Distinct Patterns of Neuropeptide Gene Expression in the Lateral Hypothalamic Area and Arcuate Nucleus Are Associated with Dehydration-Induced Anorexia

Total Page:16

File Type:pdf, Size:1020Kb

Load more

The Journal of Neuroscience, July 15, 1999, 19(14):6111–6121 Distinct Patterns of Neuropeptide Gene Expression in the Lateral Hypothalamic Area and Arcuate Nucleus Are Associated with Dehydration-Induced Anorexia Alan G. Watts, Graciela Sanchez-Watts, and Andrea B. Kelly The Neuroscience Program and the Department of Biological Sciences, University of Southern California, Los Angeles, California 90089-2520 We have investigated the hormonal and hypothalamic neu- required for anorexia after dehydration because PVH CRH ropeptidergic substrates of dehydration-associated anorexia. mRNA in dehydrated adrenalectomized animals is unchanged In situ hybridization and hormone analyses of anorexic and from euhydrated adrenalectomized controls. We also showed paired food-restricted rats revealed two distinct profiles. First, that LHA CRH mRNA was strongly correlated with the intensity both groups had the characteristic gene expression and endo- of anorexia, increased LHA CRH gene expression preceded the crine signatures usually associated with starvation: increased onset of anorexia, and dehydrated adrenalectomized animals neuropeptide Y and decreased proopiomelanocortin and neu- (which also develop anorexia) had elevated LHA CRH gene rotensin mRNAs in the arcuate nucleus (ARH); increased circu- expression with a distribution pattern similar to intact animals. lating glucocorticoid but reduced leptin and insulin. Dehydrated Finally, we identified specific efferents from the CRH-containing animals are strongly anorexic despite these attributes, showing region of the LHA to the PVH, thereby providing a neuroana- that the output of leptin- and insulin-sensitive ARH neurons that tomical framework for the integration by the PVH of neuropep- ordinarily stimulate eating must be inhibited. The second pat- tidergic signals from the ARH and the LHA. Together, these tern occurred only in anorexic animals and had two compo- observations suggest that CRH and neurotensin neurons in the nents: (1) reduced corticotropin-releasing hormone (CRH) LHA constitute a novel anatomical substrate for their well mRNA in the neuroendocrine paraventricular nucleus (PVH) and known anorexic effects. (2) increased CRH and neurotensin mRNAs in the lateral hypo- Key words: feeding behavior; anorexia; neuropeptides; thalamic (LHA) and retrochiasmatic areas. However, neither corticotropin-releasing hormone; arcuate nucleus; lateral hypo- corticosterone nor suppressed PVH CRH gene expression is thalamus; paraventricular nucleus; leptin; glucocorticoid Feeding in rats is regulated, like other motivated behaviors, by medial (DMH) nuclei, and retrochiasmatic area (RCH), with interactive inhibitory and stimulatory networks (Stricker, 1990). further contributions from the lateral hypothalamic area (LHA) Rat ingestive behaviors consistently and predictably occur during and paraventricular nucleus (PVH) (Elmquist et al., 1998a,c). In the dark period with unlimited food and water. Eating and drink- this context, neuropeptide Y (NPY) stimulates food intake when ing are alternately initiated and terminated by integrative mech- injected into the brain, whereas altered NPY and proopiomela- anisms involving peptidergic neural circuits, visceral sensory nocortin (POMC) mRNA levels in the ARH occur during depri- feedback, and circulating nutrient and hormone levels (Woods et vation (for review, see Woods et al., 1998). Regarding behavioral al., 1998). Dysfunction in this physiological network disturbs inhibition, deprivation-induced eating is suppressed by intraven- eating behaviors with serious consequences. For example, disrup- tricular injection of corticotropin-releasing hormone (CRH) or tion of leptin and associated neuropeptide signaling results in neurotensin (Morley, 1987; Woods et al., 1998). Agonists of the obesity (Elmquist et al., 1999), whereas an inability to restrain melanocortin (MC) 3/4 receptor reduce food intake (Fan et al., inhibitory mechanisms leads to anorexia, with consequent nega- 1997; Thiele et al., 1998), whereas MC3/4R antagonist adminis- tive energy balance and body wasting (Schwartz et al., 1995). tration or MC4R knockout mice provoke hyperphagia (Hruby et Several neuropeptides are strongly implicated in activating al., 1995; Huszar et al., 1997). Although the PVH is implicated in eating, and the detailed organization of their cognate neural mediating some of these anorectic effects (Heinrichs et al., 1993), circuits is being clarified. For example, to regulate eating, leptin the details of the circuits responsible for generating anorexia targets neuropeptide-containing neurons in a primary network remain less clearly defined than those responsible for stimulating consisting of the arcuate (ARH), ventromedial (VMH), dorso- eating. To examine this question we have used in situ hybridization to Received Feb. 25, 1999; revised April 27, 1999; accepted April 27, 1999. compare the dynamics of four key neuropeptide mRNAs (CRH, This study was supported by Grant NS 29728 (A.G.W.) from the National Institute neurotensin, NPY, POMC) in the ARH, PVH, LHA, and RCH of Neurological Diseases and Stroke, National Institutes of Health. We thank Drs. P. during dehydration-associated anorexia and pair-fed food depri- Dobner (NT/N), D. Larhammar (NPY), J. Majzoub (CRH), and J. Roberts (POMC) for gifts of cDNAs for probe preparation. We also thank Cynthia Kay- vation. Although thirst is the obvious behavioral correlate of Nishiyama and Dr. JunQi Zheng for technical assistance. dehydration, when prolonged it also generates an intense an- Correspondence should be addressed to Dr. Alan G. Watts, Program in Neural, Informational and Behavioral Sciences, Hedco Neuroscience Building, MC 2520, orexia (Watts, 1999). Because digestion requires significant water University of Southern California, Los Angeles, CA 90089-2520. investment, some of which is subsequently lost by colonic excre- Copyright © 1999 Society for Neuroscience 0270-6474/99/196111-11$05.00/0 tion, dehydration-associated anorexia is a physiologically gener- 6112 J. Neurosci., July 15, 1999, 19(14):6111–6121 Watts et al. • Neuropeptide Gene Expression Associated with Dehydration-Induced Anorexia ated behavioral reflex critical for protecting the fluid compart- Radioimmunoassays. Concentrations of serum leptin, plasma ACTH, ment. We have recently shown that when animals are dehydrated insulin, and corticosterone were all measured by double-antibody radio- immunoassays (RIAs) using commercially available 125I-labeled antigen by replacing drinking water with 2.5% saline, anorexia develops kits. Plasma insulin and leptin were measured using kits purchased from relatively slowly but is rapidly reversed once access to water is Linco Research (St. Charles, MI), with the lower sensitivity limits being restored, a behavioral structure consistent with the presence of 100 pg/ml and 0.5 ng/ml, respectively, whereas the intra-assay coefficients simultaneous activated sets of neural circuits that independently of variation were ,9.4% and ,6.8%, respectively. Plasma ACTH con- stimulate or suppress eating (Watts, 1999). We hypothesize that centrations were determined using an RIA kit purchased from ICN Biochemicals (Costa Mesa, CA). The lower sensitivity limit was 30 pg/ml, modified patterns of appetite-regulating neuropeptide gene ex- and the intra-assay coefficient of variation was ,10.5%. Plasma cortico- pression apparent during dehydration but not food restriction are sterone concentrations were determined using an RIA kit purchased associated with anorexia, whereas changes seen during both from ICN Biochemicals. The lower sensitivity limit was 12 ng/ml, and the dehydration and food restriction are likely associated with hunger intra-assay coefficient of variation was ,8.5%. For all hormones, all and the ensuing bout of eating that occurs once water is returned samples were run in single assays. In situ hybridization. Eight series of one in eight 15-mm-thick frontal (Watts, 1999). Because these data identified the LHA as a sections were cut through the hypothalamus and saved in ice-cold potas- potential mediator of anorexia, we also used injections of Phaseo- sium PBS (KPBS) containing 0.25% paraformaldehyde, pH 7.4. Sections lus vulgaris leucoagglutinin (PHA-L) to determine whether the were mounted the same day onto poly-L-lysine-coated gelatin-subbed region containing CRH neurons provides afferent projections to slides, vacuum-desiccated overnight, post-fixed in KPBS/4% paraformal- the PVH. dehyde for 1 hr at room temperature, rinsed five times for 5 min in clean KPBS, air-dried, and then stored at 270°C in air-tight containers con- Some of these data have been reported previously in abstract taining silica-gel desiccant for hybridization at a later date. Serial sec- form (Watts and Sanchez-Watts, 1998; Watts et al., 1998) tions were saved for thionin staining. Sections were hybridized using 35S-labeled cRNA probes for ppCRH MATERIALS AND METHODS [a 700 bp fragment encoding part of exon 1 and all of exon 2 (Frim et al., Animals. Adult male Sprague Dawley rats [250–260 gm body weight 1990)], ppNT/N [a 336 bp fragment encoding part of exon 4 (Kislauskis (BW) at the start of the experiment] were individually caged and main- and Dobner, 1990)], POMC [a 538 bp fragment encoding part of exon 3 tained on a 12 hr light/dark schedule with lights on at 6 A.M. with (Drouin and Goodman, 1980)], or NPY [a 287 bp fragment encoding part unlimited access to food (Teklad rodent diet 8604) and water. Food of exon 2 (Larhammar et al., 1987)] mRNAs synthesized
Recommended publications
  • Neurotensin Activates Gabaergic Interneurons in the Prefrontal Cortex

