DOCSLIB.ORG

2733.Full-Text.Pdf

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
2733.Full-Text.Pdf The Journal of Neuroscience, April 1995, 15(4): 2733-2747 Complementary Distribution of Receptors for Neurotensin and NPY in Small Neurons in Rat Lumbar DRGs and Regulation of the Receptors and Peptides after Peripheral Axotomy X. Zhang, Z.-Q. Xu, L. Bao, A. Dagerlind, and T. H&felt Department of Neuroscience, Karolinska Institute, 171 77 Stockholm, Sweden Neurotensin (NT) has been reported to have antinocicep- minals is the superficial dorsal horn of the rat spinal cord (Uhl tive effects at the spinal level. In situ hybridization, electro- et al., 1979; Gibson et al., 1981; Hunt et al., 1981; Ninkovic et physiology, immunohistochemistry, and electronmicros- al., 1981; Seybold and Elde, 1982; Seybold and Maley, 1984; copy were used to investigate the distribution of NT Todd et al., 1992; Proudlock et al., 1993). Since NT has not receptors, possible effects of NT on primary sensory neu- been reported to be present in normal dorsal root ganglion rons, and the effect of nerve injury on the expression of NT (DRG) neurons,it has been assumedthat the densenetwork of receptors and NT. NT receptor (Pi) mRNA was observed in NT-IR fibers in the dorsal horn originatesfrom the local neurons. more than 25% of the small dorsal root ganglion (DRG) However, low amounts of NT-like immunoreactivity (LI) may neurons, which lacked neuropeptide Y NPY-R mRNA and be present in a few primary afferent fibers in the dorsal horn essentially other neuropeptide mRNAs. Intracellular re- under normal circumstances(Zhang et al., 1993b). Behavioral, cording using voltage-clamp mode showed that NT evokes neurophysiological,and pharmacologicalstudies have indicated an outward current in NPY-insensitive small neurons, and functional roles for NT in the dorsal horn. Thus, NT has been NPY an outward current in NT-insensitive small neurons. shown to have antinociceptive effects (Clineschmidt and Mc- Both peptides lacked effect on several small DRG neurons. Guffin, 1979; Yaksh et al., 1982; Spampinatoet al., 1988). In- In the superficial dorsal horn NT immunoreactive (IR) ter- trathecal administration of NT results in an increasein the no- minals directly contacted primary afferent terminals with- ciceptive threshold as measuredin the hot plate test and an out synaptic specializations. This new category (> 25%) of increase in the latency in the acetic acid-induced writhing re- the small DRG neurons expressing NT-R mRNA was com- sponse(Yaksh et al., 1982; Spampinatoet al., 1988). Morever, plementary to the around 60% of small neurons expressing after peripheral axotomy, a marked decreasein NT-L1 has been NPY-R mRNA (and also substance P and calcitonin gene- describedin the dorsal horn of the monkey spinal cord (Zhang related peptide mRNAs) and to the rest exhibiting somato- et al., 1993a), suggestingthat NT may be involved in sensory statin mRNA expression. The electrophysiological results mechanismsthat may causechronic pain. In order to better un- support this classification, showing that NT and NPY have derstand the role of NT at the spinal level and its possible in- inhibitory effects on separate subpopulations of small DRG volvement in syndromesaccompanying peripheral nerve injury, neurons. After sciatic nerve transection, a marked de- we have analyzed the distribution of NT receptor mRNA, the crease was observed in (1) the number of NT-R mRNA-pos- effects of NT on sensoryneurons, and the expressionof NT and itive neurons in DRGs, (2) NT mRNA-positive neurons in its receptors after axotomy. the dorsal horn, and (3) NT-IR cell bodies and fibers in lam- NT binding sites have been observed in the brain (see Uhl, inae I-II. Thus, axotomy causes downregulation of several 1990) and also in the superficial dorsal horn of the spinal cord NT systems at the spinal level, suggesting that the possible (Ninkovic et al., 1981; Young and Kuhar, 1981). No change in effects of NT on