MOUNTAINVIEWVOICE QFOOD FEATURE We ekend QMOVIE TIMES QBEST BETS FOR ENTERTAINMENT

Q FOODFEATURE

W STORY BY Mountain View zero-waste ELENA KADVANY activist offers recipes, lessons W PHOTOS BY VERONICA WEBER and inspiration Anne Marie Bonneau adds sugar to her ginger beer starter in her Mountain View kitchen. She makes most of her foods Most interviews don’t start with intense hybrid of sauerkraut and kombucha and krautchi are all from scratch in an effort to live a a slice of freshly baked sourdough kimchi. products of Bonneau’s efforts to “zero-waste” lifestyle. bread, sips of homemade kom- But Anne Marie Bonneau is not bucha and bites of “krautchi,” an most interviewees. The bread, Continued on next page

June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 21 Weekend

Happy Hour 4pm-9pm Sun-Thurs 2014 Œ+TIZSM¼[*]ZOMZ[̆ WЄ  Œ.ZMVKP.ZQM[̆ WЄ  Œ WЄIVaLQVVMZ • Kids 12 & under - buy 1 get 1 free* *item from kids menu of equal or lessersser value NOW HIRING applications @clarkes.com th year and Restaurant 70 ANNIVERSARY! Open 7 days Clarkes.com Lunch & Dinner 11am-9pm; Fri ’til 10pm Breakfast on Weekends 8am-2pm Mountain View • 61615 W. El Camino Real • (650) 967-0851

We’re Hiring Full-Time News Reporter

The Almanac, an award-winning community newspaper and online news source that covers the towns of Menlo Park, Atherton, Portola Valley and Woodside, is looking for an enterprising full-time news reporter with a passion for local journalism. The ideal candidate will have experience covering local government and community news and the skills to dig up and write engaging news and feature stories for print and online. Our reporters produce monthly cover stories. We’re seeking someone who is motivated, eager to learn, able to quickly turn out finished copy, and who lives in or The refrigerator in a zero-waste kitchen doesn’t contain any plastic wrap, but it does have a lot of near the Almanac coverage area. Social media skills are a homemade concoctions, including lotion, sourdough starter, kombucha and hummus. plus. This is a fully benefited position with paid vacations, health and dental benefits, profit sharing and a 401(k) plan. Continued from previous page lifestyle that’s gained increas- “The Plastic-Free Chef.” They ing traction in recent years as soon cut out all packaged food, To apply, send a cover letter, resume, and three samples produce zero waste in her Moun- people have become more aware shopping almost exclusively at of your journalism work to Editor Richard Hine at editor@ tain View kitchen — and have of the vast amount of food that farmers markets and buying in AlmanacNews.com. fun doing it. The bread is made goes to waste in America. There bulk using handmade cloth bags from starter (just water and are now numerous zero-waste and glass jars. flour, which she bought in bulk) blogs (including Bonneau’s, Both mother and daughter that’s lasted her more than a year. “The Zero-Waste Chef”), books, describe themselves as obsessed The kombucha — poured from YouTube how-to videos, news with food and cooking. On their glass bottles, never plastic — is articles and events like “Feeding kitchen table, next to the loaf made from tea and fermented the 5,000” in Oakland, when of sourdough bread, kombucha farmers market produce like 5,000 people feast on meals and a fresh squash sit books like watermelon, mango, elderberry made entirely from food that Dan Barber’s “The Third Plate: and lavender. The krautchi is would have otherwise gone to Field Notes on the Future of fermented cabbage, also housed waste. Food” and “Bean Bible: A Legu- in a glass jar. Going for zero-waste was not maniac’s Guide To Lentils, Peas, Going zero waste means Bonneau’s first step. It started And Every Edible Bean On The absolutely no plastic, reusing in 2011, when her then-16-year- Planet!” everything, simplifying shop- old daughter, Mary Katherine, After going plastic free, zero ping habits and making almost started learning about the envi- waste was an easy and logical everything from scratch. It’s ronmental impact of plastic next step, Bonneau said. a minimalist, return-to-roots waste and started her own blog, But when Mary Katherine

Do you like to stay active?

Avenidas offers adults 50+ a choice of fitness classes for all levels: • Pilates / Yoga / Aerobics • Tai Chi • “Sit, Fit, Fun” • Walking & Biking Groups • Parkinson’s Exercise • Pole Walking Members enjoy discounts, a parking pass and more, so join Avenidas today. Mention this ad for a free gift. Call (650) 289-5400 or email [email protected] for details.

Anne Marie Bonneau buys legumes and grains in bulk and stores them in glass jars.

22 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 Weekend

were in her fridge along with eggs and baking soda, fried up in coconut oil. Bonneau also teaches local workshops and free webi- nars. She hopes to give oth- ers the tools to at least start somewhere, even if they don’t aspire to be as “hardcore” as she is about waste (she now makes her own vanilla extract, vinegar, shampoo and even deodorant), “I just think we’ve forgot- ten how — we can barely feed ourselves,” Bonneau said. She recently wrote a blog post on Going zero waste “five things I do that were once considered normal,” which means absolutely includes “(eating) food that taste good.” no plastic, reusing “People have asked if I would sell them my kombucha, but I’d everything, rather just teach them how to do it. I think people don’t want simplifying to just passively consume stuff,” shopping habits she said. “I think they want to actively make things.” and making Her advice to anyone inter- ested in going zero waste is to Look for Advertised Sale Items Everyweek at PET CLUB is Excited to Offer: Blue Buffalo, California Natural, almost everything start small. Get rid of all plastic www.petclubstores.com Chicken Soup, Earth Born, Evo, Innova, Diamond Naturals, bags; use reusable ones. Don’t Pinnacle, Taste of the Wild, & Royal Canin Pet Foods COUPON COUPON from scratch. buy plastic water bottles or GREEN FOREST containers — glass is always bet- FREE FACIAL ter. Shop at your local farmers 1 LB SPORT ¢ PET CLUB MIX PREMIUM TISSUE 79 market. Meat is admittedly dif- FOOD AND SUPPLIES 175 Count. White DOG BISCUITS “Environmentally Friendly” went off to college, it became dif- ficult, Bonneau said, but when At Blossom Hill & Snell 1010 N. Rengstorff EVERYDAY LOW PRICES with any purchase of pet, 5625 Snell Ave. San Jose CA. 95123 Super Discount Prices* Hot Specials & Coupons With any Purchase of Pet, Mountain View, CA. (Next to Costco) *Short term promotions from vendors fish food or supply. Fish Food or Supply. ficult to maintain her blog (and she does buy it, she brings her (No Membership Fees) 408-363-6068 650-988-1316 Limit 1 Lb PLU 332 MV Limit 1 Pkg. PLU 328 MV Limit 1 Coupon per family a plastic-free lifestyle). Bonneau own containers to Whole Foods M-F 9-8, SAT 9-7, SUN 10-7 M-F 9-8, Sat 9-7, Sun 10-7 Limit: 1 Coupon per Family So Much for So Little Effective 6/10/15 - 6/16/15 Effective 6/10/15 - 6/16/15 asked if she could take over the Market. Effective 6/10/15 - 6/16/15 blog; Mary Katherine said, “no Not only will you be doing the BLUE BUFFALO NATURAL BALANCE WELLNESS PURINA way,” and so Bonneau started her environment some good, your DRY DOG FOOD ULTRA-PREMIUM DRY DOG FOOD KIT N’ KABOODLE own, also with an emphasis on body will benefit as well. Bon- •Chicken & Rice (Reg & Lrg Breed) DRY DOG FOOD 30 Lb Bag •Fish & Sweet Potato (Reg & Lrg Breed) •Chicken DRY CAT FOOD •Puppy (Reg & Lrg Breed) •Potato & Duck, 26 Lb SUPER $ 99 16 Lb Bag cooking. neau said she eats much better •Senior (Reg •Reduced Calorie, 28 Lb •Healthy Weight 26 Lb . . . . 48 “The Zero-Waste Chef” offers than she did before — more veg- & Lrg Breed) AS MARKED •Regular, 30 Lb BUY! •Lamb $ 99 •Lamb & Rice $ •White Fish •Senior ...... 49 •Healthy Weight Limit $ Our Super $ 99 Limit 2 Bags $ 49 tips, from shopping to cooking etables and fruit, no processed 5 OFF •Large Breed Adult 30 Lb . . . 52 Per Family 30 Lb Bag Our Regular Low Prices! 2 Bags Low Prices Limit 2 bags Per Family5OFF 3 FREE Wellness can dog food 12.5 oz with each purchase 9 to throwing dinner parties. food, less meat — and claims to Effective 6/10/15 - 6/16/15 Effective 6/10/15 - 6/16/15 Effective 6/10/15 - 6/16/15 Effective 6/10/15 - 6/16/15 Recipes abound, from “clear- have not had a cold since 2011. out-the-fridge frittata” to fer- “I had no idea when I start- FRISKIES BUFFET FUSSIE CAT TIDY CATS SCOOP HI-COUNTRY mented hot peppers to flourless ed out this way that it would CANNED CAT FOOD PREMIUM SCOOPABLE WILD BIRD SEED chocolate coconut cake. The improve my life so much, but it 5.5 Oz CANNED CAT FOOD CAT LITTER 20 Lb Bag All Varieties Black label 2.8 Oz 20 Lb Jug (Kaytee, 20 Lbs - $8.99) night before our interview, really has,” she said. “I don’t get (Gold Label 2.8 Oz. 20/$14.00) •Regular (Audubon Friends, 20 Lbs - $5.99) Limit 2 Cases •Multiple Cat Bonneau made shredded veg- sick; we eat really well; it’s fun.” Per Family Limit 2 Cases $ 89 $ 00 Formula $ 99 Limit 2 Bags $ 99 etable fritters from leftover Information about Bonneau’s Per Family 4/ Limit 2 Jugs Per Family 1 20/ 13 Per Family 5 5 sourdough starter (which she upcoming workshops and free Effective 6/10/15 - 6/16/15 Effective 6/10/15 - 6/16/15 Effective 6/10/15 - 6/16/15 Effective 6/10/15 - 6/16/15 also uses to make pancakes and webinars are online at NUTRO MAX V FANCY FEAST EVERCLEAN waffles) and whatever veggies zerowastechef.com/register. DRY CAT FOOD PREMIUM CAT LITTER MAX CAT DRY CAT FOOD (Purina One All Varieties 3 lb. $5.99) $ 49 •ES Scented •ES Unscented •Low Track $ 99 •Adult •Indoor Chicken •Salmon $ 99 3 lb Bag Limit 2 Bags 5 25 Lb. Box Limit 2 Boxes 10 16 Lb Bag Limit 2 Bags Per Family 17 MERRICK’S PESTELL KAL KAN CESAR GOURMET CANNED DOG FOOD CLUMPING CAT LITTER SELECT DINNERS DOG FOOD 40 Lb. Bag $ 49 All Varieties ¢ 13.2 Oz All Varieties Limit 2 Cases On Sale Limit 2 Bags 8 3.5 Oz Limit 2 Cases 69 NUTRO WHISKAS NUTRO CANNED CAT FOOD SALE DRY CAT FOOD CANNED DOG FOOD SALE Limit • Selected Varietes ¢ Natural ¢ With Savory Nuggets $ 99 Limit • Selected Varieites ¢ Natural $ 35 2 Cases 3 oz Max 55 Choice 75 15 Lb Bag Limit 2 Bags Per Family 9 1 Case12.5 oz Max 89 Choice 1 Limit ZIGNATURE DOG BISCUITS FRESH STEP 2 Bags MILK-BONE CAT LITTER LIMITED INGREDIENT DRY DOG FOOD $ Large Flavor Snacks 21 Lb Bag (14 Lb Bag – $4.19) $ 99 •Turkey •Lamb •Duck $ $ 99 $ 99 13.5 lb 3OFF 27 lb 5OFF 10 Lb Box 7 Lb Box Limit 2 Bags 5 •Trout/Salmon •Zssential OUR SUPER LOW PRICES As Marked 9 8 FLUVAL FILTER SALE RELIANCE MODEL...... TANK...... PET CLUB SALE MODEL...... TANK...... PET CLUB SALE $ $ BIRD CAGES 20% OFF 106 . . . 25 GAL...... 84.99 306 . . . 70 GAL. . . . 129.99 $ $ All Varieties Stock On Hand OUR SUPER LOW PRICES 206 . . . 40 GAL...... 99.99 406 . . 100 GAL . . . 174.99 NATURE’S MIRACLE SAVORY PRIME Rawhide $ TETRA BOXED 10 GALLON TANK RAWHIDE Bones 6.99 TRAINING PADS With Economy Kit Retriever Value Pack Super $ 99 Just add Heater Limit 1 100% Beefhide $ 50 Ct $ Value Pack Roll 10.99 Buy 14 For Tropical Fish 39.99 Per Family MAMMOTH All CONAIR PRO 20% KORDON CORAL SEA PET PRODUCTS Varieties20% GROOMING SUPPLIES KENT MARINE •Tire Biters •Paw Tracks 50 GAL SALT MIX WITH AMQUEL •Flossy Chews •Squeaky •Clippers •Trimmers OFF WATER 20% OFF OFF OUR SUPER LOW PRICES $ Freaks •Soft Pet Toys OUR SUPER LOW PRICES •Shampoo All Varieties OUR SUPER LOW PRICES SUPPLEMENTS 11.99

