DOCSLIB.ORG

Supporting Information for Proteomics DOI 10.1002/Pmic.200700142

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supporting Information for Proteomics DOI 10.1002/Pmic.200700142 Supporting Information for Proteomics DOI 10.1002/pmic.200700142 Karl Skld, Marcus Svensson, Mathias Norrman, Benita Sjgren, Per Svenningsson and Per E. Andren´ The significance of biochemical and molecular sample integrity in brain proteomics and peptidomics: Stathmin 2-20 and peptides as sample quality indicators ª 2007 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim www.proteomics-journal.com SUPPORTING INFORMATION Supporting Information Table 1. Degraded protein identities and peptide sequences in the striatum after 1, 3, and 10 min post-mortem. UniProtKBa. Protein name Sequenceb Scorec P60710/P63260 Actin, cytoplasmic 1,2 A.LVVDNGSGMCK.A 56 E.MATAASSSSLEKS.Y 55 W.IGGSILASLSTFQQ.M 64 W.ISKQEYDESGPSIVHRK.C 93 M.WISKQEYDESGPSIVHRK.C 56 Q8K021 Secretory carrier-associated F.ATGVMSNKTVQTAAANAASTAATSAAQNAFKGNQM.- 124 membrane protein 1 Q9D164 FXYD domain-containing ion L.ITTNAAEPQK.A 58 transport regulator 6 precursor L.ITTNAAEPQKA.E 57 L.ITTNAAEPQKAE.N 89 L.ITTNAAEPQKAEN.- 54 P99029 Peroxiredoxin 5, mitochondrial M.APIKVGDAIPSVEVF.E 57 precursor P01942 Hemoglobin alpha subunit F.LASVSTVLTSKYR.- 106 M.FASFPTTKTYFPHF.D 72 L.ASHHPADFTPAVHASLDK.F 76 T.LASHHPADFTPAVHASLDK.F 59 L.LVTLASHHPADFTPAVHAS.L 56 L.LVTLASHHPADFTPAVHASLDK.F 71 L.LVTLASHHPADFTPAVHASLDKFLASVST.V 66 T.LASHHPADFTPAVHASLDKFLAS.V 55 L.VTLASHHPADFTPAVHASLDKFLAS.V 68 -.VLSGEDKSNIKAAWGKIGGHGAEYGAEALER.M 97 -.VLSGEDKSNIKAAWGKIGGHGAEYGAEALERM.F 58 P02088/P02089 Hemoglobin beta-1,2 subunit L.LVVYPWTQRY.F 53 L.LVVYPWTQRYF.D 52 Q00623 Apolipoprotein A-I precursor Y.VDAVKDSGRDYVSQFESSSLGQQLN.L 100 P10637 Microtubule-associated protein D.MVDSPQLATLADEVSASLAKQ.G 148 tau M.VDSPQLATLADEVSASLAKQ.G 111 P20357 Microtubule-associated protein L.LESPQLATLAEDVTAALAKQ.G 99 2 L.LESPQLATLAEDVTAALAKQG.L 98 P68369/Q922F4 Tubulin alpha-1,6 chain F.HSFGGGTGSGFTS.L 63 F.FSETGAGKHVPRA.V 62 F.LVFHSFGGGTGSGFTS.L 68 L.THSLGGGTGSGMGTLLI.S 85 F.SVMPSPKVSDTVVEPYNA.T 61 Q9D6F9 Tubulin beta-4 chain R.SGPFGQIFRPDNF.V 53 Q62361 Thyroliberin precursor A.LLEAAQEEGAVTPDLPGLEKVQVRPE.R 89 Q9Z0P4 Paralemmin F.MGYQNVEDEAETKKVLGLQDTIKA.E 81 F.MGYQNVEDEAETKKVLGLQDT.I 58 P05201 Aspartate aminotransferase, -.APPSVFAQVPQAPPVLVFK.L 85 cytoplasmic -.APPSVFAQVPQAPPVLVFKL.T 81 Q60771 Claudin-11 F.YYSSGSSSPTHAKSAHV.- 63 Q68ED7 Mucoepidermoid carcinoma L.STEARRQQAQQVSPTLSPLSPITQAV.A 55 translocated protein 1 homolog P80313 T-complex protein 1, eta subunit F.VWEPAMVRINALTAASEAA.C 69 Q99KB8 Hydroxyacylglutathione -.MKVELLPAL.T 53 hydrolase P70699 Lysosomal alpha-glucosidase T.PVLEPGKTEVTGYFPKG.T 60 precursor P17751 Triosephosphate isomerase L.NAANVPAGTEVVCAPPTAYID.F 75 L.NAANVPAGTEVVCAPPTAYIDFARQK.L 66 P32037 Solute carrier family 2, L.NSMQPVKETPGNA.- 56 facilitated glucose transporter member 3 P09411 Phosphoglycerate kinase 1 L.LEGKVLPGVDA.L 58 F.LKDCVGPEVENACANPAAGTVI.L 124 F.LKDCVGPEVENACANPAAGTVIL.L 92 L.FLKDCVGPEVENACANPAAGTVI.L 96 L.FLKDCVGPEVENACANPAAGTVIL.L 70 P16858 Glyceraldehyde-3-phosphate L.ISWYDNEYGYSNR.V 76 dehydrogenase P97450 ATP synthase coupling factor 6, F.KFDDPKFEVIDKPQS.