    Neurotensin Activates Gabaergic Interneurons in the Prefrontal Cortex

    The Journal of Neuroscience, February 16, 2005 • 25(7):1629–1636 • 1629 Behavioral/Systems/Cognitive Neurotensin Activates GABAergic Interneurons in the Prefrontal Cortex Kimberly A. Petrie,1 Dennis Schmidt,1 Michael Bubser,1 Jim Fadel,1 Robert E. Carraway,2 and Ariel Y. Deutch1 1Departments of Pharmacology and Psychiatry, Vanderbilt University Medical Center, Nashville, Tennessee 37212, and 2Department of Physiology, University of Massachusetts Medical Center, Worcester, Massachusetts 01655 Converging data suggest a dysfunction of prefrontal cortical GABAergic interneurons in schizophrenia. Morphological and physiological studies indicate that cortical GABA cells are modulated by a variety of afferents. The peptide transmitter neurotensin may be one such modulator of interneurons. In the rat prefrontal cortex (PFC), neurotensin is exclusively localized to dopamine axons and has been suggested to be decreased in schizophrenia. However, the effects of neurotensin on cortical interneurons are poorly understood. We used in vivo microdialysis in freely moving rats to assess whether neurotensin regulates PFC GABAergic interneurons. Intra-PFC administra- tion of neurotensin concentration-dependently increased extracellular GABA levels; this effect was impulse dependent, being blocked by treatment with tetrodotoxin. The ability of neurotensin to increase GABA levels in the PFC was also blocked by pretreatment with 2-[1-(7-chloro-4-quinolinyl)-5-(2,6-dimethoxyphenyl)pyrazole-3-yl)carbonylamino]tricyclo(3.3.1.1.3.7)decan-2-carboxylic acid (SR48692), a high-affinity neurotensin receptor 1 (NTR1) antagonist. This finding is consistent with our observation that NTR1 was localized to GABAergic interneurons in the PFC, particularly parvalbumin-containing interneurons. Because neurotensin is exclusively localized to dopamine axons in the PFC, we also determined whether neurotensin plays a role in the ability of dopamine agonists to increase extracellular GABA levels.
  • Supporting Information for Proteomics DOI 10.1002/Pmic.200700142