BONUS COUPON BONUS COUPON BONUS COUPON JONNY CAT WHISKAS FANCY FEAST PREMIUM CAT LITTER ALL NATURAL TEMPTATIONS CAT TREATS GOURMET CANNED CAT FOOD 10 Lb Bag •All Varieties - 2.4 Oz 3 Oz - All Varieties Limit 2 Bags With Coupon Limit 2 Pkgs with Coupon except Elegant & Morning Medley Limit One Coupon Per Family $ 59 Limit One Coupon Per Family $ 29 Limit 2 cases with coupon Limit One Coupon Per Family $ 00 Price Valid Only With Coupon Price Valid Only With Coupon Cloth shopping bags sewn by Anne Marie Bonneau help her avoid MV MV Price Valid Only With Coupon MV Effective 6/10/15 - 6/16/15 1 PLU 365 Effective 6/10/15 - 6/16/15 1 PLU 423 20/ Effective 6/10/15 - 6/16/15 11PLU 361 storing produce in plastic bags. June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 23 Weekend

QMOVIEOPENINGS cation. But what gives “Jurassic World” The boys are V.I.P. guests of a real kick is how this sequel their inattentive aunt, Claire script (credited to Rick Jaffa, Dearing (Bryce Dallas Howard), Amanda Silver, Derek Connolly the park’s operations manager. and Trevorrow) has “Jurassic She’s busy touring the ultimate Park” metaphorically fight off V.I.P. — park owner Simon Mas- “sequel improvements” by reas- rani (Irrfan Khan) — and keep- serting what made the original ing in line Velociraptor trainer work. “Let’s be honest; no one’s Owen Grady (Chris Pratt), with impressed with dinosaurs any- whom she once had a date. Grady more,” Claire opines. “Consum- has his own problems fending ers want them bigger, louder and off InGen head of security Vic with more teeth.” She might as Hoskins (Vincent D’Onofrio), well be talking of jaded sequel who wants his company’s genetic thinking. This film’s comic relief wonders to be weaponized as a (an ops tech winningly played military application. The vari- by Jake Johnson of “Safety Not ous social tensions — between Guaranteed”) sports a collectible Claire and her neglected kin; the Jurassic Park T-shirt in very poor flirty, flinty never-weres Claire taste, B.D. Wong’s Dr. Henry Wu and Owen; and the competing plays a part and the film’s climax COURTESY CHUCK ZLOTNICK/UNIVERSAL PICTURES interests of the Jurassic World allows the old to triumph over Ty Simpkins and Nick Robinson play brothers visiting the “Jurassic World” theme park in the blockbuster stakeholders — all come to a the newfangled. franchise’s new sequel. head when (shock of shocks) the Trevorrow also knows a movie mother of all security breaches like this is bigger than any- unleashes InGen’s latest star one, and he handles the huge Shifting out of ‘park’ attraction: a gigantic, incredibly scale (including rampant prod- dangerous hybrid dubbed Indo- uct placement — remarkably, THE DINOS ARE BACK IN TOWN IN ‘JURASSIC WORLD’ minus rex. both major colas get a shout- (Century 16, Century 20) Logic isn’t exactly “Jurassic out) with aplomb. It’s the film’s 000 World”’s strong suit, but Trevor- stock characters that hold it Making sequels to “Jurassic this franchise, and director and ingly, none of the previous three row’s key scenes turn out to be back from greatness: The actors Park” is both a fait accompli and co-screenwriter Colin Trevor- films featured dinosaurs over- up to snuff, including a sequence seem almost irrelevant, and the something of a fool’s errand. The row (“Safety Not Guaranteed”) taking a fully functioning theme of the boys being attacked while characters — Pratt’s always- endlessly popular franchise has has met the challenges with an park populated with tourists, in a safari gyrosphere and the right ex-Navy alpha male and already brought in nearly $2 bil- appealing self-awareness. so “Jurassic World” has a jolt inevitable, old-school showdown Howard’s tightly wound career lion at the box office, but it also “Jurassic World” returns to of novelty that helps to recap- between the two biggest dinos on woman who’s not having it poses a significant challenge to Isla Nublar, the fictional site of ture the wonder of the original the block. As always, the story all — more lab-bred than the directors and screenwriters hop- the original Jurassic Park. The 1993 film. Wide-eyed and gape- functions as a cautionary tale of dinos. So it comes down to the ing to create something fresh old park lies in ruins, having mouthed, young Gray Mitchell chaos and the illusion of control, huge-scale and the thrills, and in while still living up to Steven been replaced by a gleaming (Ty Simpkins) serves as our “mad science” underestimat- these respects, “Jurassic World” Spielberg’s set pieces and telling new theme park — filled with surrogate when he gets his first ing nature and corporate inter- doesn’t disappoint. the same basic story of dinosaurs genetically engineered dinosaurs glimpse of the super-cool Jurassic ests failing to protect humanity, Rated PG-13 for intense run amok as people run scream- — called Jurassic World, com- World. He’s accompanied by his much less scientific ethics. As sequences of science-fiction vio- ing. But in the 14 years since plete with shops, restaurants, too-cool-for-school older brother Masrani puts it, “Jurassic World lence and peril. Two hours, four “Jurassic Park III,” the culture safari rides, a marine show Zach (Nick Robinson), as focused exists to remind us how very minutes. has had just enough time to miss and an IMAX theater. Surpris- on girls as Gray is on STEM edu- small we are, and how new.” — Peter Canavese

nate answer is “yes.” The biopic “Love & Not There,” screenwriter Oren Moverman Mercy” literalizes this truism by casting considers what best represents his subject: two actors as Wilson (Paul Dano and John Wilson’s ascendance as the astonish- CITY OF MOUNTAIN VIEW Cusack) and focusing on two periods in ingly talented pop-symphonic composer of “God Only Knows,” his fall into damaging QMOVIEREVIEWS the man’s life: his most creatively fertile period in the ‘60s, and the period in the drug abuse and bedridden depression, Mountain View late ‘80s when he met his current wife the winter of his discontent with Landy LOVE & MERCY 000 1/2 Melinda (Elizabeth Banks) and broke and the redemptive spring offered by Community Center Renovation Can a person ever really change? At least free of notoriously controlling therapist Melinda and reunited family and friends. In for Brian Wilson — the musical genius Eugene Landy (Paul Giamatti). As with most respects, the film proves accurate in behind the Beach Boys — the unfortu- the unconventional Bob Dylan biopic, “I’m spirit and in fan service, including detailed City Council Study Session Meeting recreations of photo shoots, promo films, Tuesday, June 16, 2015 at 5:30 p.m. concerts and the “Pet Sounds” studio Plaza Conference Room sessions. Dano and first-time director/ longtime producer Bill Pohlad show finesse Second Floor, Mountain View City Hall in capturing Wilson’s brilliance in the stu- 500 Castro Street, Mountain View dio and the head space of a musical artist. Cusack bears less resemblance to Wilson Mountain View and doesn’t have Dano’s mien, but he does The City Council will select an exterior architecture Minimum Wage a solid job of conveying Wilson’s loneliness concept for the renovation and expansion of the and fear (and his brain-fried spaciness) in Community Center. the shadow of Landy. Wilson’s innocent $10.30 essence — optimistic and pure in its spiritual desires for love and art — make • For Further Information—Contact the Public Works per hour his story deeply moving. He’s not the man Department at (650) 903-6311 or (σHFWLYH he used to be, but he’s surely earned his [email protected] happy ending.Rated PG-13 for thematic July 1, 2015 elements, drug content and language. Two hours. — P.C. • Para más información, por favor llame al (650) 903-6145 Download required materials for businesses QMOVIECRITICS ‡ǦȖȢȣȤȢȥȔȠȜțȖȢȡȜȦșȣȢȦșȟșȨȢȡȧ   and get more information at S.T. - Susan Tavernetti, P.C. - Peter Canavese, www.MountainView.gov/MinWage T.H. - Tyler Hanley