primary sensory neurons is attenuated af- density or distribution of NT binding siteswas found after dorsal ter peripheral axotomy. root section (Ninkovic et al., 198l), suggestingthat NT receptors [Key words: coexistence, calcitonin gene-related pep- (NT-Rs) are not present on the terminals of primary afferents. tide, pain, plasticity, somatostatin] It has recently been shown that the NT-R is a member of the guanine nucleotide binding, G-protein-coupled receptor super- Neurotensin (NT), a tridecapeptide (Carraway and Leeman, family (Tanaka et al., 1990), and the cloning of its cDNA se- 1973, 1975), is widely distributed in the nervous system (Ko- quence (Tanakaet al., 1990) has allowed analysisof distribution bayashi et al., 1977; Emsonet al., 1985), where it is an important of NT-R mRNA in the brain using in situ hybridization (Elde et regulatory molecule (see Kitabgi and Nemeroff, 1992). One re- al., 1990). gion with many immunoreactive (IR) cell bodies and nerve ter- In the present study, in situ hybridization was used to analyze the localization of NT-R mRNA in DRG neuronsof normal rats and after peripheral axotomy. Furthermore, it was attempted to Received Apr. 12, 1994; revised Sept. 29, 1994; accepted Oct. 3, 1994. This work was supported by the Swedish MRC (04X-2887), the Bank of define the relation of DRG neuronsexpressing NT-R mRNA to Sweden Tercentenary Foundation, Marianne and Marcus Wallenbergs Stiftelse those recently described to contain neuropeptide tyrosine and Gustav V:s and Drottning Victorias Stiftelse. We thank Dr. l? Frey, Sandoz (NPY)-R mRNA (Jazin et al., 1993; Zhang et al., 1994a) as well Research Institute, Bern, Switzerland, for generous supply of NT antiserum. Correspondence should be addressed to T. HGkfelt at the above address. as certain neuropeptidemRNAs. The effect of NT and NPY on Copyright 0 1995 Society for Neuroscience 0270-6474/95/152733-15$05.00/O DRG neuronswas monitored with intracellular recordingsusing 2734 Zhang et al. Neurotensin Receptors in Sensory Neurons voltage-clamp mode. Finally, NT-L1 and NT mRNA were stud- for 3 min, fixed in Kodak 3000A&B for 6 min, and rinsed for 30 min ied in the superficial dorsal horn of normal rats and after pe- in running water. Developed slides were mounted with glycerol and coverslipped for analysis in a Nikon Microphot-FX microscope ripheral axotomy. equipped with a dark-field condenser or stained with Toluidine blue, The present results show that NT-R mRNA-positive neurons mounted with Entellan (Merck, Darmstadt, Germany) and a coverslip represent a unique subpopulation of small DRG neurons. To- for viewing under bright-field. gether with two other subpopulationscontaining NPY-R and so- For control hybridizations were carried out with an excess of cold probe (loo-fold) together with the labeled probe. matostatin (SOM), respectively, they account for virtually all Qunnti$cation. To determine the percentage of labeled neurons, small DRG neurons. In agreement, small DRG neurons were counts were done on sections stained with Toluidine blue. Four to eight sensitive either to NT or NPY or insensitive to both of these sections (14 pm thick) of L5 DRGs from three control animals and peptides. In the dorsal horn, NT-positive boutons of local neu- three injured animals of each time point were processed. The sections rons had direct, nonsynaptic contacts with primary afferent ter- were examined under bright-field using a 20X objective lens. We di- vided the size of DRG neuron profiles into small, medium-sized, and minals. Finally, axotomy reduced NT-R mRNA levels in DRG large ones. Small neuron profiles were 22-32 pm in diameter with neuronsand NT-L1 and NT mRNA in the superficialdorsal horn, nucleus and dark cytoplasm, medium-sized ones were 32-50 pm in suggestingthat peripheral nerve injury causesa general down- diameter (longest diameter) with a nucleus and dark cytoplasm, and regulation of several NT systemsat the spinal cord level. large ones had a diameter larger