    Supporting Information for Proteomics DOI 10.1002/Pmic.200700142

    Supporting Information for Proteomics DOI 10.1002/pmic.200700142 Karl Skld, Marcus Svensson, Mathias Norrman, Benita Sjgren, Per Svenningsson and Per E. Andren´ The significance of biochemical and molecular sample integrity in brain proteomics and peptidomics: Stathmin 2-20 and peptides as sample quality indicators ª 2007 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim www.proteomics-journal.com SUPPORTING INFORMATION Supporting Information Table 1. Degraded protein identities and peptide sequences in the striatum after 1, 3, and 10 min post-mortem. UniProtKBa. Protein name Sequenceb Scorec P60710/P63260 Actin, cytoplasmic 1,2 A.LVVDNGSGMCK.A 56 E.MATAASSSSLEKS.Y 55 W.IGGSILASLSTFQQ.M 64 W.ISKQEYDESGPSIVHRK.C 93 M.WISKQEYDESGPSIVHRK.C 56 Q8K021 Secretory carrier-associated F.ATGVMSNKTVQTAAANAASTAATSAAQNAFKGNQM.- 124 membrane protein 1 Q9D164 FXYD domain-containing ion L.ITTNAAEPQK.A 58 transport regulator 6 precursor L.ITTNAAEPQKA.E 57 L.ITTNAAEPQKAE.N 89 L.ITTNAAEPQKAEN.- 54 P99029 Peroxiredoxin 5, mitochondrial M.APIKVGDAIPSVEVF.E 57 precursor P01942 Hemoglobin alpha subunit F.LASVSTVLTSKYR.- 106 M.FASFPTTKTYFPHF.D 72 L.ASHHPADFTPAVHASLDK.F 76 T.LASHHPADFTPAVHASLDK.F 59 L.LVTLASHHPADFTPAVHAS.L 56 L.LVTLASHHPADFTPAVHASLDK.F 71 L.LVTLASHHPADFTPAVHASLDKFLASVST.V 66 T.LASHHPADFTPAVHASLDKFLAS.V 55 L.VTLASHHPADFTPAVHASLDKFLAS.V 68 -.VLSGEDKSNIKAAWGKIGGHGAEYGAEALER.M 97 -.VLSGEDKSNIKAAWGKIGGHGAEYGAEALERM.F 58 P02088/P02089 Hemoglobin beta-1,2 subunit L.LVVYPWTQRY.F 53 L.LVVYPWTQRYF.D 52 Q00623 Apolipoprotein A-I precursor Y.VDAVKDSGRDYVSQFESSSLGQQLN.L
  • The Role of Neuromedin B in the Regulation of Rat Pituitary-Adrenocortical Function

    The Role of Neuromedin B in the Regulation of Rat Pituitary-Adrenocortical Function

    Histol Histopathol (1 996) 1 1 : 895-897 Histology and Histopathology The role of neuromedin B in the regulation of rat pituitary-adrenocortical function L.K. ~alendowicz~,C. Macchi2, G.G. Nussdorfer2and M. Nowakl 'Department of Histology and Embryology, School of Medicine, Poznan, Poland and 2Department of Anatomy, University of Padua, Padua, ltaly Summary. The effects of a 7-day administration of NMB-receptor antagonist (NMB-A) (Kroog et al., neuromedin B (NMB) andlor (~~r~,D-phe12)-bornbesin, 1995). an NMB-receptor antagonist (NMB-A) on the function of pituitary-adrenocortical axis were investigated in Materials and methods the rat. NMB raised the plasma concentration of aldosterone, without affecting that of ACTH or Experimental procedure corticosterone; the simultaneous administration of NMB-A prevented the effect of NMB. Neither NMB nor Adult female Wistar rats (200k20 g body weight) NMB-A treatments induced significant changes in were kept under a 12:12 h light-dark cycle (illumination adenohypophysis and adrenal weights, nor in the average onset at 8:00 a.m.) at 23 T,and maintained on a volume of zona glomerulosa and zona reticularis cells. standard diet and tap water ad libitum. The rats were NMB-A administration lowered the volume of zona divided into equal groups (n=8), which were fasciculata cells, an effect annulled by the concomitant subcutaneously injected daily with NMB, NMB-A or NMB administration. Our results suggest that NMB NMB plus NMB-A (Bachem, Bubendorf, Switzerland) specifically stimulates aldosterone secretion, and that dissolved in 0.2 m1 0.9% NaC1, for 7 consecutive days. endogenous NMB or NMB-like peptides exert a tonic The dose was 1 nmo1/100 g body weight.
  • 2733.Full-Text.Pdf

    2733.Full-Text.Pdf

    The Journal of Neuroscience, April 1995, 15(4): 2733-2747 Complementary Distribution of Receptors for Neurotensin and NPY in Small Neurons in Rat Lumbar DRGs and Regulation of the Receptors and Peptides after Peripheral Axotomy X. Zhang, Z.-Q. Xu, L. Bao, A. Dagerlind, and T. H&felt Department of Neuroscience, Karolinska Institute, 171 77 Stockholm, Sweden Neurotensin (NT) has been reported to have antinocicep- minals is the superficial dorsal horn of the rat spinal cord (Uhl tive effects at the spinal level. In situ hybridization, electro- et al., 1979; Gibson et al., 1981; Hunt et al., 1981; Ninkovic et physiology, immunohistochemistry, and electronmicros- al., 1981; Seybold and Elde, 1982; Seybold and Maley, 1984; copy were used to investigate the distribution of NT Todd et al., 1992; Proudlock et al., 1993). Since NT has not receptors, possible effects of NT on primary sensory neu- been reported to be present in normal dorsal root ganglion rons, and the effect of nerve injury on the expression of NT (DRG) neurons,it has been assumedthat the densenetwork of receptors and NT. NT receptor (Pi) mRNA was observed in NT-IR fibers in the dorsal horn originatesfrom the local neurons. more than 25% of the small dorsal root ganglion (DRG) However, low amounts of NT-like immunoreactivity (LI) may neurons, which lacked neuropeptide Y NPY-R mRNA and be present in a few primary afferent fibers in the dorsal horn essentially other neuropeptide mRNAs. Intracellular re- under normal circumstances(Zhang et al., 1993b). Behavioral, cording using voltage-clamp mode showed that NT evokes neurophysiological,and pharmacologicalstudies have indicated an outward current in NPY-insensitive small neurons, and functional roles for NT in the dorsal horn.
  • Neuropeptide Alterations in the Tree Shrew Hypothalamus During Volatile Anesthesia