24 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 Weekend presented by

QMOVIETIMES BRILLIANT CONCERTS Aloha (PG-13) Century 20: 10:50 a.m., Sat 1:30 & 4:15 p.m., Sun 4:40 p.m. Avengers: Age of Ultron (PG-13) +++ Century 16: 9:30 a.m., Fri & Sun 10:45 a.m., Sat 12:45 p.m. JUNE 19 >>> AUGUST 8 Century 20: 10 a.m., 1:10, 4:20, 7:35 & 10:45 p.m. Bright Eyes (1934) (Not Rated) Stanford Theatre: 4:15 p.m., Sat & Sun 1 p.m. Dil Dhadakne Do (Not Rated) Century 16: 10:25 a.m., 2:25, 6:30 & 10:30 p.m. Entourage (R) Century 16: 9:10 & 11:55 a.m., 2:30, 5:10, 7:50 & 10:30 p.m. Century 20: 11:40 a.m., 2:20, 5, 7:50 & 10:30 p.m. Ex Machina (R) Century 16: 10 p.m., Fri & Sat 7:05 p.m., Sun 7:15 p.m. Century 20: 7:15 & 10:05 p.m. Far From the Madding Crowd (PG-13) Century 16: 10:20 a.m. & 1:10 p.m., Fri & Sat 4 p.m., Sun 4:25 p.m. SJW MEMBER I’ll See You in My Dreams (PG-13) 6/19 Eliane Elias: Listening Party EXCLUSIVE Palo Alto Square: 2, 4:30 & 7:15 p.m., Fri & Sat 9:45 p.m. 6/20 Eliane Elias: Made in Brazil Insidious: Chapter 3 (PG-13) 6/21 ,QJP5EQƂGNF,QJP/GFGUMK Duo Century 16: 9:15 & 11:45 a.m., 2:20, 5:05, 7:55 & 10:35 p.m. 6/26 Bruce Forman and Cow Bop Century 20: 10 a.m., 12:25, 2:55, 3:15, 5:25, 7:55, 9:15 & 10:30 p.m. 6/27 Early Bird Jazz for Kids: Pentatonics Jurassic World (PG-13) Century 16: 10:10 & 11:30 a.m., +++ 6/27 Regina Carter Quartet 1:20, 2:30, 4:20, 5:30, 7:40, 9 & 10:40 p.m. In 3-D at 9, 9:30 & 10:50 a.m., noon, 12:40, 2, 3, 3:50, 5, 6:15, 7, 8:20, 9:35 & 10:10 p.m., Fri & Sat 6/28 India Jazz Generations 11:20 p.m. & 12:01 a.m. Century 20: 10 & 11:30 a.m., 1, 2:30, 4, 5:35, with George Brooks 7:05, 8:35 & 10:05 p.m. In 3-D at 11 a.m., noon, 12:30, 2, 3, 3:30, 5:05, 6, 6:30, 8:05, 9, 9:30 & 11:05 p.m. In X-D 3-D at 10:40 a.m., 1:40, 4:40, 7:45 & 10:45 p.m. In D-BOX at 10 a.m., 1, 4, 7:05 & 10:05 p.m. In 3-D D-BOX at 11 a.m., 2, 5:05, 8:05 & 11:05 p.m. 7/5 Jazz Inside Out The Little Colonel (1935) (PG) 7/10 Akira Tana and Otonowa Stanford Theatre: 9:20 p.m., Sat & Sun 2:40 p.m. 7/11 Early Bird Jazz for Kids: Love & Mercy (PG-13) 1/2 +++ Zookeepers Century 20: 10:20 a.m., 1:20, 4:20, 7:20 & 10:20 p.m. Palo Alto Square: 1, 4 & 7 p.m., Fri & Sat 10 p.m. 7/11 Tommy Igoe Groove Conspiracy TENOR SAX LEGEND Mad Max: Fury Road (R) Century 16: 10:35 a.m., 1:30, 4:25, 7:25 & 7/12 A Billie Holiday Celebration Charles Lloyd 10:25 p.m. Century 20: 10:05 a.m., 1, 3:55, 7 & 10 p.m. 7/17 /KEJCGN1o0GKNN Special Project Pitch Perfect 2 (PG-13) ++1/2 Kenny Washington Sextet Century 16: 10:25 a.m., 1:35, 4:30, 7:30 & 10:20 p.m. 7/18 Pete Escovedo 8/8 8 PM Century 20: 10:55 a.m., 1:45, 4:35, 7:25 & 10:30 p.m. 7/19 Mo’ Blues Guitar Bing Concert Hall Poor Little Rich Girl (1936) (Not Rated) 7/20 Donny McCaslin’s Fast Future Stanford University Stanford Theatre: 5:55 p.m. 7/21 %CKNK1o&QJGTV[5EQVV5QTMKP San Andreas (PG-13) ++ CD Release Party Century 16: 10:40 a.m., 12:10, 1:40, 4:35, 6:20, 7:30 & 10:25 p.m. 7/22 Ruth Davies Blues Night Century 20: 10:15 a.m., 1:05, 3, 4:05, 7:15 & 10:15 p.m., Fri & Sun 8:45 p.m. In 3-D at 11:15 a.m., 12:10, 2, 4:50, 8 & 10:50 p.m., Fri & Sun 5:50 p.m. featuring Barbara Morrison Spy (R) Century 16: 9:05 & 10:45 a.m., 1:45, 3:05, 4:45, 7:45, 9:10 & 7/23 SJW Jazz Mentor Fellows 10:45 p.m. Century 20: 10:15 & 11:15 a.m., 12:15, 1:15, 2:15, 4:15, 7/25 Ms. Lisa Fischer and Grand Baton 5:15, 6:15, 7:15, 8:10, 10:15 & 11 p.m. 7/26 Anat Cohen Quartet The Terminator (1984) (R) 7/27 Steven Lugerner’s Century 16: Sun 2 p.m. Century 20: Sun 2 p.m. SLUGish Ensemble Tomorrowland (PG) ++1/2 7/28 Yosvany Terry Quintet 8/1 John Santos: Unusual Standards Century 16: 10:05 a.m., 1:05, 4:10, 7:35 & 10:45 p.m. 7/29 Victor Lin: 1965 Revisited 8/2 Guitar Night with Julian Lage Century 20: 1:15 a.m., 1:25, 4:30, 7:35 & 10:45 p.m. 7/30 Allison Miller’s Boom Tic Boom and Peter Bernstein UFC 188: Velasquez vs. Werdum (Not Rated) with Anat Cohen 8/3 Jimmy Cobb’s Mob Century 16: Sat 7 p.m. Century 20: Sat 7 p.m. 8/4 Taylor Eigsti and Friends, featuring Wee Willy Winkie (1937) (Not Rated) Stanford Theatre: 7:30 p.m. Julian Lage and Eric Harland 8/5 James Farm When Marnie Was There (PG) +++1/2 BECOME AN SJW MEMBER Guild Theatre: Dubbed at 2:15 & 4:40 p.m., Subtitled at 7:15 & 9:40 p.m. • No ticket fees! Save up to $6 per ticket 8/7 SJW All-Star Jam • FREE Admission to: Eliane Elias 8/8 Charles Lloyd Special Project AQUARIUS: 430 Emerson St., Palo Alto (266-9260) Listening Party 6/19 Currently closed for renovation • Invitation to members-only CENTURY CINEMA 16: 1500 N. Shoreline Blvd., Mountain View (800-326-3264) events CENTURY 20 DOWNTOWN: 825 Middlefield Road, Redwood City (800-326-3264) CINEARTS AT PALO ALTO SQUARE: 3000 El Camino Real, Palo Alto (493-3456) STANFORD THEATRE: 221 University Ave., Palo Alto (324-3700) ORDER TICKETS & BECOME A MEMBER 0Skip it For show times, plot synopses, 00Some redeeming qualities trailers and more movie @ stanfordjazztickets.org 000A good bet info, visit www.mv-voice.com 0000Outstanding and click on movies. or 650-725-2787 • ON SALE NOW!

June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 25 26 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 Unexpected doesn’t wait for appointments

We understand sometimes you need a doctor fast. That’s why we created urgent care so you can get expert, same-day care close to home, whether it’s after hours or on the weekend. It’s another way we plus you.

Locations in Mountain View and throughout the Bay Area.

sutterhealth.org/urgentcare

June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 27 MOUNTAINVIEWVOICE QHIGHLIGHT ‘’TWAS BRILLIG’ A Theatre Near U will present a production of the irreverent teen musical “’Twas Brillig,” a comedy that follows the plucky Mary Pickett as she stumbles upon a mysterious land whose denizens want to crown her as queen. June 12-27, Friday and Saturday, 7:30 p.m.; Sunday, 2 p.m. $23 adult; $18 senior, students (includes a $3 facility use fee). Mountain View Center for the Performing Arts, 500 Castro St., Mountain View. Call 650-815-9938. atheatrenearu.org