- 52 mitochondrial precursor Q9DB20 ATP synthase O subunit, P.FAKLVRPPVQVYGIEGRYAT.A 63 mitochondrial precursor Q9D3D9 ATP synthase delta chain, F.FDSANVKQVDVPTLTGAFG.I 52 mitochondrial precursor Y.AEAAAAPAPAAGPGQMSFTFASPTQ.V 126 Q61548 Clathrin coat assembly protein F.DSAPEVAAAPKPDAAPS.I 57 AP180 D.AFAAPSPASTASPAKAESSGVIDL.F 91 P17742 Peptidyl-prolyl cis-trans T.ADDEPLGRVSF.E 66 isomerase A F.FDITADDEPLGR.V 71 F.DITADDEPLGRVSF.E 61 F.DITADDEPLGRVS.F 67 M.ANAGPNTNGSQFFICT.A 60 M.ANAGPNTNGSQFFICTA.K 71 Q9R0P9 Ubiquitin carboxyl-terminal L.LLLFPLTAQHENF.R 68 hydrolase isozyme L1 Q9DCT8 Cysteine-rich protein 2 Y.IYDKDPEGTVQP.- 62 O08553 Dihydropyrimidinase-related A.FVTSPPLSPDPTTPDFLNS.L 52 protein 2 Q99LX0 Protein DJ-1 L.AIVEALVGKDMANQVKAPLVLKD.- 56 Q66JT5 Protein C18orf10 homolog S.KVFKSKNKILI.P 60 P56564 Excitatory amino acid L.IAQDNEPEKPVADSETKM.- 51 transporter 1 Q9QZM0 Ubiquilin-2 L.ATEAPGLIPSFAPGVGMGVLGT.A 59 P70296 Phosphatidylethanolamine- Y.AGVTVDELGKVLTPTQV.M 61 binding protein W.AGPLCLQEVDEPPQHAL.R 63 P34884 Macrophage migration Y.DMNAANVGWNGSTFA.- 64 inhibitory factor O70251 Elongation factor 1-beta -.GFGDLKTPAGLQVL.N 66 P35455 Vasopressin-neurophysin 2- Q.LAGTRESVDSAKPR.V 68 copeptin precursor L.VQLAGTRESVDSAKPR.V 64 L.VQLAGTRESVDSAKPRVY.- 62 R.LVQLAGTRESVDSAKPRVY.- 73 P60761 Neurogranin G.RKGPGPGGPGGAGGARGGAGGGPSGD.- 97 P57774 Neuropeptide Y precursor R.SSPETLISDLLMKESTENAPRTRLEDPS.M 56 P60041 Somatostatin precursor R.SANSNPAMAPRE.R 52 P22005 Proenkephalin A precursor Q.LEDEAKELQ.K 54 R.SPQLEDEAKE.L 61 R.SPQLEDEAKEL.Q 51 R.SPQLEDEAKELQ.K 72 K.DADEGDTLANSSDLLK.E 102 Q8BME9 Cerebellin-4 precursor N.SKVAFSAVRSTN.H 69 R.AANSKVAFSAVRSTN.H 78 Q9R171 Cerebellin precursor R.SGSAKVAFSAIRSTN.H 61 R.SGSAKVAFSAIRSTNH.E 58 P01193 Corticotropin-lipotropin F.MTSEKSQTPLVTL.F 52 precursor R.RPVKVYPNVAENE.S 72 E.EEAVWGDGSPEPSPRE.G 67 A.EEEAVWGDGSPEPSPRE.G 60 R.AEEEAVWGDGSPEPSPRE.G 101 R.RAEEEAVWGDGSPEPSPRE.G 75 P06880 Somatotropin precursor A.FPAMPLSSLFSNA.V 72 P41539 Protachykinin 1 precursor R.DADSSVEKQVALLKALYGHGQISH.K 67 P20065 Thymosin beta-4 K.KTETQEKNPLPSKETIEQEKQAG.E 52 L.PSKETIEQEKQAG.E 58 P16014 Secretogranin-1 precursor R.LGALFNPYFDPLQWKN.S 70 Q03517 Secretogranin-2 precursor F.QELGKLTGPSNQ.K 61 R.IPVGSLKNEDTPN.R 61 L.VKYPELLNTNQL.K 57 R.IPVGSLKNEDTPNR.Q 90 E.SVFQELGKLTGPSNQ.K 54 L.ESVFQELGKLTGPSNQ.K 90 L.KAGEKPNGLVEPEQDLE.L 56 L.NQEQAEQGREHLA.K 65 R.ESKDQLSEDASKVITYL.R 70 R.VPSPVSSEDDLQEEEQLEQAIKEHLGPG.S 74 P47867 Secretogranin-3 precursor L.RAITEKETVEKERQ.S 54 R.AITEKETVEKERQS.I 66 R.ELSAERPLNEQIAEAEAD.K 81 aAccession number in the UniProtKB bAmino acid sequence of the identified peptide cMascot score is based on the absolute probability (P) that the observed match between the experimental data and the database sequence is a random 5 event. The score reported is -10 x log10(P). If 1.5 x 10 peptides during a search are within the mass tolerance window of the precursor mass, and the significance threshold is chosen to be 0.05 (5% chance of a false positive), this translates into a threshold score of 51. Supporting Information Table 2. Identified endogenous peptides in hypothalamic brain tissue irradiated in vivo with focused microwaves. UniProtKBa Precursor proteinb Peptide namec Peptide sequenced Precursor Charge mass (m/z)e state (z)f Q9D3P9 Neuromedin