    Neuropeptide Alterations in the Tree Shrew Hypothalamus During Volatile Anesthesia

    Published in "-RXUQDORI3URWHRPLFVGRLMMSURW" which should be cited to refer to this work. Neuropeptide alterations in the tree shrew hypothalamus during volatile anesthesia Laetitia Fouillen1, Filomena Petruzziello, Julia Veit, Anwesha Bhattacharyya, Robert Kretz, Gregor Rainer, Xiaozhe Zhang⁎ Visual Cognition Laboratory, Department of Medicine, University of Fribourg, Chemin du Musée 5, Fribourg, CH-1700, Switzerland Neuropeptides are critical signaling molecules, involved in the regulation of diverse physiological processes including energy metabolism, pain perception and brain cognitive state. Prolonged general anesthesia has an impact on many of these processes, but the regulation of peptides by general anesthetics is poorly understood. In this study, we present an in-depth characterization of the hypothalamic neuropeptides of the tree shrew during volatile isoflurane/nitrous oxide anesthesia administered accompanying a neurosurgical procedure. Using a predicted-peptide database and hybrid spectral analysis, we first identified 85 peptides from the tree shrew hypothalamus. Differential analysis was then performed between control and experimental group animals. The levels of 12 hypothalamic peptides were up-regulated following prolonged general anesthesia. Our study revealed for the first time that several neuropeptides, including alpha-neoendorphin and somatostatin-14, were altered during general anesthesia. Our study broadens the scope for the involvement of neuropeptides in volatile anesthesia regulation, opening the possibility for investigating the associated regulatory mechanisms. 1. Introduction Neuropeptides act as neuromodulators, tuning the efficacy of fast acting neurotransmitters, and are thought to be mostly General anesthesia is characterized by several components released by volume transmission. A line of evidence has http://doc.rero.ch such as hypnosis and analgesia [1], and is used during medical demonstrated that general anesthesia can evoke the extracel- and experimental surgical procedures to reduce pain.
  • Biologically Active Peptides from Australian Amphibians

    Biologically Active Peptides from Australian Amphibians

    Biologically Active Peptides from Australian Amphibians _________________________________ A thesis submitted for the Degree of Doctor of Philosophy by Rebecca Jo Jackway B. Sc. (Biomed.) (Hons.) from the Department of Chemistry, The University of Adelaide August, 2008 Chapter 6 Amphibian Neuropeptides 6.1 Introduction 6.1.1 Amphibian Neuropeptides The identification and characterisation of neuropeptides in amphibians has provided invaluable understanding of not only amphibian ecology and physiology but also of mammalian physiology. In the 1960’s Erspamer demonstrated that a variety of the peptides isolated from amphibian skin secretions were homologous to mammalian neurotransmitters and hormones (reviewed in [10]). Erspamer postulated that every amphibian neuropeptide would have a mammalian counterpart and as a result several were subsequently identified. For example, the discovery of amphibian bombesins lead to their identification in the GI tract and brain of mammals [394]. Neuropeptides form an integral part of an animal’s defence and can assist in regulation of dermal physiology. Neuropeptides can be defined as peptidergic neurotransmitters that are produced by neurons, and can influence the immune response [395], display activities in the CNS and have various other endocrine functions [10]. Generally, neuropeptides exert their biological effects through interactions with G protein-coupled receptors distributed throughout the CNS and periphery and can affect varied activities depending on tissue type. As a result, these peptides have biological significance with possible application to medical sciences. Neuropeptides isolated from amphibians will be discussed in this chapter, with emphasis on the investigation into the biological activity of peptides isolated from several Litoria and Crinia species. Many neurotransmitters and hormones active in the CNS are ubiquitous among all vertebrates, however, active neuropeptides from amphibian skin have limited distributions and are unique to a restricted number of species.
  • Neurotensin/Neuromedin N Precursor (Peptide Hormones/Enteric Mucosa/Polyprotein Precursor) PAUL R