ART GALLERIES students can create a wacky, vintage portrait last row. Community School of Music and Arts, dance and fitness workouts for all skill levels. Senior Center, 266 Escuela Ave., Mountain View. using modern tools and a gelatin transfer process Tateuchi Hall, 230 San Antonio Circle, Mountain Danceation studio also offers weekly yoga Call 650-903-6330. www.mountainview.gov/ ‘Transformation, Still Life Paintings’ to a distressed metal surface. The class is limited View. Call 650-918-9656. www.afscv.org/ classes. See website for specific schedule. seniors Gallery 9 offers an exhibit of work by local artist to 20 students, ages 16 and up. Those interested lefestival/ Monday, Wednesday and Friday, June 8-Aug. Facebook workshop The Mountain View Carol Hake called “Transformation, Still Life should call to register. July 11, 10 a.m.-2 p.m. $10 Cellist Irene Sharp The Community School of 31. $20 single class; $150 10-class pass. Los Senior Center will offer a workshop on using Paintings,” in which ordinary household items gain museum member; $20 nonmember. Los Altos Music and Arts will host an evening of music with Altos American Legion, 347 1st St., Los Altos. Facebook to make friends, send messages and exuberance through light, color and shadows. June History Museum, 51 S. San Antonio Road, Los the celebrated cellist and master teacher Irene danceation.com keep up with last minute programming at the 2-27, Friday-Saturday, 11 a.m.-5 p.m.; Sunday, Altos. Call 650-948-9427, ext. 14. losaltoshistory. Sharp. June 18, 7:30-8:30 p.m. Free. Community center. A Facebook account is required to register. noon-4 p.m. Free. Gallery 9, 143 Main St., Los org School of Music and Arts, Tateuchi Hall, 230 San FOOD AND DRINK June 17, 2:30-3:30 p.m. Free. Mountain View Altos. Call 650-941-0458. gallery9losaltos.com Antonio Circle, Mountain View. www.arts4all. Ser Winery tasting Nicole Walsh, owner and Senior Center, 266 Escuela Ave., Mountain View. ‘Various Viewpoints’ During the month CLUBS/MEETINGS org/attend/concerts.htm winemaker of Ser Winery based in Santa Cruz, will Call 650-903-6330. www.mountainview.gov/ of June, Viewpoints Gallery has on display the Peninsula Astronomical Society: International String Trio This eclectic lead a tasting sharing wines made to express their seniors work of Bay Area painters Nancy Calhoun and ‘History and Art of Telescope Making’ performance by the International String Trio will place of origin and in an old world style. June 14, Got Your Dairy? workshop To mark Jane Ferguson in an exhibit called “Various At this month’s meeting of the Peninsula present Appalachian folk, Gypsy jazz, Russian and 2-5 p.m. $16. Savvy Cellar Wine Bar & Wine Shop, National Dairy Month, the Mountain View Senior Viewpoints.” June 2-27, 11 a.m.-5 p.m.; Sunday Astronomical Society, Richard Ozer will give a Israeli tunes, tangos, Irish jigs and more. June 16, 750 W. Evelyn Ave., Mountain View. Call 650- Center will offer a session educating seniors only until 3 p.m. Free. Viewpoints Gallery, 315 talk on the topic of “History and Art of Telescope noon-1:30 p.m. $15. Schultz Cultural Arts Hall, 969-3958. www.savvycellar.com on the health benefits of dairy, tips for making State St., Los Altos. www.viewpointsgallery.com Making: Galileo to Celestron.” Those attending 3921 Fabian Way, Palo Alto. Call 650-223-8616. healthy choices and ways to get enough calcium should park in lot 6. The observatory will be open paloaltojcc.org/music LIVE MUSIC without consuming dairy products. Healthy food CLASSES/WORKSHOPS after the meeting from 9 to 11 p.m. June 12, Vans Warped Tour Vans Warped Tour ‘15 Mirada Guitar Duo The Mirada Guitar Duo, samples will be provided. June 18, 1-2 p.m. Free. Adult school summer classes 7:30-9 p.m. Free; $3 parking. Foothill College, will make its way to Shoreline Amphitheatre, consisting of Tony Song and Jun Lee, will perform Mountain View Senior Center, 266 Escuela Ave., registration Registration for summer classes Room 5015, 12345 El Monte Road, Los Altos Hills. bringing both emerging and veteran musical a relaxed set of jazz guitar music. Jun 13, 8-9:30 Mountain View. Call 650-903-6330. www. at the Mountain View-Los Altos Adult School www.pastro.org/dnn/ acts including Neck Deep, Front Porch Step, p.m. Free. Red Rock Coffee Company, 201 Castro mountainview.gov/seniors began on May 15. The summer session will run Peninsula Democratic Coalition: Kosha Dillz, Palisades and many more. June 20, St., Mountain View. www.redrockcoffee.org Intro to SALA Sylvia Kennedy, a staff attorney from June 15 to July 31. Those interested should ‘Debunking Right-wing Fabrications’ 11 a.m. $39.50 general (plus fees). Shoreline from Senior Adults Legal Assistance, will describe call or visit the website for more info. May 15-June The Peninsula Democratic Coalition will hold a Amphitheatre, One Amphitheatre Parkway, ON STAGE free legal services provided by the organization 19. Prices vary. Mountain View-Los Altos Adult lunch with assessor Larry Stone, who will talk Mountain View. vanswarpedtour.com/dates/san- ‘Angels in America’ Foothill College Theatre to Santa Clara County residents ages 60 or older. School, 333 Moffett Blvd., Mountain View. Call about “Debunking Right-wing Fabrications.” francisco-ca-3 Arts will perform the two-part play “Angels in June 16, 11 a.m.-noon. Free. Mountain View 650-940-1333. www.mvlaae.net Reservations and advanced payment are required. World Harmony Chorus concert This America” by Tony Kushner. Directed by Bruce Senior Center, 266 Escuela Ave., Mountain View. Brew Your Own Kombucha class This Seating is limited. June 14, 11 a.m.-2 p.m. $25 diverse choral group will share some of its McLeod, the production will include a full staging Call 650-903-6330. www.mountainview.gov/ course offered by Anne Marie Bonneau will member; $30 nonmember. Ristorante Don repertoire of music from around the world, of the first part, “Millennium Approaches,” and a seniors cover the benefits of kombucha, the necessary Giovanni’s, 235 Castro St., Mountain View. Call including tunes from Africa, Latin America and dramatic reading of the second part, “Perestroika.” equipment, and successful and safe conditions. 650-941-8190. www.peninsulademocrats.org eastern Europe. June 15, 7:30-8:30 p.m. Free. The material may not be appropriate for those SPORTS Students can taste samples of kombucha, Community School of Music and Arts, Tateuchi under age 16. See the website for more info and Mountain View Tennis Summer Camp sourdough bread and other fermented foods COMMUNITY EVENTS Hall, 230 San Antonio Circle, Mountain View. the full schedule and times. May 28-31, June 4-7 Registration Mountain View Tennis will and 10-14. $20 general; $15 student, senior, made by the instructor, and they will take home Oscar Wilde Adult Storytime At this www.arts4all.org/attend/concerts.htm hold summer tennis camps at a few locations Foothill employee; $10 OwlCard holder. Foothill a jar of kombucha and a Symbiotic Colony of month’s story-time event for grown-ups, a throughout the summer for players from ages College, Lohman Theatre, 12345 El Monte Road, Bacteria and Yeast, or a SCOBY. June 17, 6-8 Mountain View Public Library librarian will read DANCE 7 to 14 and of different abilities. Campers will p.m. $60. Private home, address provided upon Cuban Rhythm Dances In this six-week Los Altos Hills. Call 650-949-7360. foothill.edu/ learn skills, play cooperatively and have fun in a stories by Oscar Wilde, including “The Happy theatre/tickets.php registration, Mountain View. Call 650-450-8205. Prince.” RSVP is optional. June 15, 7-8 p.m. class sponsored by MVLA Adult Education, Ellen positive environment. See the website for specific zerowastechef.com/register/ Free. Mountain View Public Library, 585 Franklin Murray and Gene Esswein will teach students ‘Arcadia’ The Pear Avenue Theatre will end dates and pricing. Monday-Friday, June 15-Aug. Tool Time in the Garden Author and St., Mountain View. Call 650-526-7020. www. how to dance the rumba, cha-cha and mambo/ its season with a production of “Arcadia,” a 14. Prices vary. Cuesta, Rengstorff, Whisman and gardener Claire Splan will lead an entertaining mountainview.gov/library salsa. Singles and couples are welcome. Mondays, contemporary play by Tom Stoppard in which the Cooper parks, Mountain View. Call 650-967- and informative workshop on selecting and June 15-July 20, 7:30-9 p.m. $50. Mountain activity of two scholars living at an English estate 5955. www.mountainviewtennis.net maintaining the most important gardening CONCERTS View Recreation Center, 201 S. Rengstorff Ave., is juxtaposed with that of the estate’s residents Mountain View. Call 650-867-3460. mvlaae.net 180 years before. See website for specific dates; LECTURES & TALKS tools. A book signing will follow. Registration is ‘Three Summits of French Chamber no show will be performed on July 4. June 18-July ‘Demystifying Orchids’ UC Master Gardener appreciated but not required. June 18, 6:30-7:30 Music’ For the first performance in the second FAMILY AND KIDS 12, Wednesday-Saturday, 8 p.m.; Sunday, 2 Jamie Chen will give a lecture teaching others how p.m. Free. Mountain View Public Library, 585 annual Festival of French Classical Music put on p.m. $10 June 18 preview; $25/$20 Thursday to successfully grow and care for orchids. Topics Franklin St., Mountain View. Call 650-526-7020. by Alliance Francaise Silicon Valley, Ensemble Author LeUyen Pham on ‘There’s No and Sunday; $30/$25 Friday and Saturday. The covered will include potting techniques, optimum www.mountainview.gov/library San Francisco will play pieces by Claude Debussy, Such Thing as Little’ Bay Area illustrator Pear Avenue Theatre, 1220 Pear Ave., Unit K, temperature, light needs, humidity levels, Vintage Tintype Photography The Los Maurice Ravel and Cesar Franck. June 19, 8 and author LeUyen Pham will read and sign Mountain View. www.thepear.org/arcadia.htm fertilizing, watering and propagation. Attendees Altos History Museum will hold a class where p.m. $45 first five rows; $35 last five rows; $25 copies of her picture book “There’s No Such Thing as Little,” which examines little things and ‘Chinglish’ For its next production, the Palo can bring specific questions to be answered. June encourages all ages to think big. June 20, 1-2 p.m. Alto Players will stage “Chinglish,” a play 13, 11:30 a.m.-1 p.m. Free. Mountain View Public Free. Linden Tree Books, 265 State St., Los Altos. by David Henry Hwang of comedy, love and Library, 585 Franklin St., Mountain View. Call 408- Call 650-949-3390. www.lindentreebooks.com communication that follows the American Daniel 282-3105. mastergardeners.org/scc.html Lizards at the Library Mountain View Police as he seeks to expand his family’s sign-making ‘How To Raise an Adult: An Evening Inspirations business to China. June 12-28, Thursday, 7 p.m.; Department’s own Sergeant Saul Jaeger — and with Julie Lythcott-Haims’ Former Stanford friends — will share his personal collection of Friday and Saturday, 8 p.m.; Sunday, 2 p.m. $31- University Dean of Freshmen and Palo Alto lizards, snakes and other creatures. All ages $45. Lucie Stern Theater, 1305 Middlefield Road, parent Julie Lythcott-Haims will talk about her a guide to the spiritual community are welcome. Registration is appreciated, but Palo Alto. Call 650-329-0891. www.paplayers. new book “How to Raise an Adult: Break Free not required. Sunday, June 21, 1-2 p.m. Free. org/our-shows/on-stage-now/ of the Overparenting Trap and Prepare Your LOS ALTOS LUTHERAN To include your Mountain View Public Library, 585 Franklin St., ‘Fallen Angels’ TheatreWorks will offer a Kid for Success,” which explores the dangers of Bringing God’s Love and Hope to All Mountain View. Call 650-526-7020. www. production directed by Robert Kelley of “Fallen hyper-attentive, or helicopter, parenting. June Church in mountainview.gov/library Angels,” a Noël Coward comedy about two 13, 7:30-9 p.m. $15 general; $40 admission and book. Schultz Cultural Arts Hall, 3921 Fabian Way, Children’s Nursery Poolside Sundays The Oshman Family JCC married women who reconnect with a charming Palo Alto. Call 650-223-8664. paloaltojcc.org/ 10:00 a.m. Worship Inspirations will hold poolside parties each Sunday, where French lover. See website for specific times and dialogues 10:10 Sunday School Please call there will be a bounce house and food options, dates. June 3-28. $53 adult; $43 senior, educator; 11:15 a.m. Fellowship including barbecue. Sundays, June 14-Aug. 16, $25 under age 30. Mountain View Center for the ‘Scam and Fraud Protection’ At this 11:30 a.m.