N Neurotensin 150pyroglutamic acid LYENKPRRPYIL162 558.3 3 P22005 / Proenk A precursor, Met-enk YGGFM, multivalent 574.3 1 P01193 POMC P22005 Proenk A precursor Met-enk-RSL 188YGGFMRSL195 465.7 2 Q9QXV0 ProSAAS Big LEN 245LENPSPQAPARRLLPP260 586.0 3 P01193 Pro-opiomelanocortin Melanotropin alpha 124SYSMEHFRWGKPV136-amidation 555.6 3 1ac Ser124 acetylation P01193 Pro-opiomelanocortin Melanotropin alpha 124SYSMEHFRWGKPV136-amidation 569.7 3 2 ac Ser124, Ser126 acetylation P56942 Pro-MCH precursor Neuropeptide EI 132EIGDEENSAKFPI144-amidation 724.4 2 P20065 Thymosin beta-4 Thymosin beta-4 acetylation- 709.7 7 isoform short 2SDKPDMAEIEKFDKSKLKKTETQEKNPLPSK ETIEQEKQAGES44 Q6ZWY8 Thymosin beta-10 Thymosin beta-10 acetylation- 705.8 7 2ADKPDMGEIASFDKAKLKKTETQEKNTLPT KETIEQEKRSEIS44 P41539 Protachykinin 1 Substance P 58RPKPQQFFGLM68-amidation 674.4 2 P26339 Chromogranin A Chromogranin A 392AYGFRDPGPQL402 610.9 2 precursor 394-402 P20156* Neurosecretory VGF VGF 491-507 491PPEPVPPPRAAPAPTHV507 577.4 3 protein P01193 Pro-opiomelanocortin Joining peptide 103AEEEAVWGDGSPEPSPRE120-amidation 970.8 2 P22005 Proenkephalin A Proenk A 198-209 198SPQLEDEAKELQ209 693.9 2 precursor P22005 / Proenk A / proenk B Leu-enk YGGFL, multivalent 556.4 1 P06300 Q9QXV0 ProSAAS Little SAAS 42SLSAASAPLVETSTPLRL59 907.0 2 P01193 Pro-opiomelanocortin CLIP 141RPVKVYPNVAENESAEAFPLEF162 836.0 3 P01193 Pro-opiomelanocortin CLIP 141RPVKVYPNVAENESAEAFPLEF162 862.8 3 Ser-154 Phosphate P01193 Pro-opiomelanocortin Lipotropin gamma 165ELEGERPLGLEQVLESDAEKDDGPYRVEH 740.4 6 FRWSNPPKD202 P01193 Pro-opiomelanocortin Beta endorphin acetylation- 760.2 5 205YGGFMTSEKSQTPLVTLFKNAIIKNAH231 P01193 Pro-opiomelanocortin POMC 205-221 acetylation-205YGGFMTSEKSQTPLVTL221 951.0 2 P54227 Stathmin Stathmin 2-20 acetylation-2ASSDIQVKELEKRASGQAF20 702.8 3 a Accession number in the UniProtKB. b Name of the precursor protein from which the peptide originates. c Name of peptide if previously reported, or else precursor protein name and location. d Peptide sequence, modification and location in precursor protein. e Observed peptide precursor m/z. f Peptide precursor charge state * UniProtKB accession number to rat since mouse accession is non-existent. MS/MS spectra Q9D3P9, Neurotensin, mono mass 1672.0 P22005/P01193, Met-enkephalin, mono mass 573.2 P22005, Met-enkephalin-RSL, mono mass 929.5 Q9QXVO, big Len, mono mass 1755.1 P01193, Melanotrophin alpha, acetylated on second S, mono mass 1663.9 P01193, Melanotrophin alpha, acetylated on first and second S, mono mass 1705.8 P56942, Neuropeptide EI, mono mass 1446.8 P20065, Thymosin beta-4, mono mass 4960.8 Q6ZWY8, Thymosin beta-10, mono mass 4933.7 P41539, Substance P, mono mass 1346.8 P26339, Chromogranin A 392-402, mono mass 1346.8 P20156, Neurosecretory VGF protein 491-507, mono mass 1729.2 P01193, Joining peptide, mono mass 1939.8 P22005, Proenkephalin A precursor 198-209, mono mass 1385.7 P22005/P06300, Leu-enkephalin, mono mass 555.3 Q9QXVO, littleSAAS, mono mass 1812.0 P01193, CLIP, mono mass 2505.3 P01193, CLIP phosphorylation on S, mono mass 2585.3 P01193, Lipotropin gamma, mono mass 4436.2 P01193, Beta endorphin, mono mass 3036.7 P01193, Beta endorphin 1-17, mono mass 1900.0 P54227, Stathmin 2-20, N-terminalacetylation, mono mass 2105.1 .
Load more

Recommended publications
  • Joy Wellness Partners 838 W G Street Suite 201 San Diego, California 92101
    United States of America FEDERAL TRADE COMMISSION Southwest Region 1999 Bryan St., Ste. 2150 Dallas, Texas 75201 June 3, 2020 WARNING LETTER VIA EMAIL TO [email protected] Joy Wellness Partners 838 W G Street Suite 201 San Diego, California 92101 Re: Unsubstantiated Claims for Coronavirus Prevention or Treatment To Whom It May Concern, This is to advise you that FTC staff reviewed your website at https://joywellnesspartners.com/ on May 24, 2020. We have determined that you are unlawfully advertising that certain products treat or prevent Coronavirus Disease 2019 (COVID-19). Some examples of Coronavirus treatment or prevention claims on your website include: In marketing materials accessible on your website by selecting “BLOG” from the navigation menu and clicking on “CORONAVIRUS (COVID-19),” you claim: o Under the heading “Hormones, Peptides, & Immunity”: . You state that “Keeping your immune system running optimally with balanced hormones and peptides helps your body prevent and fight illness, including viruses like COVID-19. Book now [https://intakeq.com/booking/8hkwjk]” . You post a video titled “IMMUNITY, BIOTE, & CORONAVIRUS” featuring Carol Joy Bender, NP. In the video at approximately 31:55, Bender states, “More specifically, I wanted to touch on the things that we’re all concerned about the coronavirus times: what can I do to boost my immune system to keep me healthy? BioTE has already been doing this for us… We have a lot of patients that are already taking their iodine with selenium and zinc. The zinc is one of the mainstay treatments that many of you have read about… zinc helps to reduce the RNA replication inside the cells, when the coronavirus gets in.
    [Show full text]
  • Neurotensin Activates Gabaergic Interneurons in the Prefrontal Cortex
    The Journal of Neuroscience, February 16, 2005 • 25(7):1629–1636 • 1629 Behavioral/Systems/Cognitive Neurotensin Activates GABAergic Interneurons in the Prefrontal Cortex Kimberly A. Petrie,1 Dennis Schmidt,1 Michael Bubser,1 Jim Fadel,1 Robert E. Carraway,2 and Ariel Y. Deutch1 1Departments of Pharmacology and Psychiatry, Vanderbilt University Medical Center, Nashville, Tennessee 37212, and 2Department of Physiology, University of Massachusetts Medical Center, Worcester, Massachusetts 01655 Converging data suggest a dysfunction of prefrontal cortical GABAergic interneurons in schizophrenia. Morphological and physiological studies indicate that cortical GABA cells are modulated by a variety of afferents. The peptide transmitter neurotensin may be one such modulator of interneurons. In the rat prefrontal cortex (PFC), neurotensin is exclusively localized to dopamine axons and has been suggested to be decreased in schizophrenia. However, the effects of neurotensin on cortical interneurons are poorly understood. We used in vivo microdialysis in freely moving rats to assess whether neurotensin regulates PFC GABAergic interneurons. Intra-PFC administra- tion of neurotensin concentration-dependently increased extracellular GABA levels; this effect was impulse dependent, being blocked by treatment with tetrodotoxin. The ability of neurotensin to increase GABA levels in the PFC was also blocked by pretreatment with 2-[1-(7-chloro-4-quinolinyl)-5-(2,6-dimethoxyphenyl)pyrazole-3-yl)carbonylamino]tricyclo(3.3.1.1.3.7)decan-2-carboxylic acid (SR48692), a high-affinity neurotensin receptor 1 (NTR1) antagonist. This finding is consistent with our observation that NTR1 was localized to GABAergic interneurons in the PFC, particularly parvalbumin-containing interneurons. Because neurotensin is exclusively localized to dopamine axons in the PFC, we also determined whether neurotensin plays a role in the ability of dopamine agonists to increase extracellular GABA levels.
    [Show full text]
  • Endogenous Peptide Discovery of the Rat Circadian Clock a FOCUSED STUDY of the SUPRACHIASMATIC NUCLEUS by ULTRAHIGH PERFORMANCE TANDEM MASS □ SPECTROMETRY* S
    Research Endogenous Peptide Discovery of the Rat Circadian Clock A FOCUSED STUDY OF THE SUPRACHIASMATIC NUCLEUS BY ULTRAHIGH PERFORMANCE TANDEM MASS □ SPECTROMETRY* S Ji Eun Lee‡§, Norman Atkins, Jr.¶, Nathan G. Hatcherʈ, Leonid Zamdborg‡§, Martha U. Gillette§¶**, Jonathan V. Sweedler‡§¶ʈ, and Neil L. Kelleher‡§‡‡ Understanding how a small brain region, the suprachias- pyroglutamylation, or acetylation. These aspects of peptide matic nucleus (SCN), can synchronize the body’s circa- synthesis impact the properties of neuropeptides, further ex- dian rhythms is an ongoing research area. This important panding their diverse physiological implications. Therefore, time-keeping system requires a complex suite of peptide unveiling new peptides and unreported peptide properties is hormones and transmitters that remain incompletely critical to advancing our understanding of nervous system characterized. Here, capillary liquid chromatography and function. FTMS have been coupled with tailored software for the Historically, the analysis of neuropeptides was performed analysis of endogenous peptides present in the SCN of the rat brain. After ex vivo processing of brain slices, by Edman degradation in which the N-terminal amino acid is peptide extraction, identification, and characterization sequentially removed. However, analysis by this method is from tandem FTMS data with <5-ppm mass accuracy slow and does not allow for sequencing of the peptides con- produced a hyperconfident list of 102 endogenous pep- taining N-terminal PTMs (5). Immunological techniques, such tides, including 33 previously unidentified peptides, and as radioimmunoassay and immunohistochemistry, are used 12 peptides that were post-translationally modified with for measuring relative peptide levels and spatial localization, amidation, phosphorylation, pyroglutamylation, or acety- but these methods only detect peptide sequences with known lation.
    [Show full text]
  • Thymosin Hh10 Inhibits Angiogenesis and Tumor Growth by Interfering with Ras Function
    Research Article Thymosin hh10 Inhibits Angiogenesis and Tumor Growth by Interfering with Ras Function Seung-Hoon Lee,1 Myung Jin Son,1,2 Sun-Hee Oh,1 Seung-Bae Rho,1 Kyungsook Park,1 Yung-Jin Kim,2 Mi-Sun Park,1 and Je-Ho Lee1 1Molecular Therapy Research Center, Samsung Medical Center, School of Medicine, Sung Kyun Kwan University, Seoul, Korea and 2Department of Molecular Biology, Pusan National University, Busan, Korea Abstract are a family of highly conserved small peptides that inhibit barbed end actin polymerization by sequestering actin mono- Thymosin h10 is a monomeric actin sequestering protein mers (8). Among them, thymosin h4 and thymosin h10 are the that regulates actin dynamics. Previously, we and others h have shown that thymosin h acts as an actin-mediated two most abundant -thymosins in the mammalian species and 10 coexist in some tissue types at varying ratios (9). Although both tumor suppressor. In this study, we show that thymosin h10 is not only a cytoskeletal regulator, but that it also acts as a peptides share a high degree of sequence homology, they show potent inhibitor of angiogenesis and tumor growth by its distinct patterns of expression in several tissues (10) and play interaction with Ras. We found that overexpressed thymosin different roles during rodent development (11). Recently, the angiogenic effects of several members of the thymosin family of h10 significantly inhibited vascular endothelial growth factor–induced endothelial cell proliferation, migration, peptides were studied in the chick chorioallantoic membrane h a invasion, and tube formation in vitro. Vessel sprouting was model (12).
    [Show full text]
  • Multiple Beneficial Effects of Melanocortin MC4 Receptor
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Archivio della ricerca - Università degli studi di Napoli Federico II Progress in Neurobiology 148 (2017) 40–56 Contents lists available at ScienceDirect Progress in Neurobiology journal homepage: www.elsevier.com/locate/pneurobio Review article Multiple beneficial effects of melanocortin MC4 receptor agonists in experimental neurodegenerative disorders: Therapeutic perspectives a a a b c Daniela Giuliani , Alessandra Ottani , Laura Neri , Davide Zaffe , Paolo Grieco , d e f a, Jerzy Jochem , Gian Maria Cavallini , Anna Catania , Salvatore Guarini * a Department of Biomedical, Metabolic and Neural Sciences, Section of Pharmacology and Molecular Medicine, University of Modena and Reggio Emilia, Modena, Italy b Department of Biomedical, Metabolic and Neural Sciences, Section of Human Morphology, University of Modena and Reggio Emilia, Modena, Italy c Department of Pharmacy, University of Napoli “Federico II”, Napoli, Italy d Department of Basic Medical Sciences, School of Public Health in Bytom, Medical University of Silesia, Katowice, Poland e Department of Ophthalmology, University of Modena and Reggio Emilia, Modena, Italy f Center for Preclinical Surgical Research, Fondazione IRCCS Ca' Granda À Ospedale Maggiore Policlinico, Milano, Italy A R T I C L E I N F O A B S T R A C T Article history: Received 20 May 2015 Melanocortin peptides induce neuroprotection in acute and chronic experimental neurodegenerative Received in revised form 22 November 2016 conditions. Melanocortins likewise counteract systemic responses to brain injuries. Furthermore, they Accepted 28 November 2016 promote neurogenesis by activating critical signaling pathways. Melanocortin-induced long-lasting Available online 1 December 2016 improvement in synaptic activity and neurological performance, including learning and memory, sensory-motor orientation and coordinated limb use, has been consistently observed in experimental Keywords: models of acute and chronic neurodegeneration.
    [Show full text]
  • The Role of Neuromedin B in the Regulation of Rat Pituitary-Adrenocortical Function
    Histol Histopathol (1 996) 1 1 : 895-897 Histology and Histopathology The role of neuromedin B in the regulation of rat pituitary-adrenocortical function L.K. ~alendowicz~,C. Macchi2, G.G. Nussdorfer2and M. Nowakl 'Department of Histology and Embryology, School of Medicine, Poznan, Poland and 2Department of Anatomy, University of Padua, Padua, ltaly Summary. The effects of a 7-day administration of NMB-receptor antagonist (NMB-A) (Kroog et al., neuromedin B (NMB) andlor (~~r~,D-phe12)-bornbesin, 1995). an NMB-receptor antagonist (NMB-A) on the function of pituitary-adrenocortical axis were investigated in Materials and methods the rat. NMB raised the plasma concentration of aldosterone, without affecting that of ACTH or Experimental procedure corticosterone; the simultaneous administration of NMB-A prevented the effect of NMB. Neither NMB nor Adult female Wistar rats (200k20 g body weight) NMB-A treatments induced significant changes in were kept under a 12:12 h light-dark cycle (illumination adenohypophysis and adrenal weights, nor in the average onset at 8:00 a.m.) at 23 T,and maintained on a volume of zona glomerulosa and zona reticularis cells. standard diet and tap water ad libitum. The rats were NMB-A administration lowered the volume of zona divided into equal groups (n=8), which were fasciculata cells, an effect annulled by the concomitant subcutaneously injected daily with NMB, NMB-A or NMB administration. Our results suggest that NMB NMB plus NMB-A (Bachem, Bubendorf, Switzerland) specifically stimulates aldosterone secretion, and that dissolved in 0.2 m1 0.9% NaC1, for 7 consecutive days. endogenous NMB or NMB-like peptides exert a tonic The dose was 1 nmo1/100 g body weight.
    [Show full text]
  • 2733.Full-Text.Pdf
    The Journal of Neuroscience, April 1995, 15(4): 2733-2747 Complementary Distribution of Receptors for Neurotensin and NPY in Small Neurons in Rat Lumbar DRGs and Regulation of the Receptors and Peptides after Peripheral Axotomy X. Zhang, Z.-Q. Xu, L. Bao, A. Dagerlind, and T. H&felt Department of Neuroscience, Karolinska Institute, 171 77 Stockholm, Sweden Neurotensin (NT) has been reported to have antinocicep- minals is the superficial dorsal horn of the rat spinal cord (Uhl tive effects at the spinal level. In situ hybridization, electro- et al., 1979; Gibson et al., 1981; Hunt et al., 1981; Ninkovic et physiology, immunohistochemistry, and electronmicros- al., 1981; Seybold and Elde, 1982; Seybold and Maley, 1984; copy were used to investigate the distribution of NT Todd et al., 1992; Proudlock et al., 1993). Since NT has not receptors, possible effects of NT on primary sensory neu- been reported to be present in normal dorsal root ganglion rons, and the effect of nerve injury on the expression of NT (DRG) neurons,it has been assumedthat the densenetwork of receptors and NT. NT receptor (Pi) mRNA was observed in NT-IR fibers in the dorsal horn originatesfrom the local neurons. more than 25% of the small dorsal root ganglion (DRG) However, low amounts of NT-like immunoreactivity (LI) may neurons, which lacked neuropeptide Y NPY-R mRNA and be present in a few primary afferent fibers in the dorsal horn essentially other neuropeptide mRNAs. Intracellular re- under normal circumstances(Zhang et al., 1993b). Behavioral, cording using voltage-clamp mode showed that NT evokes neurophysiological,and pharmacologicalstudies have indicated an outward current in NPY-insensitive small neurons, and functional roles for NT in the dorsal horn.
    [Show full text]
  • Information to Users
    INFORMATION TO USERS This manuscript has been reproduced from the microfilm master. UMI films the text directly from the original or copy submitted. Thus, some thesis and dissertation copies are in typewriter face, while others may be from any type of computer printer. The quality of this reproduction is dependent upon the quality of the copy submitted. Broken or indistinct print, colored or poor quality illustrations and photographs, print bleedthrough, substandard margins, and improper alignment can adversely affect reproduction. In the unlikely event that the author did not send UMI a complete manuscript and there are missing pages, these will be noted. Also, if unauthorized copyright material had to be removed, a note will indicate the deletion. Oversize materials (e.g., maps, drawings, charts) are reproduced by sectioning the original, beginning at the upper left-hand comer and continuing from left to right in equal sections with small overlaps. Each original is also photographed in one exposure and is included in reduced form at the back of the book. Photographs included in the original manuscript have been reproduced xerographically in this copy. Higher quality 6" x 9" black and white photographic prints are available for any photographs or illustrations appearing in this copy for an additional charge. Contact UMI directly to order. A Bell & Howell Information Company 300 North Zeeb Road. Ann Arbor. Ml 48106-1346 USA 313/761-4700 800/521-0600 Order Number 9517090 Partial characterization and purification of steroidogenic factors in thymic epithelial cell culture-conditioned medium Uzumcu, Mehmet, Ph.D. The Ohio State University, 1994 UMI 300 N.
    [Show full text]
  • Stabilization Stabilizor Workflow Inactivation of Enzymes
    Denator Novel Tissue Sample Preparation Technology for MS Analysis denator.com WATERS 2nd NORDIC MS SYMPOSIUM Tuesday Nov 8 2011 Båstad Katarina Alenäs Denator 2004 University spin-off 2006 Head office at Biotech Center Gothenburg, Sweden Research lab in Uppsala Science Park, Sweden 2008 Stabilizor T1 – Launch 2009-to date Publications: Svensson et al. “Heat stabilization of the tissue proteome” Journal of Proteome Research, 2009 Robinson et al. “Assessing the use of thermal treatment to preserve the intact proteomes of post-mortem heart and brain tissue” Proteomics, 2009 Scholz et al. “Impact of temperature dependent sampling procedures in proteomics and peptidomics” Molecular and Cellular Proteomics, 2010 Goodwin et al. “Stopping the clock on proteomic degradation by heat-treatment at the point of tissue excision” Proteomics, 2010 Rountree et al “Clinical application for the preservation of phospho-proteins through in-situ tissue stabilization” Proteome Science, 2010 Ahmed et al “Preserving protein profiles in tissue samples: Differing outcomes with and without heat stabilization” Journal of Neuroscience Methods, 2011 Colgrave et al “Neuropeptide profiling of the bovine hypothalamus: Thermal stabilization is an effective tool in inhibiting post-mortem degradation” Colgrave et al, Proteomics, 2011 Protein research workflow Collection Sample prep Analysis Bioinformatics Stabilization Extraction 2D-gels Dissection Clean up MS Storage Enrichment Western blot Transport Trypsin cleavage ELISA Laboratory for Biological and Medical Mass Spectrometry,
    [Show full text]
  • Mass Spectrometry-Based Discovery of Circadian Peptides
    Mass spectrometry-based discovery of circadian peptides Nathan G. Hatcher*†, Norman Atkins, Jr.‡, Suresh P. Annangudi*†, Andrew J. Forbes*, Neil L. Kelleher*§, Martha U. Gillette‡§¶, and Jonathan V. Sweedler*†‡§ ʈ *Department of Chemistry; †Beckman Institute; ‡Neuroscience Program; ¶Department of Cell and Developmental Biology; and §Institute for Genomic Biology, University of Illinois, Urbana, IL 61801 Communicated by William T. Greenough, University of Illinois at Urbana–Champaign, Urbana, IL, May 20, 2008 (received for review January 18, 2008) A significant challenge to understanding dynamic and heteroge- (5–8). Captured releasates then were characterized offline with neous brain systems lies in the chemical complexity of secreted MALDI TOF MS. Following this strategy, releasates could be intercellular messengers that change rapidly with space and time. screened for multiple compounds that include known, unex- Two solid-phase extraction collection strategies are presented that pected, or even unknown compounds. relate time and location of peptide release with mass spectrometric We characterized peptides endogenously secreted from the characterization. Here, complex suites of peptide-based cell-to-cell site of the SCN over the course of 24 h as well as peptides signaling molecules are characterized from the mammalian supra- released specifically following electrophysiological stimulation chiasmatic nucleus (SCN), site of the master circadian clock. Ob- of the retinohypothalamic (RHT) tract, the afferent pathway served SCN releasates are peptide rich and demonstrate the co- mediating SCN phase-setting light cues (9, 10). Surprisingly release of established circadian neuropeptides and peptides with complex SCN neuropeptide release spectra were observed with unknown roles in circadian rhythms. Additionally, the content of the use of a combination of neurophysiology and selective SCN releasate is stimulation specific.
    [Show full text]
  • (12) United States Patent (10) Patent No.: US 8,133,863 B2 Maggio (45) Date of Patent: Mar
    USOO8133863B2 (12) United States Patent (10) Patent No.: US 8,133,863 B2 Maggio (45) Date of Patent: Mar. 13, 2012 (54) STABILIZING ALKYLGLYCOSIDE 3.5. A g E. S. et al COMPOSITIONS AND METHODS THEREOF 5,369,095 A 1 1/1994 KeeOnahoe et al. et al. 5,556,757 A 9, 1996 A1 tal. (75) Inventor: Edward T. Maggio, San Diego, CA 5,556,940 A 9, 1996 WRC (US) 6,524,557 B1 2/2003 Backstrom et al. 6,551.578 B2 * 4/2003 Adjei et al. ..................... 424/45 (73) Assignee: Aegis Therapeutics, LLC, San Diego, 2002fO1105247,425,542 A1B2 9/20088, 2002 CowanMaggio et al. CA (US) 2004/0209814 A1 10, 2004 Nauck et al. 2005/0215475 A1 9/2005 Ong et al. (*) Notice: Subject to any disclaimer, the term of this 2005/0276843 Al 12/2005 Quay et al. patent is extended or adjusted under 35 2006/0046962 A1 3/2006 Meezan et al. .................. 514/12 2006, OO74025 A1 4/2006 Quay et al. U.S.C. 154(b) by 443 days. 2006/0183674 A1 8/2006 Brand et al. 21) Appl. No.: 12/360,758 2007/01 11938 A1 5, 2007 Pert et al. (21) Appl. No.: 9 (Continued) (22) Filed: Jan. 27, 2009 FOREIGN PATENT DOCUMENTS US 2009/0197816A1 Aug. 6, 2009 (Continued) OTHER PUBLICATIONS Related U.S. Application Data Brown et al. Affinity Purification of a Somatostatin Receptor-G- (60) Division of application No. 12/119,378, filed on May protein Complex... The Journal of Biological Chemistry. Mar. 25. 12, 2008, which is a continuation-in-part of 1993, Vol.
    [Show full text]
  • Slow” NGF Binding, Efficient NGF Uptake, and Multiple NGF Responses to NGF-Nonresponsive PC12 Cell Mutants
    The Journal of Neuroscience, July 1993, 13(7): 2919-2929 Transfection with frk Restores “Slow” NGF Binding, Efficient NGF Uptake, and Multiple NGF Responses to NGF-nonresponsive PC12 Cell Mutants David M. Loeb and Lloyd A. Greene Department of Pathology and Center for Neurobiology and Behavior, Columbia University, New York, New York 10032 NGF binds to and activates the protein tyrosine kinase line PC 12 (Greene and Tischler, 1976) has been used extensively gp140prototrk. Expression of this receptor is required for at as an in vitro model to study NGF signaling (Levi et al., 1988). least some responses to NGF. Three outstanding issues are Two distinct NGF receptors, designated ~75 and gp140proto1rk addressed in the present work. First, we determined whether (Trk), have been identified, and cDNAs encoding these have expression of gpl40 protot* is required for all neuronal NGF been cloned (Chao et al., 1986; Radeke et al., 1987; Martin- responses. Second, we examined the role of gp140Pmtot* in Zanca et al., 1989). The discovery that NGF binds to and stim- NGF binding and internalization. Third, we addressed the ulates the tyrosine kinase activity of the gp140~~~‘~‘~~(Bothwell, utility of NGF-nonresponsive PC1 2nnr5 cells for study of the 199 1; Kaplan et al., 199 la,b; Klein et al., 1991) has focused NGF mechanism. In contrast to wild-type PC12 cells, attention on its role in NGF signal transduction. Transfection PC1 2nnr5 cells do not express endogenous gpl40~~~‘~‘*. We experiments have demonstrated that gp140~~~‘~“~mediates NGF- therefore asked whether they possess other defects that stimulated fibroblast transformation (Cordon-Card0 et al., 199 1) compromise NGF signaling pathways.
    [Show full text]