    Neurotensin/Neuromedin N Precursor (Peptide Hormones/Enteric Mucosa/Polyprotein Precursor) PAUL R

    Proc. Nati. Acad. Sci. USA Vol. 84, pp. 3516-3520, May 1987 Neurobiology Cloning and sequence analysis of cDNA for the canine neurotensin/neuromedin N precursor (peptide hormones/enteric mucosa/polyprotein precursor) PAUL R. DOBNER*t, DIANE L. BARBERt, LYDIA VILLA-KOMAROFF§, AND COLLEEN MCKIERNAN* Departments of *Molecular Genetics and Microbiology, and *Physiology, University of Massachusetts Medical Center, 55 Lake Avenue North, Worcester, MA 01605; and §Department of Neuroscience, The Children's Hospital, 300 Longwood Avenue, Boston, MA 02115 Communicated by Sanford L. Palay, February 5, 1987 ABSTRACT Cloned cDNAs encoding neurotensin were related peptides possess common carboxyl-terminal se- isolated from a cDNA library derived from primary cultures of quences but differ at the amino terminus. canine enteric mucosa cells. Nucleotide sequence analysis has A method for obtaining primary cultures enriched in revealed the primary structure of a 170-amino acid precursor neurotensin-containing cells from the canine enteric mucosa protein that encodes both neurotensin and the neurotensin-like has been described (13). We have used these enriched cells peptide neuromedin N. The peptide-coding domains are locat- to isolate cDNA clones encoding neurotensin. Nucleotide ed in tandem near the carboxyl terminus of the precursor and sequence analysis of the cloned cDNA has revealed the are bounded and separated by the paired, basic amino acid primary structure of a precursor protein that encodes both residues Lys-Arg. An additional coding domain, resembling neurotensin and neuromedin N. neuromedin N, occurs immediately after an Arg-Arg basic amino acid pair located in the central region of the precursor. MATERIALS AND METHODS Additional amino acid homologies suggest that tandem dupli- cations have contributed to the structure of the gene.
  • Neurotensin and Its Receptors Q Philippe Sarret, Florine Cavelier

    Neurotensin and Its Receptors Q Philippe Sarret, Florine Cavelier

    Neurotensin and Its Receptors q Philippe Sarret, Florine Cavelier To cite this version: Philippe Sarret, Florine Cavelier. Neurotensin and Its Receptors q. Neuroscience and Biobehavioral Psychology, 2018. hal-03150277 HAL Id: hal-03150277 https://hal.archives-ouvertes.fr/hal-03150277 Submitted on 10 Mar 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Neurotensin and receptors Philippe Sarret* and Florine Cavelier$ *Département de Pharmacologie & Physiologie, Institut de Pharmacologie de Sherbrooke, Faculté de Médecine et des Sciences de la Santé, Université de Sherbrooke, Sherbrooke, Québec, Canada, J1H 5N4 $Institut des Biomolécules Max Mousseron, UMR-5247, CNRS, Université Montpellier, 34095 Montpellier Cedex 5, France Philippe Sarret, PhD Professeur Titulaire, Département de Pharmacologie & Physiologie Faculté de Médecine et des Sciences de la Santé, Université de Sherbrooke, 3001, 12Ème Avenue Nord, Sherbrooke, Québec, Canada, J1H 5N4 Tel: (819) 821 8000 ext : 72554 Email: [email protected] Florine Cavelier, PhD Directeur de
  • Neuropeptide Y Using ALZET Osmotic Pumps