-3 p.m. Free for members; guest passes Performing Arts, 500 Castro St., Mountain View. Mountain View Public Library event, Mountain Blanca Yoc www.theatreworks.org/shows/1415-season/ Pastor David K. Bonde available for nonmembers. Oshman Family JCC View police officers will offer tips on ensuring fallenangels the safety of an individual’s property, family Outreach Pastor Gary Berkland at 650-223-6596 Pool, 3921 Fabian Way, Palo Alto. Call 650-223- 8631. paloaltojcc.org/familyactivities ‘Urinetown: The Musical’ The Los Altos and person. Registration is appreciated but not or email Stage Company will offer a production of required. June 16, 6:30-7:30 p.m. Free. Mountain 460 South El Monte (at Cuesta) HEALTH “Urinetown: The Musical,” a satirical play by View Public Library, 585 Franklin St., Mountain 650-948-3012 [email protected] www.losaltoslutheran.org Covered California talk at June NHN Mark Hollman and Greg Kotis set in a fictional, View. Call 650-526-7020. www.mountainview. community outreach event At one of drought-plagued future where citizens protest gov/library the Neighbors Helping Neighbors community the government’s ban on private toilets. See outreach events, Shelly Grimaldi of Covered the website for specific dates. May 28-June 27, TEEN ACTIVITIES MOUNTAIN VIEW CENTRAL SEVENTH-DAY ADVENTIST CHURCH California and Harbage Consulting will give a Wednesday-Saturday, 8 p.m.; Sunday, 3 p.m. $18- Youth TV Studio Production Workshop $36. Bus Barn Theater, 97 Hillview Ave., Los Altos. Sabbath School: talk discussing Cal MediConnect, which offers a (June 15-19) The Midpeninsula Community 9:30 a.m. single managed care plan for Santa Clara County Call 650-941-0551. www.losaltosstage.org Media Center will offer a session for students Saturday Services: Worship 10:45 a.m. residents eligible for Medicare and Medi-Cal. SENIORS in grades six to eight where they can learn Wednesday Study Groups: 10-11 a.m. June 13, noon-2 p.m. Free. Middlefield Meadows skills for producing, directing and starring Club House, 114 Flynn Ave., Mountain View. CSA Referral: Legal/Financial in a TV show. Participants will transform a Pastor Kenny Fraser, B.A.M. DIV Call 650-283-0270. www.facebook.com/ Resources Community Services Agency’s Senior concept into a completed show, creating sets, NeighborsHelpingNeighborsPaloAlto Case Managers will visit the Mountain View monitoring cameras and sound, using graphics 1425 Springer Rd., Mtn. View - Office Hrs. M-F 9am-1pm Danceation Fitness Classes European Senior Center to share resources for wills/trusts, and acting. June 15-19, 9 a.m.-3 p.m. $450. www.mtviewda.adventistfaith.org Phone: 650-967-2189 pop star Heath Hunter and international fitness financial planning and low-income legal options. Midpeninsula Community Media Center, 900 San guru Kirsten Johnson will lead high-energy No legal or financial advice will be given at this Antonio Road, Palo Alto. Call 650-494-8686. session. June 16, 10-11 a.m. Free. Mountain View midpenmedia.org/youth/digiquest-2-2/ 28 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 fogster.com THE PENINSULA’S FREE CLASSIFIEDS WEBSITE Combining the reach of the Web with Marketplace print ads reaching over 150,000 readers! PLACEPLACE AN AD fogster.com is a unique website offering FREE postings from communities throughout the Bay Area and an opportunity for your ad to appear in the Palo Alto Weekly, The Almanac and the Mountain View Voice. ONLINE fogster.com 145 Non-Profits 240 Furnishings/ E-MAILE-MAIL Bulletin Needs Household items Mind Business [email protected]@fogster.com DONATE BOOKS TO SUPPORT LIBRARY Sofa - $400 Stanford Museums Volunteer 245 Miscellaneous Board WISH LIST FRIENDS OF PA LIBRARY & Body Services DirecTV PHONE Starting at $19.99/mo. FREE Installation. 150 Volunteers FREE 3 months of HBO SHOWTIME 650.326.8216 115 Announcements Fosterers Needed for Moffet Cats CINEMAX, STARZ. FREE HD/DVR 403 Acupuncture 604 Adult Care DID YOU KNOW FRIENDS OF THE MTN VIEW LIBRARY Upgrade! 2015 NFL Sunday Ticket DID YOU KNOW Offered Included (Select Packages) New 7 IN 10 Americans or 158 million U.S. Now you can log on to Information is power and content FRIENDS OF THE PALO ALTO LIBRARY Nurse/CNA Available Customers Only. CALL 1-800-385-9017 Adults read content from newspaper is King? Your doorway to statewide Live in. 23 yrs hospital exp., all areas. fogster.comfogster.com, day or JOIN OUR ONLINE STOREFRONT TEAM (CalSCAN) media each week? Discover the Power Public Notices, California Newspaper Local. 650/224-1870 night and get your ad Publishers Association Smart Search Dish Network of Newspaper Advertising. For a free Feature. Sign-up, Enter keywords and sit 152 Research Study Get MORE for LESS! Starting $19.99/ brochure call 916-288-6011 or email started immediately online. [email protected] (Cal-SCAN) 624 Financial back and let public notices come to you Volunteers month (for 12 months.) PLUS Bundle Most listings are free and on your mobile, desktop, and tablet. For and SAVE (Fast Internet for $15 more/ Reduce Your Past Tax Bill more information call Hot Flashes? month.) CALL Now 1-800-357-0810 425 Health Services by as much as 75 Percent. Stop Levies, includeinclude a one-lineone-line frfreeee Women 40-65 with frequent hot flashes, Liens and Wage Garnishments. Call The Cecelia @ (916) 288-6011 or (Cal-SCAN) Drivers: Great Miles www.capublicnotice.com (Cal-SCAN) may qualify for the REPLENISH Trial - a Tax DR Now to see if you Qualify printprint ad in our Peninsula free medical research study for post- Kill Bed Bugs! and Top 1% Pay. Family Company. 1-800-498-1067. (Cal-SCAN) Pregnant? Buy Harris Bed Bug Killers/ KIT. Available: Loyalty Bonus! Quality Equipment. Pet/ newspapersnewspapers with the menopausal women. Call 855-781-1851. Sell Your Structured Thinking of adoption? Talk with car- (Cal-SCAN) Hardware Stores, Buy Online/Store: Rider Program. CDL-A Req - optionoption of photosphotos and ing agency specializing in matching homedepot.com (877) 258-8782 settlement or annuity payments for Birthmothers with Families Nationwide. (AAN CAN) www.drive4melton.com (Cal-SCAN) CASH NOW. You don’t have to wait for additional lines. ExemptExempt your future payments any longer! LIVING EXPENSES PAID. Call 24/7 Abby’s Having Sleep Problems? Kill Roaches! Got Knee Pain? Back Pain? One True Gift Adoptions. 866-413-6293. Call 1-800-673-5926 are employment ads, If you are 60 years or older, you may Guaranteed. Buy Harris Roach Tablets. Got Knee Pain? Back Pain? Shoulder (Cal-SCAN) whichwhich includeinclude a wwebeb Void in Illinois/ New Mexico/Indiana be eligible to participate in a study of No Mess, Odorless, Long Lasting. Pain? Get a pain-relieving brace -little or (AAN CAN) Non-Drug Treatments for Insomnia Available: ACE Hardware, The Home NO cost to you. Medicare Patients Call SOCIAL SECURITY DISABILITY listinglisting charge. Home sponsored by the National Institutes Depot (AAN CAN) Health Hotline Now! 1- 800-796-5091 Benefits. Unable to work? Denied ben- PREGNANT? efits? We Can Help! WIN or Pay Nothing! Considering adoption? Call us first. of Health, and conducted at the Safe Step Walk-In Tub! (Cal-SCAN) Services and Mind & Body Veterans Affairs Palo Alto Medical Contact Bill Gordon & Associates at Living expenses, housing, medical, and Alert for Seniors. Bathroom falls can be Struggling with Drugs 1-800-966-1904 to start your application Services requirerequire contact continued support afterwards. Choose Center. Participants will receive fatal. Approved by Arthritis Foundation. extensive sleep evaluation, individual or alcohol? Addicted to PILLS? Talk to today! (Cal-SCAN) withwith a CustomerCustomer SalesSales adoptive family of your choice. Call 24/7. Therapeutic Jets. Less Than 4 Inch Step- someone who cares. Call The Addiction 1-877-879-4709 (CalSCAN) treatment, and reimbursement for In. Wide Door. Anti-Slip Floors. American participation. For more information, Hope and Help Line for a free assess- 636 Insurance Representative.Representative. Made. Installation Included. Call ment. 800-978-6674 Free Steel Drum Concert please call Stephanie or Ryan at 800-799-4811 for $750 Off. (Cal-SCAN) Auto Insurance (650) 849-0584. (For general Natural Aphrodisiac I NEED ANDROID BEEP HELP starting at $25/month. So, the next time you have information about participant rights, SAWMILLS UltimateDesireWorks.com Call 855-977-9537 Reese Jones Entrepreneur Lecture contact 866-680-2906.) from only $4397. Make and save money an item to sell, barter, give with your own bandmill- Cut lumber any Lowest Prices away or buy, get the perfect Summer Dance Camps&Classes dimension. In stock ready to ship. FREE 460 Pilates Health and Dental Insurance. We have combination: print ads in Info/DVD: www.NorwoodSawmills.com DID YOU KNOW the best rates from top companies! Call 130 Classes & 1-800-578-1363 Ext.300N (Cal-SCAN) 144 million U.S. Adults read a Newspaper Now! 888-989-4807. (CalSCAN) your local newspapers, print copy each week? Discover the Power Instruction 250 Musical of Newspaper Advertising. For a free reaching more than 150,000 brochure call 916-288-6011 or email AIRLINE CAREERS Home Instruments [email protected] (Cal-SCAN) readers, and unlimited free Start Here – Get trained as FAA certi- web postings reaching fied Aviation Technician. Financial aid For Sale Full-Size H Schuster Violin - $800 for qualified students. Job placement hundreds of thousands assistance. Call Aviation Institute of Services additional people!! Maintenance 866-231-7177. (Cal-SCAN) 202 Vehicles Wanted Kid’s AIRLINE CAREERS Cash for Cars 715 Cleaning begin here – Get started by training Any Car/Truck. Running or Not! Top Jobs as FAA certified Aviation Technician. Dollar Paid. We Come To You! Call For Stuff Services Financial aid for qualified students. Job Instant Offer: 1-888-420-3808 Delma’s House Cleaning INDEX placement assistance. Call Aviation www.cash4car.com (AAN CAN) Gloria’s Housecleaning Q BULLETIN BOARD Institute of Maintenance 800-725-1563 Donate Your Car, Truck, Boat 500 Help Wanted Weekly, bi-weekly, monthly. Own (AAN CAN) to Heritage for the Blind. FREE 3 Day 340 Child Care Dry Cleaners in Palo Alto 100-199 supplies. Great refs., affordable rates. Earn $500 A Day Vacation, Tax Deductible, Free Towing, Wanted Experienced spotter/presser needed now. 5 days 35 hrs/week. Will train 650/704-1172 Q FOR SALE as an Airbrush Makeup Artist All Paperwork Taken Care of. For: Ads . TV . Film . Fashion. HD . Digital. Call 800-731-5042 (Cal-SCAN) Reliable Childcare/ Housekeeper presser. Call 650 329-0998 Isabel and Elbi’s Housecleaning 200-299 35% OFF TUITION - One Week Course I buy old Porsche’s A responsible, reliable and energetic Labors & Painters Apartments and homes. Excellent refer- ences. Great rates. 650/670-7287 or taught by top makeup artist & 911, 356. 1948-1973 only. Any condition. Housekeeper/ Babysitting who can Top $$$. Must be a US CITIZEN and valid Q 650/771-8281  KIDS STUFF photographer Top $$ paid. Finders Fee. Call help us with our child. Work will be 3 CA DL. 3-4 years exp. Call 650/322-4166 330-399 Train & Build Portfolio. Models Provided. 707-965-9546 or email hours daily for three days in a week. Lucy’s Housecleaning Service Accredited. A+ Rated. [email protected] Experience necessary,Contact us if 525 Adult Care Homes, condos, apts. Window cleaning. Q MIND & BODY AwardMakeupSchool.com (Cal-SCAN) you are interested 22 years exp., refs. Free est. (818) 980-2119 (AAN CAN) Older Car, Boat, RV? Wanted 650/771-8499; 408/745-7276. 400-499 [email protected] 133 Music Lessons Got an older car, boat or RV? Do the 350 Preschools/ Caregiver needed QJOBS humane thing. Donate it to the Humane male caregiver for disabled student in Orkopina Housecleaning MV. Call (650)-906-4715. 500-599 Christina Conti Private Piano Society. Call 1- 800-743-1482 (Cal-SCAN) Schools/Camps Spring Cleaning Sale. Celebrating 30 Instruction Acorn Chinese Learning Center years. 650/962-1536 Lessons in your home. Bachelor of 210 Garage/Estate 560 Employment QBUSINESS Children Mandarin & Cantonese  Music. 650/493-6950 Program. www.acornchinese.com 748 Gardening/ SERVICES Sales Information Hope Street Music Studios Menlo Park, 921 Lucky Ave., June 13 & Art & Soul Summer Camp Drivers: Class A CDL Landscaping 600-699 Now on Old Middefield Way, MV. Most 14, 9-4 Bridge (Card Game) Summer Camp in 2-1/2 weeks. Company Sponsored A. Barrios Garden Maintenance instruments, voice. Training. Also Hiring Recent Truck Palo Alto, 4000 Middlefield Road, June Piano Summer Camp *Weekly or every other week QHOME All ages and levels 650-961-2192 School Graduates, Experienced Drivers. www.HopeStreetMusicStudios.com 13 & 14, 10-4 *Irrigation systems SERVICES 355 Items for Sale Must be 21 or Older. *Clean up and hauling Call: (866) 275-2349. (Cal-SCAN) *Tree removal 700-799 215 Collectibles & 3DVDsLittlePeople,PlanetHeroes,T MAKE $1000 Weekly!! *Refs. 650/771-0213; 392-9760 Antiques 3T KRU RainJacket $5 Q FOR RENT/ Mailing Brochures From Home. Helping Dr. Seuss Pink Tufted Beast - $6200 Nike ShinpadsAge4-7y$4 home workers since 2001. Genuine FOR SALE Opportunity. No Experience Required. Dr. Seuss Relaxed in Spite of It - $3800 J. Garcia Garden Maintenance PoohDuvetCoverPillowCase Start Immediately. REAL ESTATE Service www.theworkingcorner.com (AAN CAN) 800-899 220 Computers/ SoccerCleatsSize2$7Diadora Free est. 21 years exp. Piano Lessons Electronics TopGunPilotJacket4T 650/366-4301 or 650/346-6781 QPUBLIC/LEGAL Quality Piano Lessons in Menlo Park. Fogster.com is a unique Call (650)838-9772 Alita Lake Macbook Air 13” 128GB MD760LL/B NOTICES - $850 To place a Classified ad in website offering FREE postings from LANDA’S GARDENING & communities throughout the Bay Area LANDSCAPING 995-997 135 Group Activities 230 Freebies The Almanac, The Palo Alto Weekly *Yard Maint. *New Lawns. *Rototil *Clean Ups *Tree Trim *Power Wash Thanks St Jude Nicely upholstered chaise - FREE or The Mountain View Voice and an opportunity for your ad to appear The publisher waives any and all claims or *Irrigation timer programming. consequential damages due to errors. Embarcadero call 326-8216 in The Almanac, the Palo Alto Weekly, 19 yrs exp. Ramon, 650/576-6242 Media cannot assume responsibility for the claims or 140 Lost & Found [email protected] performance of its advertisers. Embarcadero Media FOGSTER.COM or visit us at fogster.com and the Mountain View Voice. has the right to refuse, edit or reclassify any ad 123 solely at its discretion without prior notice. GO TO FOGSTER.COM TO RESPOND TO ADS WITHOUT PHONE NUMBERS June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 29 the printed version of MARKETPLACE THE PENINSULA’S FREE CLASSIFIEDS WEBSITE TM TO RESPOND TO ADS WITHOUT PHONE NUMBERS fogster.com GO TO WWW.FOGSTER.COM

R.G. Landscape business under the fictitious business your claim with the court and mail a Drought tolerant native landscapes and 771 Painting/ 809 Shared Housing/ name(s) listed above on 5/29/15. copy to the personal representative succulent gardens. Demos, installations, Wallpaper Rooms Public This statement was filed with the appointed by the court within the later maint. Free est. 650/468-8859 County Clerk-Recorder of Santa Clara of either (1) four months from the date County on May 29, 2015. of first issuance of letters to a general Scott Haber Landsaping DAVID AND MARTIN ALL AREAS ROOMMATES.COM Lonely? Bored? Broke? Find the perfect (MVV June 5, 12, 19, 26, 2015) personal representative, as defined in PAINTING roommate to complement your person- Notices TETON CONSTRUCTION section 58 (b) of the California Probate 751 General Quality work ality and lifestyle at Roommates.com! FICTITIOUS BUSINESS NAME STATEMENT Code, or (2) 60 days from the date of Contracting Good references (AAN CAN) File No.: 605579 mailing or personal delivery to you Low price 995 Fictitious Name The following person (persons) is (are) of a notice under section 9052 of the Palo Alto, 1 BR/1 BA - $1350/mo doing business as: California Probate Code. Other California A NOTICE TO READERS: Lic. #52643 (650) 575-2022 Statement Teton Construction, located at 490 Easy statutes and legal authority may affect It is illegal for an unlicensed person your rights as a creditor. You may want EL MONTE LIQUOR STORE Street Apt. 8, Mountain View, CA 94043, to perform contracting work on any 815 Rentals Wanted to consult with an attorney knowledge- Glen Hodges Painting FICTITIOUS BUSINESS NAME STATEMENT Santa Clara County. project valued at $500.00 or more in able in California law. File No.: 604601 This business is owned by: An labor and materials. State law also Call me first! Senior discount. 45 yrs. Single Bedroom furnished unit You may examine the file kept by the The following person (persons) is (are) Individual. requires that contractors include #351738. 650/322-8325 court. If you are a person interested in doing business as: The name and residence address of the their license numbers on all advertis- Student needs summer housing the estate, you may file with the court H.D.A. Painting and Drywall El Monte Liquor Store, located at 992- owner(s)/registrant(s) is(are): ing. Check your contractor’s status a Request for Special Notice (form Interior/exterior painting, drywall 94, El Monte Ave., Mountain View, CA JOHN KLUG at www.cslb.ca.gov or 800-321-CSLB DE-154) of the filing of an inventory installed. Mud, tape all textures. Free est. 825 Homes/Condos 94040, Santa Clara County. 490 Easy Street Apt. 8 (2752). Unlicensed persons taking and appraisal of estate assets or of 650/207-770 This business is owned by: Married Mountain View, CA 94043 jobs that total less than $500.00 any petition or account as provided in for Sale Couple. Registrant/Owner began transacting must state in their advertisements Italian Painter Probate Code section 1250. A Request The name and residence address of the business under the fictitious business that they are not licensed by the Spring Spruce Up! Avail. now! Interior/ Menlo Park, 3 BR/2 BA - $899000 for Special Notice form is available from owner(s)/registrant(s) is(are): name(s) listed above on N/A. Contractors State License Board. exterior. 30 years exp. Excel. refs. No job the court clerk. TRON DOAN This statement was filed with the too small. AFFORDABLE RATES. Free Palo Alto, 3 BR/2 BA - $1099000 County Clerk-Recorder of Santa Clara Petitioner: est. Call Domenico, 650/421-6879 5607 Lean Ave. Siobhan Marie Waldron, in Pro Per San Jose, CA 95123 County on June 2, 2015. Sunnyvale, 3 BR/2 BA - $899000 (MVV June 5, 12, 19, 26, 2015) 1125 Manzanita Street 757 Handyman/ STYLE PAINTING MYLAN DUONG Los Angeles, CA 90029 Full service painting. Insured. Lic. 5607 Lean Ave. (650)279-4626 Repairs 903303. 650/388-8577 850 Acreage/Lots/ San Jose, CA 95123 997 All Other Legals (MVV June 5, 12, 19, 2015) Registrant/Owner began transacting Handyman Services NOTICE OF PETITION TO ADMINISTER Storage business under the fictitious business NOTICE OF BULK SALE Lic. 249558. Plumb, elect., masonry, car- ESTATE OF: 775 Asphalt/ name(s) listed above on N/A. (subject to Com. C. 6106.2) pentry, landscape. 40+ years exp. Pete DID YOU KNOW DAWN ELLEN HYDE This statement was filed with the Case No.: 1-15-PR 176524 The following definitions and designa- Rumore, 650/823-0736; 650/851-3078 Concrete DID YOU KNOW Information is power County Clerk-Recorder of Santa Clara To all heirs, beneficiaries, creditors, con- tions shall apply in this Notice without Roe General Engineering and content is King? Do you need timely County on May 7, 2015. tingent creditors, and persons who may regard to number or gender: Asphalt, concrete, pavers, tiles, sealing, access to public notices and remain rel- 759 Hauling (MVV June 5, 12, 19, 26, 2015) otherwise be interested in the will or SELLER: Yuksel Corporation artificial turf. 36 yrs exp. No job too evant in today’s highly competitive estate, or both, of DAWN ELLEN HYDE. 1477 Plymouth Street #E, Mtn View, J & G HAULING SERVICE small. Lic #663703. 650/814-5572 market? Gain an edge with California HARBORS A Petition for Probate has been filed CA 94043 Misc. junk, office, gar., furn., Newspaper Publishers Association new FICTITIOUS BUSINESS NAME STATEMENT by: SIOBHAN MARIE WALDRON in the BUYER: Kucchii, Inc. mattresses, green waste, more. innovative website capublicnotice.com File No.: 605716 Superior Court of California, County of 1477 Plymouth Street #E, Mtn View, Lic./ins. Free est. 650/743-8852 779 Organizing and check out the Smart Search The following person (persons) is (are) SANTA CLARA. CA 94043 (see my Yelp reviews) Feature. For more information call doing business as: Services The Petition for Probate requests that: BUSINESS: FALAFEL & KEBAB Cecelia @ (916) 288-6011 or Harbors, located at 452 Franklin St., SIOBHAN MARIE WALDRON be appoint- 1477 Plymouth Street #E, Mtn View, End the Clutter & Get Organized www.capublicnotice.com (Cal-SCAN) Mountain View, CA 94041, Santa Clara CA 94043 767 Movers Residential Organizing County. ed as personal representative to admin- ister the estate of the decedent. DATE OF CONSUMMATION: June 30, Sunny Express Moving Co. by Debra Robinson This business is owned by: An The petition requests authority to 2015 Afforable, Reliable, Refs. CalT #191198. (650)390-0125 855 Real Estate Individual. administer the estate under the 650/722-6586 or 408/904-9688 The name and residence address of the Services Independent Administration of LAST DAY TO FILE CLAIMS: June 29, 2015 owner(s)/registrant(s) is(are): ESCROW HOLDER: WILLIAM H. DUNN, MANUEL C. RAMIREZ Estates Act. (This authority will allow Real DID YOU KNOW the personal representative to take Attorney at Law, 1350 Dell Avenue, Suite Information is power and content is 452 Franklin St. 204, Campbell, CA 95008 No phone Mountain View, CA 94041 many actions without obtaining court King? Do you need timely access to approval. Before taking certain very Notice is hereby given that Seller number in the public notices and remain relevant in Registrant/Owner began transacting intends to make a bulk sale of the business under the fictitious business important actions, however, the per- ad? Estate today’s hostile business climate? Gain sonal representative will be required to assets of the above described Business the edge with California Newspaper name(s) listed above on N/A. to Buyer including all stock in trade, GO TO This statement was filed with the give notice to interested persons unless Publishers Association new innovative they have waived notice or consented furniture, and equipment used in said website capublicnotice.com and check County Clerk-Recorder of Santa Clara Business, to be consummated at the FOGSTER.COM County on June 4, 2015. to the proposed action.) The indepen- 801 Apartments/ out the FREE One-Month Trial Smart office of the Escrow Holder at the for contact (MVV June 12, 19, 26, July 3, 2015) dent administration authority will be Condos/Studios Search Feature. For more information granted unless an interested person files time of consummation or thereafter. information call Cecelia @ (916) 288-6011 or SOUTH OCEAN EXPRESS an objection to the petition and shows Creditors of the Seller may file claims Menlo Park, 2 BR/1 BA - $3,295 www.capublicnotice.com (Cal-SCAN) FICTITIOUS BUSINESS NAME STATEMENT good cause why the court should not with the Escrow Holder on or before the File No.: 605504 grant the authority. last day to file claims stated above. This The following person (persons) is (are) A HEARING on the petition will be held sale is subject to California Commercial doing business as: on July 2, 2015 at 9:00 a.m. in Dept.: Code 6106.2. South Ocean Express, located at 501 10, of the Superior Court of California, Seller has used the following other Moorpark Way, Spc. #7, Mountain View, County of Santa Clara, located at 191 N. business names and addresses within “Is Quality Important to You? We M easure Quality by Results” CA 94041, Santa Clara County. First St., San Jose, CA, 95113. the last three years so far as known to This business is owned by: An If you object to the granting of the peti- Buyer: None Yvonne Heyl Individual. tion, you should appear at the hearing The name and residence address of the and state your objections or file written Kucchii, Inc. ˆÀiVÌÊ­Èxä®Ê™{LJ{ș{ owner(s)/registrant(s) is(are): objections with the court before the ______Power of Two iÊ­Èxä®ÊÎäӇ{äxx NAM TRAN hearing. Your appearance may be in BY: WILLIAM H. DUNN 501 Moorpark Way, Spc. #7 person or by your attorney. Agent for Buyer , ›Êä£ÓxxÈÈ£ Mountain View, CA 94041 If you are a creditor or a contingent 6/12/15 Registrant/Owner began transacting creditor of the decedent, you must file CNS-2761574# Þ iޏJˆ˜ÌiÀœÀi>iÃÌ>Ìi°Vœ“ MVV Jeff Gonzalez ˆÀiVÌÊ­Èxä®Ê™{LJ{șn iÊ­{än®Ênnn‡ÇÇ{n , ›Êää™ÇnǙЍ}œ˜â>iâJˆ˜ÌiÀœÀi>iÃÌ>Ìi°Vœ“ Team BRE# 70000637 Do You Know? Þۜ˜˜i>˜`ivvJˆ˜ÌiÀœÀi>iÃÌ>Ìi°Vœ“ {™ÈʈÀÃÌÊ-Ì°Ê-ՈÌiÊÓääÊUÊœÃÊ
ÌœÃʙ{äÓÓ ÜÜÜ°Þۜ˜˜i>˜`ivv°Vœ“ ࠮;OL4V\U[HPU=PL^=VPJLPZHKQ\KPJH[LK[V W\ISPZOPU[OL*V\U[`VM:HU[H*SHYH THINK GLOBALLY ࠮6\YHKQ\KPJH[PVUPUJS\KLZ[OL4PK7LUPUZ\SH JVTT\UP[PLZVM7HSV(S[V:[HUMVYK3VZ(S[VZ POST LOCALLY HUK4V\U[HPU=PL^ THE PENINSULA’S FREE ࠮;OL4V\U[HPU=PL^=VPJLW\ISPZOLZL]LY`-YPKH` CLASSIFIEDS WEBSITE +LHKSPUL!WT[OLWYL]PV\Z-YPKH`