than 50 km with a nucleus or a di- ameter of 40-50 p.m without nucleus and with light cytoplasm. Neurons Materials and Methods with three times more grains than mean background grain densities were counted. Mean background grain densities (O-5 grains per 100 ym2) In situ hybridization. Eighteen adult male Sprague-Dawley rats (body were determined by averaging grain counts over defined areas of the weight, 200-250 gm; ALAB, Stockholm, Sweden) were deeply anes- neuropil devoid of positively labeled cell bodies. Five hundred and fifty thetized with sodium pentobarbital (Mebumal; 60 mg/kg, i.p.), and the to 820 neurons from the sections of each DRG of each animal of the left sciatic nerve was transected above trochanter major. In all cases, a two groups were analyzed. The total number of labeled neuron profiles 5 mm portion of the nerve was resected. The rats were allowed to was divided by the total number of toluidine blue-stained neuron pro- survive for 2, 7, 21, and 28 d (three rats in each group) or 14 d (six files. rats). Lesioned animals and three normal control animals were deeply To determine the size of DRG neurons positive for NT-R or NPY-R anesthetized (as above) and perfused via the aorta with 50 ml warm mRNAs, 200 positive neurons for each receptor mRNA and 500 DRG (37°C) saline to clear the blood, followed by rapid dissection and freez- ing of L4 and L5 DRGs and L4-5 spinal cord segments. Before sec- neurons were randomly selected and measured on lightly toluidine blue- tioning, experimental and normal DRGs or spinal cords were fused by stained sections. A Macintosh 11x equipped with a DAGE-MT1 CCD- saline on the same blocks, so that all groups could be processed on the 72 series camera connected with a Nikon Microphot-FX microscope same slide. Sections (14 pm) were cut in-a cryostat (&Iicrom, Heidel- equipped with a 20X objective lens was used to collect the data.
Load more

Recommended publications
  • Neurotensin Activates Gabaergic Interneurons in the Prefrontal Cortex
    The Journal of Neuroscience, February 16, 2005 • 25(7):1629–1636 • 1629 Behavioral/Systems/Cognitive Neurotensin Activates GABAergic Interneurons in the Prefrontal Cortex Kimberly A. Petrie,1 Dennis Schmidt,1 Michael Bubser,1 Jim Fadel,1 Robert E. Carraway,2 and Ariel Y. Deutch1 1Departments of Pharmacology and Psychiatry, Vanderbilt University Medical Center, Nashville, Tennessee 37212, and 2Department of Physiology, University of Massachusetts Medical Center, Worcester, Massachusetts 01655 Converging data suggest a dysfunction of prefrontal cortical GABAergic interneurons in schizophrenia. Morphological and physiological studies indicate that cortical GABA cells are modulated by a variety of afferents. The peptide transmitter neurotensin may be one such modulator of interneurons. In the rat prefrontal cortex (PFC), neurotensin is exclusively localized to dopamine axons and has been suggested to be decreased in schizophrenia. However, the effects of neurotensin on cortical interneurons are poorly understood. We used in vivo microdialysis in freely moving rats to assess whether neurotensin regulates PFC GABAergic interneurons. Intra-PFC administra- tion of neurotensin concentration-dependently increased extracellular GABA levels; this effect was impulse dependent, being blocked by treatment with tetrodotoxin. The ability of neurotensin to increase GABA levels in the PFC was also blocked by pretreatment with 2-[1-(7-chloro-4-quinolinyl)-5-(2,6-dimethoxyphenyl)pyrazole-3-yl)carbonylamino]tricyclo(3.3.1.1.3.7)decan-2-carboxylic acid (SR48692), a high-affinity neurotensin receptor 1 (NTR1) antagonist. This finding is consistent with our observation that NTR1 was localized to GABAergic interneurons in the PFC, particularly parvalbumin-containing interneurons. Because neurotensin is exclusively localized to dopamine axons in the PFC, we also determined whether neurotensin plays a role in the ability of dopamine agonists to increase extracellular GABA levels.