    Neuropeptide Y Using ALZET Osmotic Pumps

    ALZET® Bibliography References on the Administration of Neuropeptide Y Using ALZET Osmotic Pumps Q4685: R. Zhang, et al. Long-Term Administration of Neuropeptide Y in the Subcutaneous Infusion Results in Cardiac Dysfunction and Hypertrophy in Rats. CELLULAR PHYSIOLOGY AND BIOCHEMISTRY 2015;37(94-104 ALZET Comments: Neuropeptide Y; PBS; SC; Rat; 2004; 30 days; Controls received mp w/ vehicle; animal info (male, Wistar, 250-300g); functionality of mp verified by plasma levels; cardiovascular; peptides; pumps primed in 37C saline for 40 hours;. Q4622: C. Trivedi, et al. Tachykinin-1 in the Central Nervous System Regulates Adiposity in Rodents. ENDOCRINOLOGY 2015;156(1714-1723 ALZET Comments: Ghrelin; neuropeptide K; Saline; CSF/CNS (fourth ventricle); CSF/CNS; Rat; mice; 1002;1007D; 7 days; Controls received mp w/ vehicle; animal info (rat male, Wistar, 260-290g; mice male, C57Bl6, 12-16 weeks old); ALZET brain infusion kit used; dose-response (pg 1718); post op. care (analgesics); behavioral testing (locomotor activity); neuropeptide K aka NPK;. Q1862: F. Xie, et al. Long-term Neuropeptide Y Administration in the Periphery Induces Abnormal Baroreflex Sensitivity and Obesity in Rats. CELLULAR PHYSIOLOGY AND BIOCHEMISTRY 2012;29(1-2):111-120 ALZET Comments: Neuropeptide Y; PBS; SC; Rat; 2004; 4 months; Controls received mp w/ vehicle; animal info (Wistar, male, 230-270 g, 3-4 mo old); long-term study; pumps replaced monthly. Q1861: F. Xie, et al. Neuropeptide Y Reverses Chronic Stress-induced Baroreflex Hypersensitivity in Rats. CELLULAR PHYSIOLOGY AND BIOCHEMISTRY 2012;29(3-4):463-474 ALZET Comments: Neuropeptide Y; SC; Rat; 2004; 3 months; Controls received mp w/ PBS; animal info (Wistar, male, adult, 230-250 g); long-term study; pumps replaced monthly.
  • Mutually Dependent Elements in the Neurotensin/Neuromedin N Gene Promoter Integrate Multiple Environmental Stimuli in PC12 Cells: a Thesis

    Mutually Dependent Elements in the Neurotensin/Neuromedin N Gene Promoter Integrate Multiple Environmental Stimuli in PC12 Cells: a Thesis

    University of Massachusetts Medical School eScholarship@UMMS GSBS Dissertations and Theses Graduate School of Biomedical Sciences 1990-06-01 Mutually Dependent Elements in the Neurotensin/Neuromedin N Gene Promoter Integrate Multiple Environmental Stimuli in PC12 Cells: a Thesis Edward H. Kislauskis University of Massachusetts Medical School Let us know how access to this document benefits ou.y Follow this and additional works at: https://escholarship.umassmed.edu/gsbs_diss Part of the Amino Acids, Peptides, and Proteins Commons, Animal Experimentation and Research Commons, Cells Commons, Genetic Phenomena Commons, Nucleic Acids, Nucleotides, and Nucleosides Commons, and the Tissues Commons Repository Citation Kislauskis EH. (1990). Mutually Dependent Elements in the Neurotensin/Neuromedin N Gene Promoter Integrate Multiple Environmental Stimuli in PC12 Cells: a Thesis. GSBS Dissertations and Theses. https://doi.org/10.13028/2r34-xj40. Retrieved from https://escholarship.umassmed.edu/gsbs_diss/81 This material is brought to you by eScholarship@UMMS. It has been accepted for inclusion in GSBS Dissertations and Theses by an authorized administrator of eScholarship@UMMS. For more information, please contact [email protected]. MUTUAllY DEPENDENT ELEMENTS IN THE NEUROTENSIN/NEUROMEDIN N GENE PROMOTER INTEGRATE STIMULI IN PC12 CELLS MULTIPLE ENVIRONMENTAL A Thesis Presented Edward Kislauskis Submitted to the Faculty of the University of Massachusetts Medical School Graduate School of Biomedical Sciences, Worcester in partial fulfilment of the requirements for the degree of: DOCTOR OF PHILOSOPHY IN MEDICAL SCIENCES June 1990 Molecular Genetics (g 1990 EDWARD KISLAUSKIS All RIGHTS RESERVED (Signature) _______________________________ (Dr. Janet Stavnezer, Ph.D.), Chairperson of Committee (Signature) _______________________________ (Dr. Susan E. Leeman, Ph.D.), member of Committee (Signature) _______________________________ (Dr.
  • The Signaling Signature of the Neurotensin Type 1 Receptor with Endogenous Ligands