To respond to ads *HSS(SPJPH:HU[PSSHU without phone numbers [VHZZPZ[`V\^P[O`V\YSLNHSHK]LY[PZPUNULLKZ Go to www.Fogster.Com ,THPS!HZHU[PSSHU'WH^LLRS`JVT

30 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 DELEON REALTY SUMMER SPLASH

DeLeon Realty is excited to announce the July Summer Splash.

Buyers often want to buy homes during the summer so they can get settled before the new school year. However, real estate agents have traditionally advised sellers to wait until the fall because the low inventory causes buyers to lose focus.

In response to what buyers and sellers want, DeLeon Realty is breaking with tradition and releasing some of the year’s best listings between July 13th and July 26th.

There will be special incentives for anyone who buys a DeLeon listing during the Summer Splash, including a $5,000 gift FHUWLÀFDWHWR)OHJHO·V,QWHULRU'HVLJQ +RPH )XUQLVKLQJV7KDW·VULJKW'H/HRQ5HDOW\ZLOODWWUDFWPRUH BUYERS by giving them $5,000 to spend at one of Silicon Valley’s best furniture stores.

Check out the next issue of The DeLeon Insight or visit www.DeLeonRealty.com for more information. Give us a call at 650.488.7325 if you would like to list your home during our Summer Splash.

Disclaimer: This is a limited time offer. This promotion only applies to homes originally listed by the DeLeon Team be- tween the dates of July 13, 2015 and July 26, 2015 as part of the Summer Splash. The home must be in contract by July 31, 2015. The transaction must close by September 1, 2015 and the Gift Certificate must be used by March 31, 2016. There is no cash value to the certificate. Lost certificates will not be replaced. The certificate will be issued in the Buyers’ names and they are non-transferable. Please check our website at www.deleonrealty.com for further details.

650.488.7325 | www.deleonrealty.com | DeLeon Realty CalBRE #01903224

June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 31 Ready for a change? PAM BLACKMAN ‰ Diversifying your portfolio CERTIFIED RESIDENTIAL SPECIALIST® ‰ Combining households SENIORS REAL ESTATE SPECIALIST® ‰ Ready for retirement living ‰ Upsizing or downsizing SOLD by Pam Blackman ‰ Simplifying life (partial list) If your lifestyle change includes Buying or Selling a home, I can help.

650.823.0308 [email protected] www.PamBlackman.com CalBRE# 00584333

DELEON REALTY CONDO SPECIALIST

&RQGRPLQLXPVDQGWRZQKRPHVDUHWHUULÀF MAKE THE RIGHT CHOICE options for people looking to move into an area where single family homes are cost-prohibitive. In addition to the advantages of shared communal areas and considerable amenities, let our specialist at DeLeon Realty show you what other great features condominium living has to offer.

®

Experience the difference — Visit my website for information on property listings, virtual tours, JERYLANN MATEO buying, selling and much more. Broker Associate Realtor Direct: 650.209.1601 | Cell: 650.743.7895 650.600.3889 | [email protected] [email protected] | www.jmateo.com www.deleonrealty.com | CalBRE #01903224 BRE# 01362250 apr.com | LOS ALTOS 167 S. San Antonio Road | 650.941.1111

Buying or selling a home? Try out the Mountain View’s Online real estate site, the most comprehensive place for local real estate listings.

>LVɈLY[OLVULVUSPULKLZ[PUH[PVU[OH[SL[Z`V\M\SS`L_WSVYL!

࠮0U[LYHJ[P]LTHWZ ࠮7YPVYZHSLZPUMV ࠮/VTLZMVYZHSL ࠮5LPNOIVYOVVKN\PKLZ ࠮6WLUOV\ZLKH[LZHUK[PTLZ ࠮(YLHYLHSLZ[H[LSPURZ ࠮=PY[\HS[V\YZHUKWOV[VZ ࠮HUKZVT\JOTVYL Our comprehensive online guide to the Midpeninsula real estate market has all the resources a home buyer, agent or local resident could ever want and it’s all in one easy-to-use, local site!

Agents: You’ll want to explore our unique online advertising opportunities. *VU[HJ[`V\YZHSLZYLWYLZLU[H[P]LVYJHSS [VKH`[VÄUKV\[ more.

Explore area real estate through your favorite local website: PaloAltoOnline.com PaloAltoOnline.com TheAlmanacOnline.com TheAlmanacOnline.com MountainViewOnline.com And click on “real estate” in the navigation bar.

MountainViewOnline.com

©2015 Embarcadero Publishing Company

32 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 180 Escobar Road, Portola Valley Offered at $2,988,000 Home Enjoys Treehouse-Like Grandeur Enjoy treetop luxury living within this 4 bedroom, 3 bathroom home of 2,430 sq. ft. (per county) on a lot of 4.3 acres (per county). Offering an exotic multi-level structure in an intimate woodland environment, this home provides natural hardwood floors, soaring ceilings, and terrific views from almost every window. Oversized windows and a carved stone mantelpiece enhance the great room, which shares beamed ceilings with the romantic raised dining area. The light-filled kitchen provides a breakfast nook and fine appliances like a Sub-Zero refrigerator. A lower- level bedroom forms the ideal in-law suite, while the exciting master suite balances cathedral ceilings and a stunning, sky-lit bathroom. Outdoor attractions include a lap pool, a private trail through the property, and broad rear decks offering incredible bay views. Other features include a three-car carport, an office, and original stained- glass windows. This home is just minutes from Interstate 280 and Ladera Shopping Center. Terrific nearby schools include Ormondale Elementary (API 923), Corte Madera (API 937), and Woodside High (buyer to verify eligibility).

For video tour & more photos, please visit: www.180Escobar.com

® OPEN HOUSE Saturday & Sunday, 1-5 pm Complimentary KenKDL DeLeon MhMichael lRk Repka Lunch & Lattes CalBRE #01342140 CalBRE #01854880

650.488.7325 | [email protected] | www.deleonrealty.com | CalBRE #01903224

June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 33 ...and the art of Real Estate

(0LGGOH¿HOG5G Mountain View

OPEN HOUSE 2 bed / 1.5 bath / 935 sq ft

SAT & SUN 1:30PM-4:30PM Charming remodeled townhome end unit. Living URRPZ¿UHSODFHVHSDUDWH dining area, attached garage, inside laundry and huge backyard. DELEON REALTY List Price $645,000 MOUNTAIN VIEW SPECIALIST

116 Flynn Ave. #D Home of the most innovative companies, Mountain View Mountain View has a small-town feel with an international flaJS. From the modernized cultural OPEN HOUSE center of Downtown to the suburban haven of 2 bed / 1 ba / 840 sq ft Waverly Park, let our specialist at DeLeon Realty show SAT & SUN 1:30PM-4:30PM Single level condo end you all that Mountain View has to offer. unit with no one above ® or below. Detached JDUDJHRSHQÀRRUSODQ  remodeled kitchen.

List Price $599,000 650.600.3848 | [email protected] www.deleonrealty.com | CalBRE #01903224 49 Showers Dr. Mountain View

3 bed 2.5 ba 1487 sq ft COMING SOON Quality remodel! Custom We Measure Quality by Results NLWFKHQVHSDUDWHGLQLQJ Is Quality Important to You? room, huge master suite, GHVLJQHUEDWKURRPVSULPH Yvonne Heyl Jeff Gonzalez location and Los Altos +PYLJ[   +PYLJ[  *LSS *LSS   schools )9,  )9,     `OL`S'PU[LYVYLHSLZ[H[LJVT QNVUaHSLa'PU[LYVYLHSLZ[H[LJVT List Price TBD Team BRE# 70000637 `]VUULHUKQLɈ'PU[LYVYLHSLZ[H[LJVT The Power of Two! Since 1998 ^^^`]VUULHUKQLɈJVT 366 Sierra Vista Ave. #9 143 Whelan Court, Mountain View Mountain View SALE PENDING

SALE PENDING 2 bed / 2.5 ba 1478 sq ft Dramatic townhome with RECEIVED MULTIPLE OFFERS soaring ceilings, living URRPZ¿UHSODFHVHSDUDWH dining room, inside laundry, 2 car attached garage, & ODUJHEDFN\DUGSDWLR

List Price $835,000 Desirable California Station at Whisman Station Community. • 3 Bedrooms, 2.5 Baths • New Door Hinges and Knobs • Approx. 1,390 Square Feet • Brand New Flush Mounted Lights • Facing Greenbelt • Brand New Light Fixtures in Entry and Dining Room • Built in 1998 by Kaufman & Broad • Brand New Carpet on Stairs, Upstairs Hallway, and Bedrooms • Laminate Floors in Living Room, Dining Room, and Family • Plantation Shutters Room • Upstairs Laundry THE ROYCE GROUP • Tile Floors in Kitchen and Bathrooms • Central Heating & Air Conditioning Your Townhome & Condo Specialists • New Designer Interior Paint Throughout • Attached 2-Car Garage • Brand New Stainless Steel Kitchen Appliances, Including Sink • Large Storage Area and Faucet • Refrigerator, Washer & Dryer Included (650) 224-1711 • Brand New Quartz Kitchen Counters, Including Island/ • HOA Dues $320/month, Including Pool/Spa, Clubhouse, 2 Breakfast Bar Parks, Kid’s Playground [email protected] Property Website at www.143WhelanCourt.com BRE# 01062078 www.reroyce.com BRE# 01519580 Listed At $999,000 SERENO GROUP believes this information to be correct but has not verified this information and assumes no legal responsibility orf its accuracy. Buyers should investigate these issues to their own satisfaction. 496 First St. Suite 200 • Los Altos 94022

34 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 OPEN Just Listed ?FLJ< =ja•ÛJYlÛ¬ÛJmf•ÛAmf]Û~•Û~€Û¬Û~ÛÝÛ~‘‡‡Û¤Û‚‘‡‡Ûhe

~ƒÛ<ÛGgjlgdYÛ8n]fm]•ÛCgkÛ8dlgk ÝÛJhY[agmk•Ûmh\Yl]\Û`ge]ÛafÛ ÝÛ?Yj\ogg\ÛyÛggjaf_Ûl`jgm_`gml Egjl`ÛCgkÛ8dlgkÛ ÝÛJhY[agmkÛj]YjÛqYj\Ûoal`ÛhYjl]jj]Û ÝÛ>gj_]gmkÛ_Yj\]fkÛgfÛbmklÛgn]jÛ _Yj\]f•Ûk]hYjYl]Ûn]_]lYZd]Û gf]¤imYjl]jÛY[j] _Yj\]f•ÛYf\Û[aljmkÛlj]]k ÝہÛZ]\jggekÛYf\ۀÛZYl`k•Û ÝÛCglÛkar]Ûg^ÛYhhjgpÛ~€•†ƒÛkiÛ^lÛ af[dm\af_ÛhjanYl]ÛimYjl]jkÛa\]YdÛ ¨Zmq]jÛlgÛ[gfxÛje© ^gjÛ]pl]f\]\Û^YeadqÛgjÛYmÛhYaj ÝÛ

All miles and times approximate © Pam Blackman 2015

Pam had a great handle on everything, enlisting capable contractors to handle the repairs and inspections Ask me about and oversaw them. And she guided us ™ in making great decisions about how best to ‘show’ our home. The stager you PAM BEFORE AFTER selected, the marketing materials, and Pam’s Amazing Makeovers the virtual tour made our house look fabulous! All this played a – custom pre-marketing huge part in the 8 written property preparation. offers we received on our home in just 8 days.