    [Show full text]
  • Supporting Information for Proteomics DOI 10.1002/Pmic.200700142
    Supporting Information for Proteomics DOI 10.1002/pmic.200700142 Karl Skld, Marcus Svensson, Mathias Norrman, Benita Sjgren, Per Svenningsson and Per E. Andren´ The significance of biochemical and molecular sample integrity in brain proteomics and peptidomics: Stathmin 2-20 and peptides as sample quality indicators ª 2007 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim www.proteomics-journal.com SUPPORTING INFORMATION Supporting Information Table 1. Degraded protein identities and peptide sequences in the striatum after 1, 3, and 10 min post-mortem. UniProtKBa. Protein name Sequenceb Scorec P60710/P63260 Actin, cytoplasmic 1,2 A.LVVDNGSGMCK.A 56 E.MATAASSSSLEKS.Y 55 W.IGGSILASLSTFQQ.M 64 W.ISKQEYDESGPSIVHRK.C 93 M.WISKQEYDESGPSIVHRK.C 56 Q8K021 Secretory carrier-associated F.ATGVMSNKTVQTAAANAASTAATSAAQNAFKGNQM.- 124 membrane protein 1 Q9D164 FXYD domain-containing ion L.ITTNAAEPQK.A 58 transport regulator 6 precursor L.ITTNAAEPQKA.E 57 L.ITTNAAEPQKAE.N 89 L.ITTNAAEPQKAEN.- 54 P99029 Peroxiredoxin 5, mitochondrial M.APIKVGDAIPSVEVF.E 57 precursor P01942 Hemoglobin alpha subunit F.LASVSTVLTSKYR.- 106 M.FASFPTTKTYFPHF.D 72 L.ASHHPADFTPAVHASLDK.F 76 T.LASHHPADFTPAVHASLDK.F 59 L.LVTLASHHPADFTPAVHAS.L 56 L.LVTLASHHPADFTPAVHASLDK.F 71 L.LVTLASHHPADFTPAVHASLDKFLASVST.V 66 T.LASHHPADFTPAVHASLDKFLAS.V 55 L.VTLASHHPADFTPAVHASLDKFLAS.V 68 -.VLSGEDKSNIKAAWGKIGGHGAEYGAEALER.M 97 -.VLSGEDKSNIKAAWGKIGGHGAEYGAEALERM.F 58 P02088/P02089 Hemoglobin beta-1,2 subunit L.LVVYPWTQRY.F 53 L.LVVYPWTQRYF.D 52 Q00623 Apolipoprotein A-I precursor Y.VDAVKDSGRDYVSQFESSSLGQQLN.L
    [Show full text]
  • The Role of Neuromedin B in the Regulation of Rat Pituitary-Adrenocortical Function
    Histol Histopathol (1 996) 1 1 : 895-897 Histology and Histopathology The role of neuromedin B in the regulation of rat pituitary-adrenocortical function L.K. ~alendowicz~,C. Macchi2, G.G. Nussdorfer2and M. Nowakl 'Department of Histology and Embryology, School of Medicine, Poznan, Poland and 2Department of Anatomy, University of Padua, Padua, ltaly Summary. The effects of a 7-day administration of NMB-receptor antagonist (NMB-A) (Kroog et al., neuromedin B (NMB) andlor (~~r~,D-phe12)-bornbesin, 1995). an NMB-receptor antagonist (NMB-A) on the function of pituitary-adrenocortical axis were investigated in Materials and methods the rat. NMB raised the plasma concentration of aldosterone, without affecting that of ACTH or Experimental procedure corticosterone; the simultaneous administration of NMB-A prevented the effect of NMB. Neither NMB nor Adult female Wistar rats (200k20 g body weight) NMB-A treatments induced significant changes in were kept under a 12:12 h light-dark cycle (illumination adenohypophysis and adrenal weights, nor in the average onset at 8:00 a.m.) at 23 T,and maintained on a volume of zona glomerulosa and zona reticularis cells. standard diet and tap water ad libitum. The rats were NMB-A administration lowered the volume of zona divided into equal groups (n=8), which were fasciculata cells, an effect annulled by the concomitant subcutaneously injected daily with NMB, NMB-A or NMB administration. Our results suggest that NMB NMB plus NMB-A (Bachem, Bubendorf, Switzerland) specifically stimulates aldosterone secretion, and that dissolved in 0.2 m1 0.9% NaC1, for 7 consecutive days. endogenous NMB or NMB-like peptides exert a tonic The dose was 1 nmo1/100 g body weight.
    [Show full text]
  • Neuropeptide Alterations in the Tree Shrew Hypothalamus During Volatile Anesthesia
    Published in "-RXUQDORI3URWHRPLFVGRLMMSURW" which should be cited to refer to this work. Neuropeptide alterations in the tree shrew hypothalamus during volatile anesthesia Laetitia Fouillen1, Filomena Petruzziello, Julia Veit, Anwesha Bhattacharyya, Robert Kretz, Gregor Rainer, Xiaozhe Zhang⁎ Visual Cognition Laboratory, Department of Medicine, University of Fribourg, Chemin du Musée 5, Fribourg, CH-1700, Switzerland Neuropeptides are critical signaling molecules, involved in the regulation of diverse physiological processes including energy metabolism, pain perception and brain cognitive state. Prolonged general anesthesia has an impact on many of these processes, but the regulation of peptides by general anesthetics is poorly understood. In this study, we present an in-depth characterization of the hypothalamic neuropeptides of the tree shrew during volatile isoflurane/nitrous oxide anesthesia administered accompanying a neurosurgical procedure. Using a predicted-peptide database and hybrid spectral analysis, we first identified 85 peptides from the tree shrew hypothalamus. Differential analysis was then performed between control and experimental group animals. The levels of 12 hypothalamic peptides were up-regulated following prolonged general anesthesia. Our study revealed for the first time that several neuropeptides, including alpha-neoendorphin and somatostatin-14, were altered during general anesthesia. Our study broadens the scope for the involvement of neuropeptides in volatile anesthesia regulation, opening the possibility for investigating the associated regulatory mechanisms. 1. Introduction Neuropeptides act as neuromodulators, tuning the efficacy of fast acting neurotransmitters, and are thought to be mostly General anesthesia is characterized by several components released by volume transmission. A line of evidence has http://doc.rero.ch such as hypnosis and analgesia [1], and is used during medical demonstrated that general anesthesia can evoke the extracel- and experimental surgical procedures to reduce pain.
    [Show full text]
  • Biologically Active Peptides from Australian Amphibians
    Biologically Active Peptides from Australian Amphibians _________________________________ A thesis submitted for the Degree of Doctor of Philosophy by Rebecca Jo Jackway B. Sc. (Biomed.) (Hons.) from the Department of Chemistry, The University of Adelaide August, 2008 Chapter 6 Amphibian Neuropeptides 6.1 Introduction 6.1.1 Amphibian Neuropeptides The identification and characterisation of neuropeptides in amphibians has provided invaluable understanding of not only amphibian ecology and physiology but also of mammalian physiology. In the 1960’s Erspamer demonstrated that a variety of the peptides isolated from amphibian skin secretions were homologous to mammalian neurotransmitters and hormones (reviewed in [10]). Erspamer postulated that every amphibian neuropeptide would have a mammalian counterpart and as a result several were subsequently identified. For example, the discovery of amphibian bombesins lead to their identification in the GI tract and brain of mammals [394]. Neuropeptides form an integral part of an animal’s defence and can assist in regulation of dermal physiology. Neuropeptides can be defined as peptidergic neurotransmitters that are produced by neurons, and can influence the immune response [395], display activities in the CNS and have various other endocrine functions [10]. Generally, neuropeptides exert their biological effects through interactions with G protein-coupled receptors distributed throughout the CNS and periphery and can affect varied activities depending on tissue type. As a result, these peptides have biological significance with possible application to medical sciences. Neuropeptides isolated from amphibians will be discussed in this chapter, with emphasis on the investigation into the biological activity of peptides isolated from several Litoria and Crinia species. Many neurotransmitters and hormones active in the CNS are ubiquitous among all vertebrates, however, active neuropeptides from amphibian skin have limited distributions and are unique to a restricted number of species.