    The Signaling Signature of the Neurotensin Type 1 Receptor with Endogenous Ligands

    This is the accepted (postprint) version of the following article: Besserer-Offroy É, et al. (2017). Eur J Pharmacol. doi: 10.1016/j.ejphar.2017.03.046, which has been accepted and published in its final form at http://www.sciencedirect.com/science/article/pii/S0014299917302157 The signaling signature of the neurotensin type 1 receptor with endogenous ligands Élie Besserer-Offroy OffroyORCID ID, Rebecca L. Brouillette, Sandrine Lavenus, Ulrike Froehlich, Andrea Brumwell, Alexandre Murza, Jean-Michel Longpré, Éric MarsaultORCID ID, Michel Grandbois, Philippe Sarret*, and Richard Leduc*ORCID ID Department of Pharmacology-Physiology, Faculty of Medicine and Health Sciences, Institut de Pharmacologie de Sherbrooke, Université de Sherbrooke, Sherbrooke, Québec, Canada J1H 5N4 e-mail addresses of the authors: [email protected] (ÉBO); [email protected] (RLB); [email protected] (SL); [email protected] (UF); [email protected] (AB); [email protected] (AM); Jean- [email protected] (JML); [email protected] (ÉM); [email protected] (MG); *[email protected] (PS); *[email protected] (RL) * Co-corresponding authors: Philippe Sarret, PhD and Richard Leduc, PhD Phone: +1 (819) 821-8000 ext. 75413 Fax: +1 (819) 564-5400 © 2017. This manuscript version is made available under the CC-BY-NC-ND 4.0 license http://creativecommons.org/licenses/by-nc-nd/4.0/ This is the accepted (postprint) version of the following article: Besserer-Offroy É, et al. (2017). Eur J Pharmacol. doi: 10.1016/j.ejphar.2017.03.046, which has been accepted and published in its final form at http://www.sciencedirect.com/science/article/pii/S0014299917302157 Abstract The human neurotensin 1 receptor (hNTS1) is a G protein-coupled receptor involved in many physiological functions, including analgesia, hypothermia, and hypotension.
  • (12) Patent Application Publication (10) Pub. No.: US 2016/0263235 A1 CASTAGNE Et Al

    (12) Patent Application Publication (10) Pub. No.: US 2016/0263235 A1 CASTAGNE Et Al

    US 2016026.3235A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2016/0263235 A1 CASTAGNE et al. (43) Pub. Date: Sep. 15, 2016 (54) PEPTIDE THERAPEUTIC CONUGATES AND (60) Provisional application No. 61/200,947, filed on Dec. USES THEREOF 5, 2008. (71) Applicant: ANGIOCHEM INC., MONTREAL (CA) Publication Classification (72) Inventors: JEAN-PAUL CASTAIGNE, (51) Int. Cl. MONT-ROYAL (CA); MICHEL A647/48 (2006.01) DEMEULE, BEACONSFIELD (CA); A638/22 (2006.01) CHRISTIAN CHE, LONGUEUIL C07K I4/575 (2006.01) (CA); CARINE THIOT, PREAUX (52) U.S. Cl. (FR): CATHERINE GAGNON, CPC ..... A61K47/48246 (2013.01); C07K 14/57563 MONTREAL-NORD (CA); BETTY (2013.01); A61 K38/2278 (2013.01); C07K LAWRENCE, BOLTON (CA) 14/5759 (2013.01); A61 K38/2264 (2013.01) (21) Appl. No.: 14/696, 193 (57) ABSTRACT (22) Filed: Apr. 24, 2015 The present invention features a compound having the for mula A-X-B, where A is peptide vector capable of enhancing Related U.S. Application Data transport of the compound across the blood-brain barrier or (63) Continuation of application No. 13/133,002, filed on into particular cell types, X is a linker, and B is a peptide Aug. 9, 2011, now abandoned, filed as application No. therapeutic. The compounds of the invention can be used to PCT/CA2009/001781 on Dec. 7, 2009. treat any disease for which the peptide therapeutic is useful. Patent Application Publication Sep. 15, 2016 Sheet 1 of 49 US 2016/0263235 A1 Peptides Amino acid Sequence : Exendin-4 native 3. HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Exendin-4-Lys(MHA) HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPK-(MHA) (CyS32)-Exendin-4 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPCSGAPPPS .