MDDCDCSNAD '@C(@OOQN@BGDC ENQGDQVNQJHMBKTCHMFSGD.OODMGDHL3NX service as a morning meal ticket checker. “She BNKKDFDADHMFSNNENBTRDCNMSGDB@QDDQO@QS HS Portfolio Gold Award and the New York Times V@R@KV@XRAQHFGS@MCBGDDQETK@MC VGDM VNTKCG@UDADDMRND@RXSNLHRRSGDAHFOHBSTQD  !DRS"GHKCQDM’R!NNJR 2GDV@RE@UNQ@AKX she had time, would have a conversation with For Banks that picture included everything reviewed in Booklist, Kirkus Reviews, School LD QDLDLADQR#@MMDQ 6G@SHLOQDRRDC @KHADQ@K@QSRDCTB@SHNMBNTKCNÈDQGDQ ( Library Journal, The Washington Post, and Parents me most was the large volume of quality focused my college years mostly on learning magazine. Her illustrations have appeared in reading matter that she consumed, material @MC@ARNQAHMFDUDQXSGHMF (SV@RRTBG@QHBG periodicals such as Harvard Business Review, ADXNMCQDPTHQDC@B@CDLHBBNTQRDQD@CHMF  DWODQHDMBD RGDQDLDLADQR $QHMDRODBH@KKX The Weekly Reader, Atlanta Magazine, Highlights enjoyed participating in Houghton’s Honors !@MJRCDDOKXBNMMDBSRVHSGSGDKHADQ@K@QSR for Children, and Focus on the Family’s Brio and /QNFQ@LHM+NMCNM 3GDDWODQHDMBDHM+NMCNM idea of integrating all aspects of life and Clubhouse magazines. Her artwork has also V@R@L@YHMFADB@TRDHSV@RRTBG@LHBQNBNRLNE thoughtfully chooses the way she wants to live. ADDMKHBDMRDC@MCRNKCAX)"/DMMDX@RVDKK@R VG@S'NTFGSNMQDOQDRDMSRADHMF@AKDSNRSTCX Currently she works from her home studio in Bed Bath and Beyond. While Erin takes her @KKSGNRDCHÈDQDMSSNOHBRHMSGDGTL@MHSHDR Charleston, S.C. on freelance projects, serves as role as an artist seriously, she has remained in an integrated way... I think it really shaped the regional recruitment director for Savannah FQNTMCDC@MCSGNTFGSETK@ANTSGDQKHED  SGDV@X(SGHMJ@ANTSSGHMJHMF (@KRNOTQRTDC "NKKDFDNE QS@MC#DRHFM @MCHR@ANTSSN “As a Christian artist, I am drawn to stories of minors in communications and sociology ADBNLD@MDVLNL 'DQGTRA@MC 3HL HR@KRN humanity and redemption,” says Banks. “As @MCSNNJ@MTLADQNEBK@RRDRNTSRHCDNELX@QS a freelance artist and works out of their home. a result, I tend to get projects that challenge L@INQ ITRSENQSGDR@JDNEAQN@CDMHMFLXRBNOD  “My greatest personal achievement is getting LDSN@CCQDRRCHÉBTKSSNOHBRRTBG@RRK@UDQX  .MDNE$QHM’RE@UNQHSDBK@RRDRV@RChildren’s to a point where we’ve created a lifestyle that the Holocaust, religious persecution) in a Book Literature, taught AXQDSHQDC/QNEDRRNQNE HRQDV@QCHMFŽNMDVGDQDVDB@MAD@SGNLD L@MMDQSG@SVHKKAD@BBDRRHAKD@MC@OOQNOQH@SD Education Dr. Dan Woolsey’77. and have a very integrated life,” says Banks. “I to younger audiences.” For Banks, this means “I was the only non-education major in the love feeling like I’m not compartmentalized SG@SSNAD@M@QSHRSHRSNAD@UDRRDK ,XE@UNQHSD BK@RR QDLDLADQR$QHM (SNNJHSCTQHMFLX in my life. Right now I love me as the artist ANNJHR,@CDKDHMD+’DMFKD’RWalking on Water,” senior year, right at the time when I was trying working as the recruitment director, me in the R@XR!@MJR (MSGDANNJ +’DMFKDS@KJR@ANTS SNCDBHCD‘VG@SMDWS’(G@CM’SQD@KKXSGNTFGS ETSTQDADHMF@LNLŽ(ITRSKNUDSGDHCD@SG@S the way that God can use someone and make NEHKKTRSQ@SHNMLTBGADENQDSG@SBK@RR @MCHS it’s all very integrated. My artwork continues something out of his or her creation that will BDQS@HMKXHMœTDMBDCLXCHQDBSHNM@R@M@QSHRSՐ to evolve, my career takes on new discoveries SNTBG@MCHMœTDMBDODNOKD@MCG@RMNSGHMF and my life is rich with opportunities. I During her time as a student, Erin’s interest to do with the person who created it. I love TMCDQRS@MCSNC@XVG@SHSLD@MRSNADETK›KKDC  in the world and her thirst for knowledge was that idea that really, you’re just a vessel.” evident to everyone who encountered her. For more information or to see the full Banks credits her artistic journey and continued Dave Huth ’91, assistant professor of visual collection of Erin’s artwork, please visit RTBBDRRSNSGDHMœTDMBDNESGD@QSE@BTKSX communication and media arts, served as GDQVDARHSD@SVVV DQHMA@MJR BNL @RVDKK@RSNSGDKHADQ@K@QSRDCTB@SHNMRGD Erin’s supervisor in graphic design. “What received at Houghton. “Beyond the many hours (QDLDLADQLNRS@ANTS$QHMV@RGDQRG@QO spent in the art studio, I was most impacted @MCD@QMDRSLHMC†:(V@R<HLOQDRRDC@MC AXSGD@QSOQNEDRRNQR@MCSGDHQ@TSGDMSHBHSX  BG@KKDMFDCAX$QHM’RQDRSKDRRHMSDKKDBS@MC QDLDLADQR!@MJR 3GD@QSE@BTKSXHMSQNCTBDC mature insights into topics of aesthetics,

22 | HOUGHTON “Beyond the many hours spent in the art RSTCHN (V@RLNRSHLO@BSDCAXSGD@QS professors and their authenticity.” -Erin Bennett Banks ’00 MARK VANDERHAAR ’99 Dan Noyes ’93, Executive Director of Alumni Relations

ou will not see “Earl the Big Red Emu” listed among the Houghton College “It’s not an "K@RRNEXNTVHKK GNVDUDQ ›MC Mark VanderHaar who, in one of his act. I can’t ›QRSINAR@ESDQFQ@CT@SHNM OK@XDCSG@S help it. It’s YKNU@AKDœHFGSKDRRAHQCNMSGDSDKDUHRHNMRDQHDRNESGD same name. He is most remembered at Houghton who I am…I for his peculiar practice of arriving at class or other Houghton events as someone other than himself. The remember characters he created became part of campus legend, and this calling to the creative use of character and when I turned costume went with him into the work world as he used his unique gifts to unify, encourage, and entertain. 16, all of my Mark arrived on campus in the fall of 1995, a disciplined friends were young method actor with a trunk full of alter egos. 'NTFGSNMRSTCDMSR E@BTKSX @MCRS@ÈRNNMADB@LD hoping for cars acquainted with Mark’s characters. Professor Doug &@DQSDQDLDLADQRGHLCQDRRHMF@R@OHQ@SDENQ and I asked for class, complete with a wooden leg fashioned from a plunger, and many remember Mark donning a a chicken suit.” snowman suit and contracting with the campus store to startle passersby, encouraging them to visit the store’s winter sale. Paul Watson ’98 remembers Carson, the sunglass-and-headband-wearing OQNEDRRHNM@KRNBBDQOK@XDQ3GDQDVDQD@BNTOKDNETRVGNHMSQNCTBDCGHLVHSGCQTL ›ED and trumpet...and he played the part in character for three-plus hours. He signed autographs, Q@M@BKHMHB DSB ,@QJQDLDLADQR"@QRNM@RVDKK"@QRNMV@R@IDQJ (LD@M GDV@RQTCDSN everybody. He might sign an autograph for you, but he really cared only about himself.”

Strangely enough, one of Mark’s proudest creative moments at Houghton happened in an @BBNTMSHMFBK@RR  #D@M’RKHRSRSTCDMSVGHKD@S'NTFGSNM GDNESDM@OOKHDCGHRœ@HQENQSGD CQ@L@SHBVHSGGHRBNTQRDVNQJ 3GDBK@RRV@RJHMCNEANQHMF @MCVDG@C@›M@KBNLHMFTO that everyone was dreading, so I convinced our professor to let the class do an ‘accounting SGD@SDQ’HMOK@BDNESGD›M@K 6DOTSNMOK@XRCDLNMRSQ@SHMFSGDKDRRNMRVDG@CKD@QMDC 

When Mark became an RA his sophomore year, it became clear that his desire to help, GHRBQD@SHUHSX @MCRDMRDNEGTLNQ›SSGHRVNQJODQEDBSKX 3GDLDMNMGHRœNNQDMINXDC NÈ SGD V@KK@BSHUHSHDRKHJDSNXAN@SQ@BDRCNVM'NTFGSNMBQDDJ LNMRSDQSQTBJQ@KKHDR  and, during stressful times of the semester, he went room to room and read them bedtime stories. He excelled at making his residents feel like they belonged, and the position was a stepping stone to an early career in college student development. EXPRESSION

As he played the role of Carson, Earl the Big Red Emu, Gem Dandy, 2ONMFD!NA @MC@GNRSNENSGDQBG@Q@BSDQR GDV@RRHLOKXADHMF himself, and it was his time at Houghton that helped him connect SGHRFHESVHSGGHRB@KKHMFSNL@JD@CHÈDQDMBDHMSGDKHUDRNEODNOKD

.MDNE,@QJ’R›QRSINAR@ESDQFQ@CT@SHNMEQNL involved with, and he seemed to feel the same Mark is currently an account manager and Houghton was director of student programs at @ANTSSGDLHMNQKD@FTDOQNRODBSRGDHMSDQ@BSDC media specialist with Delmarva Broadcasting, a Union University in Jackson, Tenn., a position VHSG@RGDCHC@ANTSSGDEQDRGLDMNMGHRœNNQ position that allows him more time with family that allowed him to mentor students and plan when he was an RA. “These guys were just and the opportunity to apply his creative skills activities during the school year and gave starting to make some money and they were in writing and producing commercials for the him freedom during the summers to pursue XNTMF@MCUDQXHLOQDRRHNM@AKD 3GDXQD@KKXG@C RS@SHNMR’@CUDQSHRDQR 6GDM@RJDCSNQDœDBSNM opportunities like playing Earl the Emu and SGDONSDMSH@KSNL@JD@CHÈDQDMBDHMSGDVNQKC  the characters he has played and whether he will working with the West Tennessee Diamond Jaxx, continue his dramatic pursuits, VanderHaar 'D@KRNS@KJR@ANTSSGDNOONQSTMHSHDRGD SGD"GHB@FN"TAR @ÉKH@SD 'HRRTLLDQR replies: “It’s not an act. I can’t help it. It’s who provided for players to share their faith: “We with the Diamond Jaxx (playing their mascot, (@L†(QDLDLADQVGDM(STQMDC @KKNELX had done these events in Tennessee with Gem Dandy) soon led to a full-time position as friends were hoping for cars and I asked for a SGD#H@LNMC)@WWVGDQDVDVNTKCAQHMFHM manager of sales and promotion that allowed chicken suit.” He has used his talents within Christian music artists and have players give VanderHaar to create scripts for all park the church, even playing the role of Judas in his their testimonies. I was thrilled when I was entertainment among other duties. When the church’s Easter production this year. Perhaps @AKDSNBNMUHMBDLXANRR@SSGD!KTD1NBJR Diamond Jaxx was sold in 2005, Mark served SGDAHFFDRSHQNMXHRSG@S DUDMVGDMGDHROK@XHMF to give it a try.” The world of minor league as director of community relations and later a character, it is VanderHaar’s authenticity A@RDA@KKV@RDWBHSHMF ATSVGDMGHRVHED  director of marketing with the Wilmington that draws people to him and puts them at "NQHMD F@UDAHQSGSNSGDHQC@TFGSDQ .KHUH@  !KTD1NBJR @MNSGDQLHMNQKD@FTDA@RDA@KK ease. As he played the role of Carson, Earl the ,@QJADF@MSNQD@KHYDGDBNTKCM’SCNSGHR team. His new challenges included developing !HF1DC$LT &DL#@MCX 2ONMFD!NA @MC@ forever. “My proudest accomplishment is my SGDLDMHFGSRSNGDKODMSDQS@HMA@KKO@QJ GNRSNENSGDQBG@Q@BSDQR GDV@RRHLOKXADHMF E@LHKX &NCG@RAKDRRDCLDVHSG@FQD@SVHED guests. The minor league environment allowed himself, and it was his time at Houghton that @MC@AD@TSHETKSGQDD XD@Q NKCC@TFGSDQ (M him to explore his creativity with few limits. helped him connect this gift with his calling fact, that’s why I left the career in sports. Each He played characters like Richard Simmons SNL@JD@CHÈDQDMBDHMSGDKHUDRNEODNOKD RD@RNM (VNTKCAD,( ENQ GNTQR@ @MC2ONMFD!NA@MCVNQJDCVHSG@U@QHDSX week, and it was starting to take its toll. There NEBDKDAQHSHDR EQNL@SGKDSDRSNQDBNQCHMF are just some things that are more important artists to legendary professional wrestlers. in life, although I did give up free corndogs Even with all the exciting aspects of these @MCBNSSNMB@MCXEQNL OQHKSN2DOSDLADQ  positions, VanderHaar is most enthusiastic @ANTS@LHMNQKD@FTDBG@ODKOQNFQ@LGDV@R

HOUGHTON | 25 FACULTY ACCOLADES

Glen Avery,SDBGMNKNFXKHAQ@QH@M INHMDC connection and reconciliation through music as other people in running a marathon on King well as to provide real professional experience FACULTY &DNQFD(RK@MCHM MS@QBSHB@NM%DAQT@QX  for talented post-educational musicians.  'DœDVSN4RGT@H@ 3HDQQ@CDK%TDFNUH@ ,DLADQRBNLDEQNL@KK@QNTMC6DRSDQM-DV !TDMNR HQDR  QFDMSHM@ SGDMSQ@UDQRDCAX 8NQJ@MCADF@MSGDHQ›QRSOQNEDRRHNM@KSNTQNE RGHOSGD#Q@JD/@RR@FDADSVDDM2NTSG LDQHB@ 1NBGDRSDQ !TÈ@KN@MC3NQNMSNHM,@X and Antarctica. His trip included trekking ,HJD+@RSNQH@ director of counseling services, NMFK@BHDQR@MCNARDQUHMFODMFTHMR VG@KDR  V@R@V@QCDCØEQNLSGD*@SGDQHMD+HMCKDX and seals. This was his 42nd marathon and Project Fund to support his attendance at SGD›ESGBNMSHMDMSNMVGHBGGDG@RQTM  the Milton Erickson Couples Conference, 1NADQS!K@BJ professor of economics, held March 31-April 3, 2011. The Katherine G@CGHRQDUHDVNESGDANNJAdam Smith +HMCKDX/QNIDBSNÈDQRETMCHMFENQ@MXRSTCDMS and the Character of VirtueOTAKHRGDCHM NQE@BTKSXLDLADQ QDF@QCKDRRNEL@INQNQ Journal of Markets & Morality, Volume 13:2. discipline, to undertake a scholarly project SG@SQDœDBSRRNBH@KRBHDMBDNAIDBSHUDR@MC +@TQHD#@RGM@T associate professor of English includes theological themes or questions. and director of the writing center, accompanied ›UD'NTFGSNMRSTCDMSRVGNOQDRDMSDC@S Terence Paige,BG@HQNESGD!HAKHB@KRSTCHDR the National Conference on Undergraduate department and professor of New Testament, Research (NCUR) from March 31-April 2, 2011. was a guest lecturer in Northeastern Seminary S. Kyle Johnson ’12 presented his paper, in Rochester, N.Y. on the topic of the history “Into Charted Territory: The Evolution of the development of New Testament of Epistemology and Theodicy in the criticism. Professor Paige preaches twice Enlightenment as Treated in Paradise a year at the InterVarsity student chapel at 01 Lost and Candide,”SG@SG@CADDMNUDQRDDM Alfred University in Alfred, N.Y. He also AX/QNEDRRNQNE$MFKHRGStephen Woolsey ’73. presented “The Thessalonian Epistles” at Katrina Koehler ’11 had two papers, SGD6DRKDX"DMSDQ"NMEDQDMBDHM%DAQT@QX “Quasielastic Neutron-Induced Deuteron  @MCV@RQDBDMSKXOTAKHRGDCHMSGD Breakup” and “Deuteron Formation for Big Bang Wesleyan Theological Journal for his review 2XMSGDRHR,NCDKR SG@SG@CADDMNUDQRDDMAX NESGDANNJThe New Testament in Antiquity. Professor Mark Yuly. Zachary Miller ’12 and "NQX1DMA@QFDQ assistant professor of voice, Wesley Jones ’13 presented “Characteristic was a guest judge at the annual Concerto Aria Sites in the Internal Proteins of Avian and "NLODSHSHNM@S1NADQSR6DRKDX@M"NKKDFD  'TL@M(MœTDMY@5HQTRDR @O@ODQSG@S The competition is for students of the college Professor Wei Hu advised them on. Nathaniel @MCNÈDQR@RNKNODQENQL@MBDOQHYD  Smith ’12V@R@CUHRDCAX/QNEDRRNQNdunge Kiiti ’88 on his paper titled “World Vision: Jillian Sokso, assistant professor of art, "@RD2STCXHM&KNA@K$MF@FDLDMS  01 HRBNKK@ANQ@SHMFHMSVNDWGHAHSRSGHRXD@Q 02 @SSGD+DUX&@KKDQXHM/GHK@CDKOGH@ Wei Hu, professor of mathematics and Conversations EQNL)@MT@QXSN,@QBG@MC 03 computer science, had his paper titled Monumental BTQ@SDCAX'TH"GT 1DBDOSNQ!HMCHMF2ODBH›BHSXNE'- Ideas in Miniature Books II, Ying, on display at 48 venues in 20 countries /@MCDLHB(MœTDMY@5HQTROTAKHRGDCHM from 2011-2015. Furthermore, she was part of Natural Science magazine in March 2011. @RGNVGHFGKHFGSHMFGDQBNKK@ANQ@SHUDVNQJR Brandon Johnson, associate professor of VHSGEDKKNV@QSHRS*DUHM2GNNJHM@MDWGHAHSHNM conducting and vocal music director of choral titled Both Sides at the Wellsville Creative Arts activities, has recently founded an emerging "DMSDQEQNL)@MT@QX%DAQT@QX   MDVOQNEDRRHNM@KBGNHQB@KKDC5NW+TLHMD NQ She was recently awarded a fellowship and 5NHBDRNE+HFGS )NGMRNMRS@QSDCSGDFQNTO@R@ artist-in-residence at the Women’s Studio V@XSNAQHMFCHUDQRDBNLLTMHSHDRSNFDSGDQENQ Workshop in Rosendale, N.Y. for June 2011. 02 FACULTY

Gary Stith, professor and coordinator of BOOKSHELF music education, recently served as guest PUBLICATIONS BY HOUGHTON ALUMNI conductor for the 14th Annual Williamsville Middle School Band Festival. He also served D.M. Basnight-Brown ’01,@MC)  KS@QQHA@  of C.S. Lewis: A Meditative Journey Through as host for his annual “Interview with a “Code-Switching and Code-Mixing in Twenty-Six of His Best-Loved Writings +DFDMCBKHMHBRDRRHNM@SSGD-DV8NQJ2S@SD Bilinguals: Cognitive, Developmental, 3XMC@KD'NTRD/TAKHRGDQR  Band Directors Association Symposium and EmpiricalApproaches.” in Syracuse. He interviewed nationally $ / ,@QBDKKHM$KHY@ADSG/DSQHKKN’ Speech and Language Disorders in Bilinguals renowned conductor Anthony Maiello. Marcellin). Element Keepers: Professor Stith’s new text, -NU@2BHDMBD/TAKHRGDQR(MB  Score and Rehearsal Whispers of the Wind Preparation: A Realistic Approach for Instrumental D.M. Basnight-Brown ’01, et al. 3@SD/TAKHRGHMF  Conductors,HRRBGDCTKDCSNADOTAKHRGDCAX “Monolingual and Bilingual Recognition of ,DQDCHSG,TRHB/TAKHB@SHNMRSGHRROQHMF Joyce (Wilson ’66) Strong. Lambs on 1DFTK@Q@MC(QQDFTK@Q$MFKHRG5DQAR#NDR the Ledge: Seeing and Avoiding Danger Ryan Thompson, assistant professor of art, was 2DMRHSHUHSXSN.QSGNFQ@OGHB2HLHK@QHSX5@QX in Spiritual Leadership OKD@RDCSNBNKK@ANQ@SDHMENTQFQNTODWGHAHSHNMR 6HSG+@MFT@FD$WODQHDMBD H4MHUDQRD/TAKHRGHMF  The Night of 1001 Videos in the Gallery Analix Journal of Memory and Language, 57, 2007 %NQDUDQHM&DMDU@ 2VHSYDQK@MCWORK: Joyce (Wilson ’66) Strong. Caught in the Curse or Calling, CIVA, a three-year traveling D.M. Basnight-Brown ’01@MC)  KS@QQHA@  Crossfire: Confronted by the Compassionate, DWGHAHSHNMAX)NDK9VNQSSmoke & Mirrors: “An Information Processing Approach to Uncompromising Love of God An International Juried Exhibition,BTQ@SDCAX 2DBNMC+@MFT@FD BPTHRHSHNM  H4MHUDQRD/TAKHRGHMF  ,HBGDKD1NADBBGHHM&DMDU@ 2VHSYDQK@MC New Handbook of Second Language Acquisition and @MDWGHAHSHNMHM+HFGSVDKK Carte Blanche, $LDQ@KC&QNTO/TAKHRGHMF+SC  Joyce (Wilson ’66) Strong. Instruments for &@KKDQX@SSGD4MHUDQRHSXNE.JK@GNL@ 2NLD His Glory: Releasing Women to Minister in NEGHRVNQJV@R@KRNED@STQDCHMSGDANNJ Ronald Fessenden ’66 and Mike McInnes. Harmony with God and Man Reframing Photography: Theory and Practice. The Honey Revolution: Restoring the Health of Charisma House, 1999 Future Generations J. Michael Walters, professor of Christian 6NQKC"K@RR$LOQHRD++"  ministries and director of ministerial Joyce (Wilson ’66) Strong. Leading with Passion and Grace: Encouraging and Mentoring education, was a speaker at the 2011 Aldersgate Ronald Fessenden ’66 and Mike McInnes. "QTR@CD @XD@QKXDLOG@RHRGDKCAX@QD@ Women Leaders in the Body of Christ The Honey Revolution – Abridged churches in Bradford, Pa. Additionally he Xulon Press, 2003 6NQKC"K@RR$LOQHRD++"  taught in January 2011 at the Missionary Joyce (Wilson ’66) Strong. Journey to Joy: 3Q@HMHMF(MRSHSTSD,3(ENQ&KNA@K/@QSMDQR &HMH.KMDX’&QHÉM !HAKD2STCXSGD Discovering the Love of God in Real Time at Wesleyan Headquarters in Indianapolis. +HEDNE#@UHCHMThrough the FireAX)@BJHD H4MHUDQRD/TAKHRGHMF  Jo-Anne Young, instructor of equestrian 'NÈL@M RSTCHDR G@RBNMSQHATSDCSN@MDVDCTB@SHNM@K WinePress Books, 2010 Joyce (Wilson ’66) Strong. Of Dreams and DVD for riding instructors and horse Kings and Mystical Things: A Novel on the Bruce Howell ’73. Pushing the Pause Button NVMDQR 3GD#5# OQNCTBDCAXSGD"DQSH›DC Life of King David on Your Life Horsemanship Association, will include #DRSHMX(L@FD/TAKHRGDQR  (R@@B/TAKHRGHMF  SVNVNQJRGNOROQDRDMSDCAX8NTMF@SSGD Joyce (Wilson ’66) Strong. A Dragon, a international conferences: “Developing the Jan (Hicks ’61) Johansson. Rider’s Seat and Quick Corrections for Position,” Dreamer and the Promise Giver: A Novel on the The Fragrance of His Grace BN OQDRDMSDCVHSG)TKHD2TVXM@MC)TLOHMF Life of King Solomon +HFGSMHMF2NTQBD  @MC&XLM@RSHB#DUDKNOLDMSNESGD+DRRNM #DRSHMX(L@FD/TAKHRGDQR  Horse,” co-presented with Heidi Potter. 03 Jan (Hicks ’61) Johansson. The Fragrance of His Faithfulness +HFGSMHMF2NTQBD 

+NQH,HQ@MC@’ "NMSQHATSNQHMThe Soul

HOUGHTON | 27 ALUMNI NEWS & NOTES

ALUMNI Houghton College welcomes all submissions to Alumni News & Notes. Due to space limitations, not all news items or photographs may be published and the college reserves the right to edit submissions for space and content. You can send updates via e-mail to magazine@houghton. DCT NQAXQDFTK@QL@HKSNSGD,@QJDSHMF"NLLTMHB@SHNMR.ÉBD .MD6HKK@QC UDMTD 'NTFGSNM -8  6GDMRDMCHMFHMOGNSNRENQ publication please submit digitally in the highest resolution image available (preferably 300dpi). Thank you for keeping in touch with your alma mater!

1938 1944 William entered the ministry and served in various churches the rest of his life. He was Doris (Bain) Thompson, 93, died on October $HKDDM&DAG@QCS3QDHBGKDQ 87, died on thrilled at every opportunity to preach. He 12, 2010. She was a talented musician and December 21, 2010. After working in the is survived by his niece; two nephews; one teacher her entire adult life, teaching music Library of Congress, she devoted her life to great-niece; and three great-nephews. in Bolivar, N.Y. and at the Crane School nurturing her family and supporting her of Music in Potsdam. Doris also taught husband in his medical practice in Virginia. American history and English. After retiring She is survived by her husband, 'NV@QC’ 1950 she published a series of textbooks called her seven children, Lee Treichler ’70, Harold Jenkins, 85, passed away on December Vocabulary Workshop. She is survived by her Ellen Aschenbrenner ’73, Lynn Toth, Kim 23, 2010. He pastored Presbyterian churches husband of 69 years, Dean Thompson ’38; Harsher, Susan Schleith, Nadine Harper, HM›UDRS@SDR 'DRDQUDCHMSGD QLXCTQHMF SGQDDBGHKCQDM@MC›UDFQ@MCBGHKCQDM  and Howard Treichler; 22 grandchildren; World War II, was a prisoner of war, and 10 great-grandchildren; and her sister. received the Bronze Star. He was the beloved husband of Jeanne for 67 years, who survives. 1939 He is also survived by his four children; seven ,@ADK'DRR&QNRUDMNQ 93, passed away on 1945 g r a n d c h i l d r e n ; a n d 1 1 g r e a t- g r a n d c h i l d r e n . April 11, 2010. She was the wife of William ’39; !DMI@LHM QLRSQNMF 87, died in Sellersville, loving mother of three children; grandmother Pa. on December 12, 2010. During his career Janice (Walton) Fulford, 81, passed away on of six; and great-grandmother of 11. During he was a Presbyterian pastor, published OQHK  2GDV@R@QDSHQDCKHAQ@QH@M@MC World War II, Mabel taught English and The Electric Church, was a director at Trans a member of Pi Lambda Sigma and Comfort coached boys’ basketball. Her passions World Radio, was chief administrator for Tyler DAR. She was also a member of Syracuse were reading, learning and traveling. National Religious Broadcasters, and was Alliance Church. She is survived by her husband later inducted into the NRB Hall of Fame. NEXD@QR #@UHC@MCRDUDQ@KBNTRHMR  6HKKH@L5 &QNRUDMNQ 93, passed away on !DMI@LHMGDKCSGDONRHSHNMNECHQDBSNQ -NUDLADQ  1DU &QNRUDMNQRDQUDC of doctoral studies at Faith Theological in churches in Pennsylvania, New Jersey Seminary until last year. He is survived 1951 and Florida. He was a lifetime member of by his wife, Ruth; son, 1NADQS QLRSQNMF’ Lynne (Merryman) Tingley, 80, died the Rotary Club and recipient of their Paul and daughters, Bonnie and Debbie. unexpectedly on September 2, 2010. She moved to Wyoming with her husband, Harris Fellow award. He was honored with "GDRSDQ:"GDS<’ in the early 1970s. the title of Pastor Emeritus of the Church 1947 Lynne loved music and being outdoors and of the Palms in Sarasota, Fla. William was On January 5, 2011, Marion (Thornton) V@R@AKDSNGHJDSGD&Q@MC"@MXNML@MX predeceased by his wife of 68 years, Mabel Cummings, 87, passed away. Marion was a times. She is survived by a brother. (Hess ’39). Surviving are his three daughters; graduate of Ohio Wesleyan College and Ohio six grandchildren; and 11 great-grandchildren. Northern College, and taught sixth grade at Chester D. Rudd, 83, died on February 5, 2011. Fillmore Central School from 1962 to 1986. She He is survived by his wife, Ruth (Knapp) ’51; 1943 is survived by her husband, Robert ’50; son, children, Daniel Rudd, Peter Rudd, ,@QINQHD &VDMCNKXM2SQ@SSNM+NMF@BQD 88, died on Stephen (Kathleen Houck ’71) Cummings ’71; (Martin’75) Webber ’75, Richard (Ruth Reilly ’77) a daughter, Brenda (Daniel ’76) Dix ’75;›UD October 11, 2009. After studying English at Rudd ’78, Valerie (Stephen ’77) Schermerhorn ’78, grandchildren; one great-granddaughter; two 'NTFGSNM &VDMCNKXML@QQHDC1NADQS’ and Andrew Rudd ’83; sister, ,@QF@QDS"G@RD’; sisters; and several nieces and nephews. and the couple spent years in Mexico doing sister-in-law, Araxie Krikorian ’52; nephews, VNQJENQ6XBKHÈD!HAKD3Q@MRK@SNQR (M QLHM2@Q@G8NTC’1TCC’ David they relocated to Dallas where she became 1948 (Cynthia Thompson ’77) Rudd ’77, and Jonathan BDQSH›DCSNSD@BG2O@MHRG &VDMCNKXMHR 6HKKH@L&HÈNQC 86, passed away on June 19, (Janet Marshall ’85) Rudd ’86; nieces, Rebecca survived by her husband; four children; 12  'DV@RRS@SHNMDCHMSGD2NTSG/@BH›B 1TCC’ /QHRBHKK@&KDMM’3GHA@TKS’ grandchildren; and four great-grandchildren. VGDQDGDRDQUDC@R@MNÉBDQHMSGD-@UX Tanya Shirley, and Kathleen Chase ’80; and during World War II. Following the war, grandchild, Stephen Rudd ’06.

28 | HOUGHTON ALUMNI 1957 DR. LEE JOHN BETTS Donnabelle (Pagett) Doan, 74, passed away on January 2, 2011. In 1985 she “Houghton College and its people and her husband spent 18 months have made a positive imprint upon me in Irian Jaya building an addition to which no other entity in my life could the hospital pioneered by her sister match,” wrote Dr. Lee John Betts ’56 in and brother-in-law. The Doans spent 2008 in a letter to President Shirley the following 13 years serving as Mullen ’76, concluding his 12 missionaries in Haiti. She is survived years of service on the President’s by her husband, Richard; a son, Advisory Board. Betts, 76, went Douglas Doan ’82; two daughters; to be with the Lord on November two sisters; six grandchildren; 23, 2010 in Quarryville, Pa. and many nieces and nephews.

Twice a college president during 1958 his long career in higher education, 01 Marjorie (Wohlgemuth) Campbell, +DDB@LDSN'NTFGSNM@R@EQDRGL@MHM 'DV@RSGD›QRSNEGHR 73, passed away on April 15, 2010 after E@LHKXSN›MHRGGHFGRBGNNK@MCSGD›QRSSN@SSDMCBNKKDFD  R@BGHKC @›UD XD@QA@SSKDVHSG KYGDHLDQ’R of a loving, working-class family, I was intimidated somewhat by the disease. Marge received a Master of large high school I attended,” said Betts in a letter to the editor of the Arts in Christian education from Houghton Milieu dated July 3, 1984. “It was at Houghton that I discovered Wheaton College. She taught in ENQSGD›QRSSHLDRNLDNELXKD@CDQRGHO@MCNQF@MHY@SHNM@K@AHKHSHDR  the Weekday Religious Education program in the Virginia public Lee returned to Houghton in July 1993 as a volunteer while on sabbatical school system. Marge is survived by from his position as president of Frederick Community College in her husband, Kenneth; daughter; 02 Frederick, Md. “My goal was to give back a small gift of what I had become and two grandchildren. SNSGDBNLLTMHSXNEODNOKDVGNG@CRNRHFMH›B@MSKXRG@ODCLXKHED The Rev. Dr. John S. Reist Jr. retired CTQHMFSGD’R VQNSD!DSSRHMSGD.BSNADQMilieu article titled recently as professor of Christianity  5NKTMSDDQ1DœDBSRTONM1DSTQMHMFSN'NTFGSNM +DDRODMSLNRSNE and literature from Hillsdale College 1960 SG@SSHLDVNQJHMFVHSGSGD@KTLMH@MCCDUDKNOLDMSNÉBDR @RVDKK@R after 25 years. He taught for 45 years Douglas Blackmer, 71, passed assisting with Summer Alumni Weekend programming. He also served as at various colleges and seminaries. away on May 19, 2010. a voluntary consultant to the president. “Lee was a very strong supporter While at Houghton, Dr. Reist enjoyed Dr. Calvin and Lois (France ’61) of the liberal arts,” said former Houghton College President Daniel playing quarterback on the Gold Johansson will celebrate their Chamberlain. “He had a visceral understanding of what Christian liberal intramural football team, editing 50th wedding anniversary on July arts education was at its best. While he was here, he spent time observing The Houghton Star and singing with 15, 2011. They met as students at and making notes about potential campus improvements, and many of his buddies in his barbershop quartet Houghton when he was assigned as her ‘McCarty’s Midnight Men’ (along his suggestions were implemented on campus by the following year.” accompanist. After earning advanced with his twin brother, Rev. Irwin W. degrees from Union Theological In addition to supporting the college with his time, expertise and Reist ’57). An ordained American Seminary School of Church Music EQHDMCRGHO +DDV@R@BNMRHRSDMS›M@MBH@KBNMSQHATSNQSNL@MXBNKKDFD Baptist minister, he pastored various and Southwest Baptist Theological projects, including the Campaign for Christian Liberal Arts at Houghton, churches in Illinois and Michigan. 01 Seminary, Dr. Johansson began a the Marjorie Paine Prayer Chapel project, and the Van Dyk Lounge 39-year teaching career at Evangel renovation. He also sponsored both a seat in Wesley Chapel and a 1959 University. He has lectured widely and practice room in the Center for Fine Arts and established an endowed Richard Feeck, 73, died on January published two books on the subject. scholarship called “The Betts Scholarship Fund Honoring the Reverend 25, 2011. After graduating from ,QR )NG@MRRNMS@TFGSœTSD OK@XDCHM Houghton, Dick went on to medical Clarence and Florence Betts and Leamon and Kathryn Betts.” SGD2OQHMF›DKC2XLOGNMX.QBGDRSQ@  school and then served as a medical and was employed as minister of adult In addition to his wife of 33 years, Marjorie, Lee is survived by his LHRRHNM@QXHM3@MY@MH@TMCDQSGD and children’s education at a local children, Jon Betts and Timothy Betts; stepson, J. Paul Aierstock Jr.; African Inland Mission. Following church. They have since retired to Fort stepdaughter, Susan Groh Aierstock Rynier; a stepbrother, Dr. Joseph the missionary service, he taught Myers, Fla., but spend summers in eye surgery. In addition to his Potaski; eight grandchildren; and seven great-grandchildren. music ministry at All Saints by the Sea wife, Dick is survived by his son; in Southport, Maine. They have two daughter; and three grandchildren. children and three grandchildren. 02

HOUGHTON | 29 1961 1965 Jan (Hicks) Johansson retired last 1NADQS6 'HKK 66, passed away REV. OLSON W. CLARK year from Evangel Christian School NM2DOSDLADQ  'DVQNSD@ In the early 1940s a young man

ALUMNI where she was a school counselor for ANNJVHSGGHRVHED 8NK@MC@ SHSKDC 20 years, and she is now enjoying Lilies of the Valley: Thistles of the V@RGHQDC@RSGD›QRSVNQJDQNM a second career in writing (see Meadow.'DHRRTQUHUDCAXGHRVHED @ATHKCHMFOQNIDBSHM'NTFGSNM  !NNJRGDKE 2GD@MCGDQGTRA@MC  GHRSVNBGHKCQDMSVNRSDOBGHKCQDM His initial assignment was to 1NADQS G@UDO@RSNQDC$U@MFDK and three grandchildren. dig a sewer ditch – an auspicious Church in New York City for 45 years, V@XSNADFHM@B@QDDQ 3G@S and have raised three children. 1966 young man was 1DU .KRNM6  With over 35 years of teaching, Clark,ENQLDQRS@ÈLDLADQ  1962 ministry and leadership experiences BNLLTMHSXLDLADQ @MC P. Douglas KindschiV@RRDKDBSDCAX HM!HAKDRBGNNKR BGTQBGDR@MC stonemason at Houghton, who the Interfaith Dialogue Association to Christian ministries, Joyce (Wilson) O@RRDC@V@XNM.BSNADQ  FHUDSGHRXD@Q’R1@AAH2HF@K,DLNQH@K Strong now speaks at conferences 2010 at the age of 92. +DBSTQDSHSKDC%QNL3NKDQ@MBDSN'NKX and leadership seminars in the Envy: The Interfaith Agenda.” He U.S., U.K. and countries in Europe, .KRNMADF@MRSTCHDR@S'NTFGSNM served as a dean for 28 years at Grand Asia and Africa. She is the author HMATSSGDMRS@QSDCVNQJVHSG"GDRSDQ8NQJNM'NTFGSNM’RDWO@MRHNM Valley State University and is now the NERDUDMANNJR ENTQNEVGHBG NEE@BHKHSHDR %DKKNV+TBJDX!THKCHMFVNQJDQGordon Barnett ’44 University Professor of Mathematics G@UDADDMSQ@MRK@SDCHMSNNSGDQ QDB@KKR"K@QJ@R@MDMBNTQ@FDQ  OK@PTDNMSGDPT@CRHCDNE+TBJDX and Philosophy. He also directs the languages (see Bookshelf). !THKCHMFROD@JRSN.KRNM’RVNQJHMK@XHMFSGDNUDQODQBDMSNESGD university’s Kaufman Interfaith RSNMDENQSGDATHKCHMF .KRNMQDSTQMDCSN'NTFGSNMHMSNNUDQRDD Institute as well as the Grand Dialogue 1967 construction on the Gillette (East Hall) center section. He also was in Science and Religion for the Greater William Sammons, 64, passed away QDRONMRHAKDENQSGDATHKCHMF’R›QDOK@BDL@MSKD GDKODCVHSGSGDPT@C Grand Rapids Area initiative. on July 6, 2010. He was a former social side Campus Center porch landing, took part in the construction of Geraldine (Evans) Raw, 66, passed studies teacher at Westhill High School one of the Park Drive homes, and even taught former Dean of Students in Syracuse, N.Y. and was the director away on January 15, 2010. In 1949 she 1NADQS#@MMDQGNVSNK@XRSNMDENQ8NQJVNNC'NTRD (M.KRNM of the parenting program at the attended the two-room schoolhouse in received an honorary Bachelor of Arts from Houghton College. 'NTFGSNM VGDMGDQE@LHKXATHKSVG@S Northeast Community Center. He was is now the Brenneman house. After O@RRHNM@SD@ANTSQTMMHMFDRS@SDR@KDR  3GQNTFGNTSGHRKHED .KRNMO@RSNQDCBGTQBGDRHM,HBGHF@M 5DQLNMS FQ@CT@SHMFEQNL"NKTLAH@4MHUDQRHSX  owned two vintage clothing stores, and central New York, served as a youth leader, Sunday school RGDADF@MGDQQDFHRSDQDCMTQRDB@QDDQ and was active in antiquing. He is SD@BGDQ !HAKDB@LOCHQDBSNQ @MCGDKODCBNMRSQTBSMDVBGTQBGDR RTQUHUDCAXGHRAQNSGDQRHRSDQR Holly in Nyack, N.Y., eventually working in in Canandaigua, N.Y. and in Sturgis, Mich. He later returned to the Sammons ’76@MC+@TQHD/@K@YYN@ hospitals in California and Virginia. Houghton area and coordinated the Houghton Area Senior Citizens’ MDOGDVSVNMHDBDR@MCL@MXEQHDMCR  She also played the violin with the &QNTOENQ@MTLADQNEXD@QR @MC#H@MD+XSKD’$LLNMRQDLDLADQR 2@MS@,@QH@2XLOGNMX.QBGDRSQ@ SG@S†GDDRODBH@KKXKNUDCSNRHMFOQ@HRDRSN&NCVGDQDUDQGDVDMS  and sang with the National Christian 1969 @MCQDB@KKR†GHRRDMRDNEGTLNQ@MCGHRGNMDRSXQDF@QCHMFSGD Choir in Washington, D.C. Gerrie is 1NADQS@+NMF@BQD.KAQ@MSY survived RSQTFFKDRNEKHED @SDRS@LDMSSN.KRNM’RBNLOKDSDE@HSG@MCSQTRSHM RTQUHUDCAXGDQGTRA@MC '@KSVN @RDBNMCANTSNEAQD@RSB@MBDQ &NC’ROK@MR 'HRHMœTDMBDV@R†EDKSLNMSG AX LNMSGAXSGDFQNTO  C@TFGSDQRENTQFQ@MCC@TFGSDQR @MCL@RSDBSNLX 1NADQS@VNQJR R@XR1NADQS#@MMDQ @MCHRRSHKKEDKSSNC@X .KRNM’RHMœTDMBDHRLNRS and a sister, 2@MCQ@.RSGDKKDQ’ @R@RTARSHSTSDSD@BGDQHM@OTAKHB school district and is particularly clearly seen in the words of those who knew him, like Rev. Forrest 1963 fond of her Hispanic students Gearhart ’44,VGNVQHSDRSG@S.KRNM’RRJHKK@MCO@SHDMBDBNMPTDQDC Glenna (Stephens) Fleming, 69, passed ADB@TRDRGDFQDVTOHM,DWHBN @KKNARS@BKDR†(KNNJENQV@QCSNADHMFFQDDSDCAXGHLHMGD@UDM  away on January 12, 2011. During her lifetime she enjoyed swimming, Kathy (Barnett) Daake recently .KRNMV@ROQDCDBD@RDCAXGHRVHED +HK@ 'DHRRTQUHUDCAXENTQ V@KJHMF ›DKCGNBJDX SDMMHR NHK traveled to Haiti with World Hope C@TFGSDQR ,@QF@QDS"K@QJ /@SQHBH@1NAHMRNM Susan (David ’73) painting, reading, teaching Sunday (MSDQM@SHNM@KSNSD@BGU@B@SHNM!HAKD Basnight ’74,@MC2@MCQ@5HS@KNMD@RHRSDQ .CDM@'@MRDM’ 2BGNNK KD@CHMF!HAKDRSTCHDR @MC school and meet with other teachers SGQDDFQ@MCC@TFGSDQR@MCRDUDQ@KMHDBDR@MCMDOGDVR spending time with her grandchildren. to exchange curriculum. Kathy and 2GDHRRTQUHUDCAXGDQGTRA@MC )@LDR GDQGTRA@MC 1HBG@QC:#HBJ<’ live ENTQBGHKCQDM@MCMHMDFQ@MCBGHKCQDM  HM!@QSKDRUHKKD .JK@ VGDQD#HBJ is in his 35th year of teaching>

30 | HOUGHTON BGDLHRSQX@S.JK@GNL@6DRKDX@M SQHOSNSGD-DVADQQX+HAQ@QXHM"GHB@FN ALUMNI University. Kathy is a third-generation to conduct research for his new course, ELEANOR GREATBATCH Houghton alumna. Her parents are Finding the Great Plains, was supported +NMF SHLDEQHDMCNE'NTFGSNM Glenn ’48 and Janice (Gracely ’48) HMO@QSAXSGHR@V@QC 05 College, Eleanor Fay Wright Barnett, while her grandmother, &QD@SA@SBG CHDC)@MT@QX +TBX,HKKDQ’!@QMDSS also 1977  HM.WENQC5HKK@FD@S graduated from Houghton. 03 Rich Walker completed a Master of "@MSDQATQX6NNCRHM LGDQRS  &HMH.KMDX&QHÉM served as an 2BHDMBDCDFQDDSGHRO@RS2DOSDLADQ N.Y. She was 90 years old. editor and the author representative in information technology from ENQ)@BJHD'NÈL@MHMGDQVQHSHMFNE Capella University. He completed ,QR &QD@SA@SBGV@R›QRS another lifelong goal of teaching at the Through the Fire with WinePress Books. introduced to Houghton College BNKKDFDKDUDKAXADBNLHMF@M@CITMBS instructor at ITT Technical Institute through music in 1938, when a 1970 choir from the college performed teaching advanced networking topics. !NA#XDQ  CHDCNM-NUDLADQ  at her high school. Years later @ESDQ@ XD@QA@SSKDVHSGB@MBDQ  RGD@MCGDQGTRA@MC6HKRNMF@UD He was a physical education teacher at Houghton its largest gift to date to Katahadin Middle and High School for 03 DMCNV3GD&QD@SA@SBG2BGNNKNE 34 years, and he was recognized for his ,TRHB 'NTFGSNM’R›QRSFQ@CT@SD work in physical education, including NÈDQHMF /QDRHCDMS,TKKDMDWOQDRRDCCDDOFQ@SHSTCDENQ,QR  induction into the University of Maine &QD@SA@SBG’RKNUDNELTRHB@MCGDQKHEDKNMFHMSDQDRSHM'NTFGSNM@MC /QDRPTD(RKD'@KKNE%@LD !NAHR our students as a result of her appreciation of God’s gift of music. RTQUHUDCAXGHRVHEDNEXD@QR /@SRX SGQDDC@TFGSDQR@AQNSGDQ@RHRSDQ $KD@MNQ&QD@SA@SBGKNUDCLTRHB @RCNDRGDQGTRA@MC6HKRNM  RHWFQ@MCBGHKCQDM@MCGHRLNSGDQ  R@HC!DM*HMF SGDCHQDBSNQNESGD&QD@SA@SBG2BGNNKNE,TRHB@MC OQNEDRRNQNEUNHBD 3GQNTFGSGDHQFHESSNDRS@AKHRGSGDFQ@CT@SD 1971 04 music program, all musicians here—along with the entire ,@QX1DILDQ&HARNM 61, passed BNKKDFDBNLLTMHSXŽG@UDADDMQHBGKXAKDRRDCAXSGDHMBQD@RD  @V@XNM.BSNADQ @ESDQ@M $KD@MNQ@MC6HKRNM&QD@SA@SBGG@UDPTHSDKHSDQ@KKXSQ@MRENQLDC DHFGS XD@Q›FGSVHSGB@MBDQ 2GD music-making and music learning in this place. The unique HRRTQUHUDCAXGDQGTRA@MC &@QX intertwining of graduate and undergraduate teaching and learning GDQAQNSGDQ #@UHC1DILDQ’ that is a part of any music program with a graduate component and 20 nieces and nephews. G@RLD@MSSG@S AXRDQUHMFFQ@CT@SDRSTCDMSR@MCFQ@CT@SD E@BTKSXKHMDR SGDDMSHQDDMSDQOQHRDADMD›SR 6DVHKK@KV@XRAD 1973 HMCDASDCSN$KD@MNQ@MC6HKRNM&QD@SA@SBGENQSGDHQUHRHNM SGDHQ The Rev. Stephen Clark is now serving FDMDQNRHSX @MCSGDHQBNM›CDMBDHM'NTFGSNMLTRHBH@MR  @RFHESOK@MMHMF@CUHRNQVHSG6XBKHÈD !HAKD3Q@MRK@SNQRHM.QK@MCN %K@  “Throughout her life,” reads the program from her memorial His wife, Paula (Doughten ’73), is service, “Eleanor was regarded and admired for her intelligence, a retired kindergarten teacher and sense of humor, creativity, strength, faith, love and generosity.” is enjoying the next generation of 2TQUHUNQRHMBKTCDGDQGTRA@MCNEXD@QR 6HKRNMSGQDDRNMR  Houghton alumni – the Clarks have Warren ’73,)NGM *DM@MC@C@TFGSDQ  MMD,@BH@QHDKKN  RHWFQ@MCBGHKCQDMVGNBNTKCAD 2GDHR@KRNRTQUHUDCAXFQ@MCBGHKCQDM@MCSGQDDFQD@S the sixth-generation descendants grandchildren. Her youngest son, Peter, died in 1998. NE2XKUDRSDQ@MC$KHY@ADSG!DCENQC to attend Houghton. 04

1975 Dr. Harry Thompson, executive director of Augustana College’s Center for Western Studies, received the Carole Bland Cultivating Faculty Excellence Award for 2010-11. His recent research 05

HOUGHTON | 31 1980 afterschool program, and supported 1995 !@QNM-NUDLADQ  2GDVNQJR the arts through community and as a lawyer for Investor’s Capital, a Brian Haynes was recently included +@TQ@,DQB@C@MSD,DD is a ANNRSDQNQF@MHY@SHNMR 2TQUHUNQR AQNJDQCD@KDQBNLO@MX @MCL@JDR in the listings of The Best Lawyers songwriter living in Nashville, Tenn. HMBKTCDGDQGTRA@MC #@UHC@ GDQGNLDHM6NATQM ,@RR 

ALUMNI in America 2011,@OTAKHB@SHNMSG@S Recently her original co-written C@TFGSDQ@RNM@MC@RHRSDQ compiles lists of outstanding attorneys Christmas song, “Glorious Day,” was Alicia (Consolo) Powers, Andrew through peer-review surveys from named a winner in the Nashville Hall ’96, David Adams ’97, Daniel leading lawyers. Haynes is employed 1992 Songwriters Association’s Best of the Powers ’97, Dave ’97 and Jennifer AX!NMC 2BGNDMDBJ*HMF /++"  Eugene Schmitt, 40, passed away Season competition and was released &HAANMR’/DCDQRDM and Eric on August 13, 2010. He pursued a HM#DBDLADQ  CCHSHNM@KKXRGDBN VQNSD Brownell ’97 all participated in an 1 1TAX#NKKDQ1NL@MJN 52, passed master’s degree from Georgia Tech SGDSHSKDSQ@BJNEBNTMSQXRHMFDQ)DÈ alumni reunion in January 2011. The @V@XNM-NUDLADQ  2GDV@R University in 1994, and was very active "NQMHRG’R@KATLBetween You and Me. a teacher and administrator for the FQNTOG@RADDMLDDSHMFNM-DV8D@Q’R in the Catholic Church. He received +@TQ@KHUDRVHSGGDQGTRA@MC Dave ’86, &NRGDM"GQHRSH@M2BGNNKR 1TAXG@C Eve since 2002, and also includes the Fourth Degree in the Knights and their two daughters, Jillian and a passion for singing and was the friends and spouses of alumni. 08 NE"NKTLATR $TFDMDHRRTQUHUDCAX .KHUH@ HM!QDMSVNNC 3DMM 06 director of Heaven’s Harmony and GHRVHED *HL@RNMGHRLNSGDQ@MC Sounds of Praise. She is survived RSDOE@SGDQ@RHRSDQ@MC@MDOGDV  2000 AXGDQGTRA@MC ,@QJC@TFGSDQR  1996 Erin (Bennett) Banks and her Bethany Benenati ’05 and Christine )TMHODQ,@X!@AAHSSV@RANQMNM GTRA@MC 3HL @QDG@OOXSN@MMNTMBD +@%Q@MBDSVNRNMR›UDAQNSGDQR@MC 1993 May 6, 2011 to )DÈ’ and Angela SGDAHQSGNESGDHQC@TFGSDQ  U@ RHRSDQR@MCRDUDQ@KMHDBDR@MCMDOGDVR Douglas Bowerman, M.D. and *DOODM’!@AAHSS She weighed 1NRD2@U@MM@G!@MJR ANQMNMGDQ #DANQ@G2GNKCHBD were married on three pounds, eight ounces upon due date of April 27, 2011. 09 1985 #DBDLADQ  3GDHQ›QRSC@SD arrival at Sisters Hospital in V@R@S'NTFGSNMNM#NTF’RAHQSGC@XHM !TÈ@KN - 8 )TMHODQINHMRRHAKHMFR Amy (Hautzinger) Stamp, 47, died  @MCSGDXVDQD›M@KKXL@QQHDC 2001 -NUDLADQ  2GDQDBDHUDCGDQ Dylan, Kirsten and Evan. 07 XD@QRK@SDQNM#DA’RAHQSGC@XHM  2G@VM@+DD"NKDHMF@MCGDQGTRA@MC master’s degree from Youngstown They now live in Canandaigua, N.Y. @QDOKD@RDCSN@MMNTMBDSGDAHQSGNE State University and was employed 1998 SGDHQRDBNMCA@AX  C@+NTHRD"NKDHMF  @R@RBHDMBDSD@BGDQ@S+@JDRHCD'HFG 1DADBB@'HBDFQ@CT@SDCEQNL2TÈNKJ ANQMNM TFTRS  10 2BGNNKHM RGS@ATK@ .GHN  LXV@R@ +@V2BGNNKHM,@X @MCV@RRVNQM Sunday school teacher, helped with an HM@R@LDLADQNESGD,@RR@BGTRDSSR

07 09 11

12

08

10

06

32 | HOUGHTON Dana (Basnight) Brown earned her Mack, Kristen (Dorsey) Pickard, University of Connecticut in May AHNCHUDQRHSX@MCBNMRDQU@SHNM 2GD ALUMNI doctorate in cognitive psychology from ,NMHB@2@LR&Q@È@L and 2010, and is an assistant professor of is currently teaching middle school 4MHUDQRHSX@S KA@MX@MCHRBTQQDMSKX Kristi (Fagan) Colarusso. 13 chemistry at Cedarville University. science at a private school in working as a postdoctoral research His wife, Becca (Byrne), works as a South Carolina. scientist examining the cognitive 2002 recreational therapist. The family VDKBNLDC+@TQ@)NX'M@SHTJSNSGD and neurological processes involved 1DADBB@-DTADQS married Benjamin 2006 E@LHKXNM.BSNADQ  15 in human language and memory (see Dominguez on July 24, 2010. Houghton 1DADBB@:!DBJX<'HKKL@M married Bookshelf). Her dissertation work alumni present at the wedding included Sisters Aimee (Smith) Dehaven 1NADQS,@FHKKNM)TKX  3GD focused on the mechanisms underlying Tim ’01 and Mollie (Milward ’01) Ashley, and ,DKHRR@2LHSG’+TBJDX AQHC@KO@QSXHMBKTCDC'NTFGSNM SGDSQ@MRK@SHNMOQNBDRRHMAHKHMFT@KR @ Tom Westervelt ’07, Tim ’01 and are overjoyed to announce new alumni Michelle Hillman ’08, Katelyn series of studies which earned her the Melissa (Winey ’02) Esh, Kevin additions to their families. Melissa (Morgan ’07) Bowers, and Jennifer Distinguished Doctoral Dissertation ,@B#NM@KC’ +HR@/NQSDQ’  @MCGDQGTRA@MC 1NA’ welcomed +HFFDSS’1NSAK@SS .SGDQ'NTFGSNM Award for young scientists. 11 Sandra Conner ’03, and Jason ’01 )@CDM2BNSS+TBJDXNM)TKX   alumni in attendance were: Eva and +HMCRDX6HMM’ Bewick. Jennifer PerryL@QQHDC$KKHNS+@MDR VGHKD HLDD@MCGDQGTRA@MC  -NDSGDQ’'HKKL@M '@QS1NSAK@SS Several Houghton graduates from the NM2DOSDLADQ HM-DV8NQJ  Shane, welcomed Parker Joy ’ +DRKHD3Q@TSL@M’ ,HBG@DK Dominguez family were present as N.Y. Natasha (Perry ’08) Ashley was DeHaven on June 14, 2010. 16 #@AMDX’ &QDF.M’ 1NCMDX’ well, including Judy (Wickware ’64), SGDL@SQNMNEGNMNQ .SGDQ'NTFGSNM and )@LHD*TKHBJ’$ADQKX 2TR@M Samuel ’92, Matthew ’95 and Jennifer alumni in attendance included Jordan 2004 (Hillman ’69) Dempsey, James (Berger ’94), and Amanda ’05. 14 Ashley ’09 and Amanda (Willey ’00) Megan (Springstead) Neurock Noether ’65, and Richard Sullivan +TSNLH@ )DMMHEDQ@MCGDQGTRA@MC @MCGDQGTRA@MC )NM@SG@M @QD Jr. ’74. Becky is currently pursuing live in Washington, D.C. 12 2003 CDKHFGSDCSN@MMNTMBDSGDAHQSG licensure as a massage therapist Karen (Jennings) Buell was inducted of their daughter, Jocelyn Dudley VGHKD1NADQSHR@ONKHBDNÉBDQ @MC ,DKHRR@2LHSG+TBJDX and several into Genesee Valley Central School’s -DTQNBJ NM#DBDLADQ  17 they reside in Easton, Pa. 18 former housemates and friends 2010 Wall of Fame. She now works from the class of 2001 spent some in Massachusetts as an Internet 2007 time together with their kids this AQ@MBGNÉBDQVHSG/DNOKDR!@MJ 2005 past August. The group included +HMCR@X!NVDQL@M received her $KHY@ADSG/DSQHKKN,@QBDKKHM and KDW9DKHMRJX!NNSG +HMCR@X Nathan Hnatiuk earned his doctorate Master of Science degree from GDQGTRA@MC )D@M @QDOKD@RDCSN (McCoid) Perkins, Heidi (Sedley) in organic chemistry from the University of Connecticut in @MMNTMBDSGDAHQSGNE,@CDKXM 2XKUHDNM2DOSDLADQ 

13 14 17

Liesl Diesel ’02 15 16

18

HOUGHTON | 33 2008 2010 Nicole (Trask) Gustafson and Scott Curren, P.A.C.E. Cohort Z6, GDQGTRA@MC  K@M VDKBNLDC has accepted a new position in the

ALUMNI *@SGQXM:*@SHD<,@QHD&TRS@ERNM Investment Management and Trust into the world on July 19, 2010. Services Department at Northwest Savings Bank in Warren, Pa. Scott +XCH@!HBJMDKK and Timothy Kopacz has started studying for the Series 7 were united in marriage on August 7, DW@LSNADBNLD@KHBDMRDCAQNJDQ  2010 at Rye Beach, N.H. Fellow alumni @SSGDVDCCHMFHMBKTCDCAQHCDRL@HC Joanna Brautigam ’10EQHDMCR@MC Honorary 2008 graduates Heidi Putnam, Catherine Clark Kroeger died on )DMMHEDQ3@XKNQ ,@QHD2GDQVNNC +XCH@ %DAQT@QX  (M#Q *QNDFDQ 3GNQMAK@CD@MC RGKDX2G@LA@BG received an honorary doctorate *TGMR and photographer Havilah Ford from Houghton and served as that year’s commencement speaker. She ’09. The couple resides in Fremont, ARTHUR LYNIP - ' VGDQD+XCH@SD@BGDR›ESGFQ@CD authored, co-authored or edited @MC3HLQTMRGHRNVMATRHMDRR 19 ANNJR @MCS@TFGS@S&NQCNM QSGTQ6 +XMHO Houghton’s academic dean from 1950 to Cornwell Theological Seminary. Dr. 1966, died on Sunday, January 16, 2011. He was 97. Ethan SjolanderL@QQHDC+@TQ@ Kroeger was the founding president ,NNCHDNM)TKX  3GDAQHCD NE"GQHRSH@MRENQ!HAKHB@K$PT@KHSX  (MSGDCDCHB@SHNMNESGDDCHSHNMNESGD!NTKCDQ +XMHOV@RCDRBQHADC@R and groom currently reside in North 2GDHRRTQUHUDCAXGDQ›UDBGHKCQDM ADHMF@"GQHRSH@MFDMSKDL@M@MCPTHDSRBGNK@Q L@RSDQ@CLHMHRSQ@SNQ  Haverhill, N.H. Ethan is employed 10 grandchildren, including Ruth VHRDBNTMRDKNQVHSG@MD@QRXLO@SGDSHBSNRSTCDMSR’OQNAKDLR ADKNUDC @R@M@CLHMHRSQ@SHUD@RRHRS@MSAXK@V *QNDFDQ’ and her two sisters. ENQJDDMVHS@MCRTASKDGTLNQ @MTMCDQRS@MCHMFE@SGDQ SD@BGHMFGHR ›QL!NHDR 2BGHKKDQ @MC%KDWMDQHM BGHKCQDM@ESDQGHLSNJDDOSGDV@XNESGD+NQC 2STCDMSROQ@HRDCGHR '@MNUDQ - ' @MC+@TQ@HR@RHWSG grade science teacher at Haverhill UWC BNLLHSLDMSSNHLOKDLDMSSGDKHADQ@K@QSRBTQQHBTKTL@MCSNOQNUHCD Dale D. Vanderpool, 65, died January 6, Cooperative Middle School. 20 HM BK@RROTAKHBRBGNNKSD@BGHMFDWODQHDMBDSNDCTB@SHNML@INQR VGHKD 2011, in West Reading, Pa. He received faculty appreciated his advocacy for increasing salaries, reducing ANSGGHR!@BGDKNQNE QSR@MC,@RSDQNE MTLADQRNEOQDO@Q@SHNMR@MCHMSQNCTBHMFR@AA@SHB@KKD@UDR  2009 Education degrees in special education "@HSKHM+NESTR married Andrew at the former Wesleyan College in His work wasn’t limited to the 16 years he spent as Houghton’s academic 2JHMMDQNM%DAQT@QX   Allentown. He was a youth counselor CD@M $UDM@ESDQ+XMHOKDES'NTFGSNMENQMDV@CUDMSTQDR GDQDSTQMDC MCQDVHRBTQQDMSKXDLOKNXDCAX @SSGD1DC1NBJ)NA"NQD +NODY /@  to speak at Founder’s Day Convocations and Heritage Chapel services. the U.S. Air Force and is stationed from 1983 to 1986. He was a Nazarene (MGHR@CCQDRRDRGDVNTKCQDLHMCBTQQDMSRSTCDMSRNESGDAQ@UDLDM at Joint-Base Elmendorf-Fort LHMHRSDQHM%HMCK@X .GHN@MCS@TFGS @MCVNLDMVGNG@CATHKS'NTFGSNM"NKKDFD 'DSNKCRSNQHDR ATSLNQD Richardson in Anchorage, Alas. in the St. Mary’s School District. Dale than that, he challenged students from the platform. In 1975 he looked Caitlin has started a master’s degree in HRRTQUHUDCAXGHRVHED "@SGDQHMD environmental education at Southern at the audience and dared, “The world is wide open to meaningful SVNRNMRSVNRSDOC@TFGSDQR›UD Connecticut State University. RHRSDQR@MCENTQAQNSGDQR personal engagement wherein the called, chosen, elected – you – can FN@MXVGDQDSNADSGD@QNL@NER@UHMFFQ@BDSNODQRNMRHMSQNTAKD 

20 +XMHOD@QMDCGHR!@BGDKNQNE QSREQNL'NTFGSNM"NKKDFDHM 19 @MCANSGGHRL@RSDQ’R@MCCNBSNQ@SDEQNL-DV8NQJ4MHUDQRHSX (1939, 1950). He taught high school and college English and RDQUDC@R@GHFGRBGNNKOQHMBHO@KNM+NMF(RK@MC 'D@KRNS@TFGS at Westmont College for 10 years and served as the chaplain at SVN6XBKHÈD!HAKD3Q@MRK@SHNMA@RDRHMSGD/GHKHOOHMDR 

'DHRRTQUHUDCAX@RNM 2SDOGDM’*@QDM&QDDQ‘ a daughter, )TCHSG2G@CENQC’›UDFQ@MCBGHKCQDM *DHSG L@QHR.QKDL@MM’ +XMHO’ !QX@M*HLADQKX1NADQSR’+XMHO‘ *@SGQXM)  +XMHO’ &VMXDSG1@LHQDY@MC&@QDSG!QNVM@MCMHMDFQD@S FQ@MCBGHKCQDM 'DV@ROQDBDCDCHMCD@SGAXGHRVHED +NQ@%NRSDQ’

34 | HOUGHTON Thank you to all of our alumni and friends who supported 'NTFGSNM"NKKDFD›M@MBH@KKXHM SGD ›RB@KXD@QÕ

8NTQO@QSMDQRGHOVHSG'NTFGSNM challenges students to academic excellence and empowers them to enrich the world. Every gift counts–no matter how big or small. It’s all about participation– VGHBGHRBQHSHB@KSNENTMC@SHNMRTOONQS@MC@CU@MBHMF'NTFGSNM’R mission and reputation.

To make your gift count visit www.houghton.edu/makeagift

SAVE THE DATE 1883 Society and James S. Luckey Society luncheon FRIDAY, 10.07.11 Homecoming Weekend Nonprofit Org U.S. Postage PAID Permit #2 Buffalo, NY

One Willard Avenue | Houghton, NY 14744

MARK YOUR CALENDAR FOR HOMECOMING 2011 OCTOBER 8-9, 2011 If your graduating class year ends in ‘1’ or ‘6,’ be sure to return for an opportunity to spend time with your classmates. t
4QFDJBM
SFDPHOJUJPO
GPS
UIF
UI
reunion class from 1986. t
&OKPZ
BMM
UIF
FYDJUFNFOU
PG
Homecoming combined with an opportunity to catch up with classmates and their families. No matter your class year, we hope ZPV
XJMM
KPJO
VT
8IFUIFS
ZPV
SVO
JO
UIF
,
HFU
B
UFBN
UPHFUIFS
GPS
PVS
HPMG
scramble, take part in the festival on the RVBE
KPJO
UIF
)PVHIUPO
$PMMFHF
$IPJS
for one more song in Wesley Chapel, or participate in any of the other Homecoming festivities, we know that you will have a great time back at Houghton! DO YOU RECOGNIZE THESE PEOPLE? Contact us at [email protected] to help invite classmates and plan Help us identify these people and be entered into a drawing the reunion for your class. for a Houghton College sweatshirt. To enter, log onto community.houghton.edu, register if you are not already a member of the Online Community, and then enter your answer.