    [Show full text]
  • Neurotensin/Neuromedin N Precursor (Peptide Hormones/Enteric Mucosa/Polyprotein Precursor) PAUL R
    Proc. Nati. Acad. Sci. USA Vol. 84, pp. 3516-3520, May 1987 Neurobiology Cloning and sequence analysis of cDNA for the canine neurotensin/neuromedin N precursor (peptide hormones/enteric mucosa/polyprotein precursor) PAUL R. DOBNER*t, DIANE L. BARBERt, LYDIA VILLA-KOMAROFF§, AND COLLEEN MCKIERNAN* Departments of *Molecular Genetics and Microbiology, and *Physiology, University of Massachusetts Medical Center, 55 Lake Avenue North, Worcester, MA 01605; and §Department of Neuroscience, The Children's Hospital, 300 Longwood Avenue, Boston, MA 02115 Communicated by Sanford L. Palay, February 5, 1987 ABSTRACT Cloned cDNAs encoding neurotensin were related peptides possess common carboxyl-terminal se- isolated from a cDNA library derived from primary cultures of quences but differ at the amino terminus. canine enteric mucosa cells. Nucleotide sequence analysis has A method for obtaining primary cultures enriched in revealed the primary structure of a 170-amino acid precursor neurotensin-containing cells from the canine enteric mucosa protein that encodes both neurotensin and the neurotensin-like has been described (13). We have used these enriched cells peptide neuromedin N. The peptide-coding domains are locat- to isolate cDNA clones encoding neurotensin. Nucleotide ed in tandem near the carboxyl terminus of the precursor and sequence analysis of the cloned cDNA has revealed the are bounded and separated by the paired, basic amino acid primary structure of a precursor protein that encodes both residues Lys-Arg. An additional coding domain, resembling neurotensin and neuromedin N. neuromedin N, occurs immediately after an Arg-Arg basic amino acid pair located in the central region of the precursor. MATERIALS AND METHODS Additional amino acid homologies suggest that tandem dupli- cations have contributed to the structure of the gene.
    [Show full text]
  • Neurotensin and Its Receptors Q Philippe Sarret, Florine Cavelier
    Neurotensin and Its Receptors q Philippe Sarret, Florine Cavelier To cite this version: Philippe Sarret, Florine Cavelier. Neurotensin and Its Receptors q. Neuroscience and Biobehavioral Psychology, 2018. hal-03150277 HAL Id: hal-03150277 https://hal.archives-ouvertes.fr/hal-03150277 Submitted on 10 Mar 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Neurotensin and receptors Philippe Sarret* and Florine Cavelier$ *Département de Pharmacologie & Physiologie, Institut de Pharmacologie de Sherbrooke, Faculté de Médecine et des Sciences de la Santé, Université de Sherbrooke, Sherbrooke, Québec, Canada, J1H 5N4 $Institut des Biomolécules Max Mousseron, UMR-5247, CNRS, Université Montpellier, 34095 Montpellier Cedex 5, France Philippe Sarret, PhD Professeur Titulaire, Département de Pharmacologie & Physiologie Faculté de Médecine et des Sciences de la Santé, Université de Sherbrooke, 3001, 12Ème Avenue Nord, Sherbrooke, Québec, Canada, J1H 5N4 Tel: (819) 821 8000 ext : 72554 Email: [email protected] Florine Cavelier, PhD Directeur de
    [Show full text]
  • Neuropeptide Y Using ALZET Osmotic Pumps
    ALZET® Bibliography References on the Administration of Neuropeptide Y Using ALZET Osmotic Pumps Q4685: R. Zhang, et al. Long-Term Administration of Neuropeptide Y in the Subcutaneous Infusion Results in Cardiac Dysfunction and Hypertrophy in Rats. CELLULAR PHYSIOLOGY AND BIOCHEMISTRY 2015;37(94-104 ALZET Comments: Neuropeptide Y; PBS; SC; Rat; 2004; 30 days; Controls received mp w/ vehicle; animal info (male, Wistar, 250-300g); functionality of mp verified by plasma levels; cardiovascular; peptides; pumps primed in 37C saline for 40 hours;. Q4622: C. Trivedi, et al. Tachykinin-1 in the Central Nervous System Regulates Adiposity in Rodents. ENDOCRINOLOGY 2015;156(1714-1723 ALZET Comments: Ghrelin; neuropeptide K; Saline; CSF/CNS (fourth ventricle); CSF/CNS; Rat; mice; 1002;1007D; 7 days; Controls received mp w/ vehicle; animal info (rat male, Wistar, 260-290g; mice male, C57Bl6, 12-16 weeks old); ALZET brain infusion kit used; dose-response (pg 1718); post op. care (analgesics); behavioral testing (locomotor activity); neuropeptide K aka NPK;. Q1862: F. Xie, et al. Long-term Neuropeptide Y Administration in the Periphery Induces Abnormal Baroreflex Sensitivity and Obesity in Rats. CELLULAR PHYSIOLOGY AND BIOCHEMISTRY 2012;29(1-2):111-120 ALZET Comments: Neuropeptide Y; PBS; SC; Rat; 2004; 4 months; Controls received mp w/ vehicle; animal info (Wistar, male, 230-270 g, 3-4 mo old); long-term study; pumps replaced monthly. Q1861: F. Xie, et al. Neuropeptide Y Reverses Chronic Stress-induced Baroreflex Hypersensitivity in Rats. CELLULAR PHYSIOLOGY AND BIOCHEMISTRY 2012;29(3-4):463-474 ALZET Comments: Neuropeptide Y; SC; Rat; 2004; 3 months; Controls received mp w/ PBS; animal info (Wistar, male, adult, 230-250 g); long-term study; pumps replaced monthly.
    [Show full text]
  • Mutually Dependent Elements in the Neurotensin/Neuromedin N Gene Promoter Integrate Multiple Environmental Stimuli in PC12 Cells: a Thesis
    University of Massachusetts Medical School eScholarship@UMMS GSBS Dissertations and Theses Graduate School of Biomedical Sciences 1990-06-01 Mutually Dependent Elements in the Neurotensin/Neuromedin N Gene Promoter Integrate Multiple Environmental Stimuli in PC12 Cells: a Thesis Edward H. Kislauskis University of Massachusetts Medical School Let us know how access to this document benefits ou.y Follow this and additional works at: https://escholarship.umassmed.edu/gsbs_diss Part of the Amino Acids, Peptides, and Proteins Commons, Animal Experimentation and Research Commons, Cells Commons, Genetic Phenomena Commons, Nucleic Acids, Nucleotides, and Nucleosides Commons, and the Tissues Commons Repository Citation Kislauskis EH. (1990). Mutually Dependent Elements in the Neurotensin/Neuromedin N Gene Promoter Integrate Multiple Environmental Stimuli in PC12 Cells: a Thesis. GSBS Dissertations and Theses. https://doi.org/10.13028/2r34-xj40. Retrieved from https://escholarship.umassmed.edu/gsbs_diss/81 This material is brought to you by eScholarship@UMMS. It has been accepted for inclusion in GSBS Dissertations and Theses by an authorized administrator of eScholarship@UMMS. For more information, please contact [email protected]. MUTUAllY DEPENDENT ELEMENTS IN THE NEUROTENSIN/NEUROMEDIN N GENE PROMOTER INTEGRATE STIMULI IN PC12 CELLS MULTIPLE ENVIRONMENTAL A Thesis Presented Edward Kislauskis Submitted to the Faculty of the University of Massachusetts Medical School Graduate School of Biomedical Sciences, Worcester in partial fulfilment of the requirements for the degree of: DOCTOR OF PHILOSOPHY IN MEDICAL SCIENCES June 1990 Molecular Genetics (g 1990 EDWARD KISLAUSKIS All RIGHTS RESERVED (Signature) _______________________________ (Dr. Janet Stavnezer, Ph.D.), Chairperson of Committee (Signature) _______________________________ (Dr. Susan E. Leeman, Ph.D.), member of Committee (Signature) _______________________________ (Dr.
    [Show full text]
  • The Signaling Signature of the Neurotensin Type 1 Receptor with Endogenous Ligands
    This is the accepted (postprint) version of the following article: Besserer-Offroy É, et al. (2017). Eur J Pharmacol. doi: 10.1016/j.ejphar.2017.03.046, which has been accepted and published in its final form at http://www.sciencedirect.com/science/article/pii/S0014299917302157 The signaling signature of the neurotensin type 1 receptor with endogenous ligands Élie Besserer-Offroy OffroyORCID ID, Rebecca L. Brouillette, Sandrine Lavenus, Ulrike Froehlich, Andrea Brumwell, Alexandre Murza, Jean-Michel Longpré, Éric MarsaultORCID ID, Michel Grandbois, Philippe Sarret*, and Richard Leduc*ORCID ID Department of Pharmacology-Physiology, Faculty of Medicine and Health Sciences, Institut de Pharmacologie de Sherbrooke, Université de Sherbrooke, Sherbrooke, Québec, Canada J1H 5N4 e-mail addresses of the authors: [email protected] (ÉBO); [email protected] (RLB); [email protected] (SL); [email protected] (UF); [email protected] (AB); [email protected] (AM); Jean- [email protected] (JML); [email protected] (ÉM); [email protected] (MG); *[email protected] (PS); *[email protected] (RL) * Co-corresponding authors: Philippe Sarret, PhD and Richard Leduc, PhD Phone: +1 (819) 821-8000 ext. 75413 Fax: +1 (819) 564-5400 © 2017. This manuscript version is made available under the CC-BY-NC-ND 4.0 license http://creativecommons.org/licenses/by-nc-nd/4.0/ This is the accepted (postprint) version of the following article: Besserer-Offroy É, et al. (2017). Eur J Pharmacol. doi: 10.1016/j.ejphar.2017.03.046, which has been accepted and published in its final form at http://www.sciencedirect.com/science/article/pii/S0014299917302157 Abstract The human neurotensin 1 receptor (hNTS1) is a G protein-coupled receptor involved in many physiological functions, including analgesia, hypothermia, and hypotension.
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2016/0263235 A1 CASTAGNE Et Al
    US 2016026.3235A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2016/0263235 A1 CASTAGNE et al. (43) Pub. Date: Sep. 15, 2016 (54) PEPTIDE THERAPEUTIC CONUGATES AND (60) Provisional application No. 61/200,947, filed on Dec. USES THEREOF 5, 2008. (71) Applicant: ANGIOCHEM INC., MONTREAL (CA) Publication Classification (72) Inventors: JEAN-PAUL CASTAIGNE, (51) Int. Cl. MONT-ROYAL (CA); MICHEL A647/48 (2006.01) DEMEULE, BEACONSFIELD (CA); A638/22 (2006.01) CHRISTIAN CHE, LONGUEUIL C07K I4/575 (2006.01) (CA); CARINE THIOT, PREAUX (52) U.S. Cl. (FR): CATHERINE GAGNON, CPC ..... A61K47/48246 (2013.01); C07K 14/57563 MONTREAL-NORD (CA); BETTY (2013.01); A61 K38/2278 (2013.01); C07K LAWRENCE, BOLTON (CA) 14/5759 (2013.01); A61 K38/2264 (2013.01) (21) Appl. No.: 14/696, 193 (57) ABSTRACT (22) Filed: Apr. 24, 2015 The present invention features a compound having the for mula A-X-B, where A is peptide vector capable of enhancing Related U.S. Application Data transport of the compound across the blood-brain barrier or (63) Continuation of application No. 13/133,002, filed on into particular cell types, X is a linker, and B is a peptide Aug. 9, 2011, now abandoned, filed as application No. therapeutic. The compounds of the invention can be used to PCT/CA2009/001781 on Dec. 7, 2009. treat any disease for which the peptide therapeutic is useful. Patent Application Publication Sep. 15, 2016 Sheet 1 of 49 US 2016/0263235 A1 Peptides Amino acid Sequence : Exendin-4 native 3. HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Exendin-4-Lys(MHA) HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPK-(MHA) (CyS32)-Exendin-4 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPCSGAPPPS .
    [Show full text]
  • Supplementary Materials: AGTR1 Is Overexpressed in Neuroendocrine
    Supplementary Materials: AGTR1 Is Overexpressed in Neuroendocrine Neoplasms, Regulates Secretion and May Potentially Serve as a Target for Molecular Imaging and Therapy Samantha Exner, Claudia Schuldt, Sachindra Sachindra, Jing Du, Isabelle Heing-Becker, Kai Licha, Bertram Wiedenmann and Carsten Grötzinger Table S1. Screening library compound list.
    [Show full text]