6 5 0 . 8 2 3 . 0 3 0 8 P a m @ P a m B l a c k m a n . c o m PAM BLACKMAN www.PamBlackman.com CalBRE# 00584333 CERTIFIED RESIDENTIAL SPECIALIST® SENIORS REAL ESTATE SPECIALIST®

June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 35 2452 PORTERFIELD COURT 5 3 3,048 SF MOUNTAIN VIEW 10,000 SF LOT ATTACHED 3 CAR GARAGE LISTED AT $2,149,000 OPEN SAT. & SUN. 1:30-4:30 Prime Waverly Park Neighborhood - Large Lot

Spacious two story home located in the Waverly Park neighborhood, walking distance to Cooper Park, the YMCA, El Camino Hospital, local schools and the Stevens Creek Trail. Large master bedroom suite with huge closet space. One bedroom and bath located on the main floor just perfect for an au-pair, office, or guests. Updated kitchen with granite counters. Formal dining room. Separate living room and family room each with a cozy fireplace. Attached three car garage. Sliding glass doors leading to a spacious back yard just perfect for entertaining. DIANE SCHMITZ MLS # 81469594 (650) 947-2955 | www.DianeSchmitz.com

Virtual Tour: [email protected] | CalBRE # 01235034

This information was supplied by reliable sources. Sales Associate believes this information to be www.2452Porterfield.com correct but has not verified this information and assumes no legal responsibility for its accuracy. Buyers should investigate these issues to their own satisfaction. Buyer to verify school availability. JUST LISTED MOUNTAIN VIEW OPEN SAT & SUN | 1:30 - 4:30 pm 2149 Junction Avenue #12

ÝÛKmk[YfÛafkhaj]\•Û^mddqÛj]eg\]d]\ÛafÛ‡~‡ ÝۀÛZ]\jggek•Û€‚ÛZYl`k ÝÛ•† ÛkiÛ^lÛg^Ûdanaf_ÛkhY[]Û¦Ûegj]Ûl`YfÛegklÛ`ge]k ÝÛJ]hYjYl]Û^gjeYdÛ\afaf_Ûjgge ÝÛFh]fÛcal[`]f£^YeadqÛjggeÛ[geZg ÝÛ:`]^¿kÛcal[`]fÛoal`Û[]fl]jÛakdYf\Û^]Ylmj]kÛZ]Ymla^mdÛ Yd\]jÛogg\Û[YZaf]ljq•Û_jYfal]Û[gmfl]jlghk•ÛYhjgfÛkafc•Û klYafd]kkÛkl]]dÛYhhdaYf[]kÛYf\Ûhgl¤xdd]jÛ^Ym[]l•ÛeYcaf_Û l`akÛYÛ[ggc¿kÛ\j]YeÛcal[`]f ÝÛJhY[agmkÛeYkl]jÛZ]\jggeÛkmal]Ûoal`ÛnYmdl]\Û[]adaf_k ÝÛCYj_]Ûf\ÛYf\ۀj\ÛZ]\jggek ÝÛ9gfmkÛjgge£g^x[]£ogjcgmlÛjggeÛ^mddqÛj]eg\]d]\Û oal`Ûcal[`]f]ll]ÛYf\ÛkhY¤klqd]Ûk`go]j ÝÛ9]Ymla^mdÛ[mklgeÛ[jgofÛegd\af_kÛYf\ÛZYk]ZgYj\k•Û \]ka_f]jÛhYaflÛYf\Û`Yf\¤k[jYhh]\ÛgYcÛyggjkÛY\\ÛYÛ ja[`Û]d]_Yf[]ÛlgÛl`]ÛeYafÛdanaf_ÛYj]Yk ÝÛCYj_]Ûj]YjÛ\][cÛYf\ÛqYj\ ÝÛ>j]YlÛdg[YlagfÛd]kkÛl`YfÛ~Ûead]ÛlgÛ>gg_d] Offered at $1,250,000

650.947.4780

[email protected] A Berkshire Hathaway Affiliate

www.HowardBloom.com CalBRE# 00893793

36 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 Tax Issues Relating to Real Property Thursday, June 18, 2015 6:00 - 8:00 p.m.

Please join DeLeon Realty at our June Seminar. Gain insight into tax issues relating to real estate from Michael Repka, the Managing Broker and General Counsel of DeLeon Realty. In addition to a Juris Doctorate (J.D.) Michael holds a graduate law degree in taxation (L.L.M.) from NYU.

Palo Alto Hills Golf & Country Club, ® Palo Alto Hills Grand Ballroom Golf & Country Club 3000 Alexis Drive, Palo Alto

To RSVP, please contact Lena Nguyen at 650.543.8500 or by email at [email protected]

Seminar is for prospective clients only, no outside real estate professionals permitted.

650.543.5800 | [email protected] | www.deleonrealty.com | CalBRE #01903224

June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 37 Visit us online! www.DeLeonRealty.com

Visit DeLeon Realty’s website for exclusive listings before they hit the MLS, alongside the most custom content in the industry.

®

(650) 488-7325| DeLeon Realty | CalBRE #01903224

38 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015 EXTENDED HOURS: FRIDAY, 9:30 AM–5:00 PM 829 MORAGA DRIVE SATURDAY & SUNDAY, MOUNTAIN VIEW 1:00–5:00 PM www.829Moraga.com Call for price

4 BEDS 3 BATHS BUILT IN 2002 BEAUTIFULLY APPOINTED HARDWOOD FLOORS PRIVATE REAR YARD EXCELLENT MOUNTAIN VIEW SCHOOLS

Information deemed reliable, but not guaranteed.

650 • 440 • 5076 [email protected]

davidtroyer.com A Berkshire Hathaway Affiliate

CalBRE# 01234450

June 12, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 39 Coldwell Banker #1 IN CALIFORNIA

ATHERTON Sat/Sun 1 - 4 $10,000,000 PALO ALTO Sat 1:30 - 5 $8,398,000 LOS ALTOS Sun 1:30 - 4:30 $5,798,000 216 Park Ln 4 BR 3 BA Prime location in prestigious sought after 2281 Byron St 5 BR 5.5 BA 6-year new in Old Palo Alto with 5 suites, 1 Adobe Creek Way 4 BR 3.5 BA Experience living in your own pvt neighborhood. 1st time on market in 35 years. office, bonus & media room, large lot redwd preserve. This home offers all luxurious amenities Jerry Haslam CalBRE #01180022 650.941.7040 Judy Shen CalBRE #01272874 650.325.6161 Terri Couture CalBRE #01090940 650.941.7040

PALO ALTO Sun 1:30 - 5 $4,580,000 LOS ALTOS HILLS Sat/Sun 1 - 5 $4,500,000 PALO ALTO $4,188,000 2570 Webster 5 BR 4.5 BA Stunning, Bright, Custom Built New Home 11688 Dawson Dr 6 BR 4.5 BA Carefully crafted to follow principles 4264 Wilkie Way 5 BR 4.5 BA Newer home on lg lot. Upgraded to fill every need. 5 bedrooms with 3 suites. of Feng-Shui thoughout the enitire property gourmet kit, hardwood flrs & convenient upstairs laundry Judy Shen CalBRE #01272874 650.325.6161 Shelly Potvin CalBRE #01236885 650.941.7040 Gil Oraha CalBRE #01355157 650.325.6161

SAN MATEO COUNTY By appointment $3,888,000 LOS ALTOS Sat/Sun 1:30 - 4:30 $3,495,000 LOS ALTOS Sun 1:30 - 4:30 $2,689,000 www.222PortolaStateParkRoad.com 38 Acres with rustic 2BD,2BA and 516 Van Buren St 6 BR 3 BA Highly Desirable North Los Altos 1575 Grant Rd 2 BR 2 BA Enjoy your own sanctuary on over a half- 4 stall horse barn. Neighborhood w/an Exceptionally Large Lot! acre of lush land w/gated entrances Jan Strohecker CalBRE #00620365 650.325.6161 Jim & Katie Galli CalBRE #00944554, 01925901 650.941.7040 Terri Couture CalBRE #01090940 650.941.7040

CUPERTINO $1,888,000 MENLO PARK Sat/Sun 1 - 4 $1,788,000 MENLO PARK Sat/Sun 1:30 - 4:30 $1,499,000 22350 Palm Ave 2 BR 2 BA Fantastic opportunity to expand, remodel 3 Oliver Ct 2 BR 2.5 BA Exquisite +/-2680 sq.ft. TH with den in 1014 Windermere Ave 4 BR 2.5 BA Located in Menlo Park’s Flood or tear down & build your dream home. desirable Sharon Heights w/mountain views Park neighborhood, you’ll find this beautifully updated home Ron & Nasrin Delan CalBRE #01360743 650.941.7040 Fereshteh Khodadad CalBRE #00851932 650.325.6161 Colleen Cooley CalBRE #01269455 650.325.6161

SUNNYVALE Sat/Sun 1:30 - 4:30 $1,399,500 MOUNTAIN VIEW $999,000 MOUNTAIN VIEW Sat/Sun 1:30 - 4:30 $899,000 173 Leota Ave 4 BR 2 BA Large family room, New int./ext. paint, new 445 Bella Corte 3 BR 2.5 BA End unit TH, Lg master suite, skylights, 24 Comstock Queen Ct 4 BR 2.5 BA An ideal starter home, this roof & carpeting vaulted ceilings, french doors in Dining room updated townhouse is conveniently loc close to shops w/fwy. Enis Hall CalBRE #00560902 650.941.7040 Gordon Ferguson CalBRE #01038260 650.325.6161 Terrie Masuda CalBRE #00951976 650.941.7040

Los Altos | Palo Alto CaliforniaMoves.com |GFRSVGEP|GFQEVOIXMRK[IWX|GSPH[IPPFEROIV ©2015 Coldwell Banker Real Estate LLC. All Rights Reserved. Coldwell Banker® is a registered trademark licensed to Coldwell Banker Real Estate LLC. An Equal Opportunity Company. Equal Housing Opportunity. Each Coldwell Banker Residential Brokerage 3J½GI-W3[RIHF]E7YFWMHMEV]SJ26800'%PPVMKLXWVIWIVZIH8LMWMRJSVQEXMSR[EWWYTTPMIHF]7IPPIVERHSVSXLIVWSYVGIW&VSOIVFIPMIZIWXLMWMRJSVQEXMSRXSFIGSVVIGXFYXLEWRSXZIVM½IHXLMWMRJSVQEXMSRERHEWWYQIWRSPIKEPVIWTSRWMFMPMX]JSVMXWEGGYVEG] Buyers should investigate these issues to their own satisfaction. DRE License #01908304

40 Q Mountain View Voice Q MountainViewOnline.com Q June 12, 2015