DOCSLIB.ORG

Atlas Journal

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Atlas Journal Atlas of Genetics and Cytogenetics in Oncology and Haematology Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Atlas Journal Atlas Journal versus Atlas Database: the accumulation of the issues of the Journal constitutes the body of the Database/Text-Book. TABLE OF CONTENTS Volume 7, Number 2, Apr-Jun 2003 Previous Issue / Next Issue Genes AML1 (acute myeloid leukemia 1); CBFA2; RUNX1 (runt-related transcription factor 1 (acute myeloid leukemia 1; aml1 oncogene)) (21q22.3) - updated. Jean-Loup Huret, Sylvie Senon. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 163-170. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/AML1.html MAPK8 (mitogen-activated protein kinase 8) (10q11.21). Fei Chen. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 171-178. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/JNK1ID196.html MAPK9 (mitogen-activated protein kinase 9) (5q35). Fei Chen. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 179-184. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/JNK2ID426.html MAPK10 (mitogen-activated protein kinase 10) (4q21-q23). Fei Chen. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 185-190. [Full Text] [PDF] Atlas Genet Cytogenet Oncol Haematol 2003; 2 I URL : http://AtlasGeneticsOncology.org/Genes/JNK3ID427.html JUNB (19p13.2). Fei Chen. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 191-195. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/JUNBID178.html JUN-D proto-oncogene (19p13.1-p12). Fei Chen. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 196-200. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/JUNDID179.html JUN (V-Jun sarcoma virus 17 oncogene homolog (avian)) (1p32-p31). Fei Chen. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 201-206. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/JUNID151.html RECQL (12p12-p11). Mounira Amor-Guéret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 207-210. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/RECQLID283.html BCL9 (B-cell CLL/lymphoma 9) (1q21). Jean-Loup Huret, Sylvie Senon. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 211-213. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/BCL9ID466.html WFDC1 (WAP four-disulfide core domain 1) (16q24.1). Raphael Saffroy, Antoinette Lemoine, Brigitte Debuire. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 214-219. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/WFDC1ID424.html ELL (eleven nineteen lysin rich leukemia gene) (19p13.1) - updated. Jay L Hess. Atlas Genet Cytogenet Oncol Haematol 2003; 2 II Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 220-224. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/ELL.html Leukaemias t(7;9)(q34;q34). Jacques Boyer. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 225-228. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0709q34q34ID1055.html t(7;19)(q34;p13). Jacques Boyer. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 229-232. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0719q34p13ID1060.html 3q rearrangements in myeloid malignancies. Bruce Poppe, Nicole Dastugue, Frank Speleman. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 233-238. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/3qrearrmyeloID1125.html t(2;21)(p11;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 239-240. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0221p11q22ID1261.html t(4;21)(q31;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 241-242. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0421q31q22ID1262.html t(5;21)(q13;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 243-244. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0521q13q22ID1174.html Atlas Genet Cytogenet Oncol Haematol 2003; 2 III t(6;21)(p22;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 245-246. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0621p22q22ID1266.html t(8;21)(q24;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 247-248. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0821q24q22ID1263.html t(12;21)(q24;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 249-250. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t1221q24q22ID1268.html t(14;21)(q22;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 251-252. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t1421q22q22ID1269.html t(15;21)(q22;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 253-254. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t1521q22q22ID1270.html t(20;21)(q13;q22). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 255-256. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t2021q13q22ID1264.html Solid Tumours Bone: Adamantinoma. Hans Marten Hazelbag, Pancras CW Hogendoorn. Atlas Genet Cytogenet Oncol Haematol 2003; 2 IV Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 257-262. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Tumors/AdamantinID5154.html Neuroendocrine tumors: Phaeochromocytoma. Anne-Paule Gimenez-Roqueplo. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 263-270. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Tumors/pheochromocytomaID5026.html Soft tissue tumors: an overview. Paola Dal Cin. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 271-283. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Tumors/softissuTumID5042.html Cancer Prone Diseases Deep Insights Heterochromatin, from Chromosome to Protein. Marie-Geneviève Mattei and Judith Luciani. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 284-299. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Deep/HeterochromatineDEEP.html The WNT Signaling Pathway and Its Role in Human Solid Tumors. Lin Thorstensen, Ragnhild A. Lothe. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 300-331. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Deep/WNTSignPathID20042.html Case Reports Educational Items Transcription factors. Valentina Guasconi, Hakima Yahi, Slimane Ait-Si-Ali. Atlas Genet Cytogenet Oncol Haematol 2003; 7 (2): 332-336. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Educ/TFactorsEng.html © Atlas of Genetics and Cytogenetics in Oncology and Haematology Atlas Genet Cytogenet Oncol Haematol 2003; 2 V X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching For comments and suggestions or contributions, please contact us [email protected]. Atlas Genet Cytogenet Oncol Haematol 2003; 2 VI Atlas of Genetics and Cytogenetics in Oncology and Haematology AML1 (acute myeloid leukemia 1) (updated: old version not available) RUNX1 (runt-related transcription factor 1 (acute myeloid leukemia 1; aml1 oncogene)) CBFA2 (core binding factor A2) Identity Other PEBPaB (polyomavirus enhancer binding protein aB) names Hugo RUNX1 Location 21q22.3 AML1 (21q22.3) in normal cells: clone dJ1107L6 - Courtesy Mariano Rocchi, Resources for Molecular Cytogenetics. Laboratories willing to validate the probes are wellcome: contact M Rocchi DNA/RNA DNA Diagram Description the gene spans a region of more than 120 kb Transcription transcription is from telomere to centromere --> the fusion gene is located on the 'other' chromosome (eg the der(8) of the t(8;21), the der(3) of the t(3;21)...); alternate splicing --> transcripts of 2, 3.3, ->7.5 and 8 kb Protein Atlas Genet Cytogenet Oncol Haematol 2003; 2 -163- Protein Diagram Description 250, 453 amino acids and other forms; forms heterodimers with CBFB Expression widely expressed, including hematopoietic cells at various stages of differenciation: role in haematopoiesis Localisation nuclear Function transcription factor (activator) for various hematopoietic-specific genes: binds to the core site 5' PyGPyGGTPy 3' of a number of promotors and enhancers, as in GM-CSF (granulocyte-macrophage colony stimulating factor, CSF1R (colony stimulating factor 1 receptor), TCRb sites (T cell antigen receptors), and myeloid myeloperoxidase Homology 1- Runt (drosophila): nuclear DNA binding protein; role in segmentation (embryology); 2- AML2 (also called: CBFA3, CBFa3, PEBPaC), located in 1p35-36, expressed in B lineage (3 and 5 kb RNA); AML3: (also called: CBFA1, CBFa1, PEBPaA) in 6p21; 3- cbfa family (mouse) Implicated in Entity Familial platelet disorder with predisposition to acute non lymphocytic leukemia Entity t(1;21)(p36;q22) treatment related acute non lymphocytic leukemia (ANLL) --> ?/ AML1 Entity t(2;21)(p11;q22) ANLL --> ?/ AML1 Entity t(3;21)(q26;q22)/ myelodysplastic syndrome (MDS) or ANLL --> - EVI1 or EAP/ MDS1 - AML1 Disease CML-BC of myeloid type; ANLL and MDS, often therapy related (secondary to antitopoisomerase II) Hybrid/Mutated 5' AML1 - 3' EAP or MDS1 or EVI1 Gene Entity t(4;21)(q31;q22) T-cell acute lymphoblastic leukemia (T-ALL) --> ?/ AML1 Entity t(5;21)(q13;q22) myelodysplastic syndrome (MDS) and ANLL --> ?/ AML1 Atlas Genet Cytogenet Oncol Haematol 2003; 2 -164- Entity t(8;21)(q22;q22)/ANLL. --> ETO - AML1 Disease ANLL, M2 mostly Prognosis CR is obtained; median survival (1.5-2 yrs) is the range with other
Load more

Recommended publications
  • Genetic Analysis of Retinopathy in Type 1 Diabetes
    Genetic Analysis of Retinopathy in Type 1 Diabetes by Sayed Mohsen Hosseini A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Institute of Medical Science University of Toronto © Copyright by S. Mohsen Hosseini 2014 Genetic Analysis of Retinopathy in Type 1 Diabetes Sayed Mohsen Hosseini Doctor of Philosophy Institute of Medical Science University of Toronto 2014 Abstract Diabetic retinopathy (DR) is a leading cause of blindness worldwide. Several lines of evidence suggest a genetic contribution to the risk of DR; however, no genetic variant has shown convincing association with DR in genome-wide association studies (GWAS). To identify common polymorphisms associated with DR, meta-GWAS were performed in three type 1 diabetes cohorts of White subjects: Diabetes Complications and Control Trial (DCCT, n=1304), Wisconsin Epidemiologic Study of Diabetic Retinopathy (WESDR, n=603) and Renin-Angiotensin System Study (RASS, n=239). Severe (SDR) and mild (MDR) retinopathy outcomes were defined based on repeated fundus photographs in each study graded for retinopathy severity on the Early Treatment Diabetic Retinopathy Study (ETDRS) scale. Multivariable models accounted for glycemia (measured by A1C), diabetes duration and other relevant covariates in the association analyses of additive genotypes with SDR and MDR. Fixed-effects meta- analysis was used to combine the results of GWAS performed separately in WESDR, ii RASS and subgroups of DCCT, defined by cohort and treatment group. Top association signals were prioritized for replication, based on previous supporting knowledge from the literature, followed by replication in three independent white T1D studies: Genesis-GeneDiab (n=502), Steno (n=936) and FinnDiane (n=2194).
    [Show full text]
  • Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice
    Loyola University Chicago Loyola eCommons Biology: Faculty Publications and Other Works Faculty Publications 2013 Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice Mihaela Palicev Gunter P. Wagner James P. Noonan Benedikt Hallgrimsson James M. Cheverud Loyola University Chicago, [email protected] Follow this and additional works at: https://ecommons.luc.edu/biology_facpubs Part of the Biology Commons Recommended Citation Palicev, M, GP Wagner, JP Noonan, B Hallgrimsson, and JM Cheverud. "Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice." Genome Biology and Evolution 5(10), 2013. This Article is brought to you for free and open access by the Faculty Publications at Loyola eCommons. It has been accepted for inclusion in Biology: Faculty Publications and Other Works by an authorized administrator of Loyola eCommons. For more information, please contact [email protected]. This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 License. © Palicev et al., 2013. GBE Genomic Correlates of Relationship QTL Involved in Fore- versus Hind Limb Divergence in Mice Mihaela Pavlicev1,2,*, Gu¨ nter P. Wagner3, James P. Noonan4, Benedikt Hallgrı´msson5,and James M. Cheverud6 1Konrad Lorenz Institute for Evolution and Cognition Research, Altenberg, Austria 2Department of Pediatrics, Cincinnati Children‘s Hospital Medical Center, Cincinnati, Ohio 3Yale Systems Biology Institute and Department of Ecology and Evolutionary Biology, Yale University 4Department of Genetics, Yale University School of Medicine 5Department of Cell Biology and Anatomy, The McCaig Institute for Bone and Joint Health and the Alberta Children’s Hospital Research Institute for Child and Maternal Health, University of Calgary, Calgary, Canada 6Department of Anatomy and Neurobiology, Washington University *Corresponding author: E-mail: [email protected].
    [Show full text]
  • Transcriptome Analyses of Rhesus Monkey Pre-Implantation Embryos Reveal A
    Downloaded from genome.cshlp.org on September 23, 2021 - Published by Cold Spring Harbor Laboratory Press Transcriptome analyses of rhesus monkey pre-implantation embryos reveal a reduced capacity for DNA double strand break (DSB) repair in primate oocytes and early embryos Xinyi Wang 1,3,4,5*, Denghui Liu 2,4*, Dajian He 1,3,4,5, Shengbao Suo 2,4, Xian Xia 2,4, Xiechao He1,3,6, Jing-Dong J. Han2#, Ping Zheng1,3,6# Running title: reduced DNA DSB repair in monkey early embryos Affiliations: 1 State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, Yunnan 650223, China 2 Key Laboratory of Computational Biology, CAS Center for Excellence in Molecular Cell Science, Collaborative Innovation Center for Genetics and Developmental Biology, Chinese Academy of Sciences-Max Planck Partner Institute for Computational Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200031, China 3 Yunnan Key Laboratory of Animal Reproduction, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, Yunnan 650223, China 4 University of Chinese Academy of Sciences, Beijing, China 5 Kunming College of Life Science, University of Chinese Academy of Sciences, Kunming, Yunnan 650204, China 6 Primate Research Center, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, 650223, China * Xinyi Wang and Denghui Liu contributed equally to this work 1 Downloaded from genome.cshlp.org on September 23, 2021 - Published by Cold Spring Harbor Laboratory Press # Correspondence: Jing-Dong J. Han, Email: [email protected]; Ping Zheng, Email: [email protected] Key words: rhesus monkey, pre-implantation embryo, DNA damage 2 Downloaded from genome.cshlp.org on September 23, 2021 - Published by Cold Spring Harbor Laboratory Press ABSTRACT Pre-implantation embryogenesis encompasses several critical events including genome reprogramming, zygotic genome activation (ZGA) and cell fate commitment.
    [Show full text]
  • A Novel Computational Algorithm for Predicting Immune Cell Types Using Single-Cell RNA Sequencing Data
    A novel computational algorithm for predicting immune cell types using single-cell RNA sequencing data By Shuo Jia A hesis submitted to the Faculty of Graduate Studies of The University of Manitoba n partial fulfillment of the requirements of the degree of MASTER OF SCIENCE Department of Biochemistry and Medical Genetics University of Manitoba Winnipeg, Manitoba, Canada Copyright © 2020 by Shuo Jia Abstract Background: Cells from our immune system detect and kill pathogens to protect our body against many diseases. However, current methods for determining cell types have some major limitations, such as being time-consuming and with low throughput rate, etc. These problems stack up and hinder the deep exploration of cellular heterogeneity. Immune cells that are associated with cancer tissues play a critical role in revealing the stages of tumor development. Identifying the immune composition within tumor microenvironments in a timely manner will be helpful to improve clinical prognosis and therapeutic management for cancer. Single-cell RNA sequencing (scRNA-seq), an RNA sequencing (RNA-seq) technique that focuses on a single cell level, has provided us with the ability to conduct cell type classification. Although unsupervised clustering approaches are the major methods for analyzing scRNA-seq datasets, their results vary among studies with different input parameters and sizes. However, in supervised machine learning methods, information loss and low prediction accuracy are the key limitations. Methods and Results: Genes in the human genome align to chromosomes in a particular order. Hence, we hypothesize incorporating this information into our model will potentially improve the cell type classification performance. In order to utilize gene positional information, we introduce chromosome-based neural network, namely ChrNet, a novel chromosome-specific re-trainable supervised learning method based on a one-dimensional 1 convolutional neural network (1D-CNN).
    [Show full text]
  • 4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation
    Methods Mice: 4-6 weeks old female C57BL/6 mice obtained from Jackson labs were used for cell isolation. Female Foxp3-IRES-GFP reporter mice (1), backcrossed to B6/C57 background for 10 generations, were used for the isolation of naïve CD4 and naïve CD8 cells for the RNAseq experiments. The mice were housed in pathogen-free animal facility in the La Jolla Institute for Allergy and Immunology and were used according to protocols approved by the Institutional Animal Care and use Committee. Preparation of cells: Subsets of thymocytes were isolated by cell sorting as previously described (2), after cell surface staining using CD4 (GK1.5), CD8 (53-6.7), CD3ε (145- 2C11), CD24 (M1/69) (all from Biolegend). DP cells: CD4+CD8 int/hi; CD4 SP cells: CD4CD3 hi, CD24 int/lo; CD8 SP cells: CD8 int/hi CD4 CD3 hi, CD24 int/lo (Fig S2). Peripheral subsets were isolated after pooling spleen and lymph nodes. T cells were enriched by negative isolation using Dynabeads (Dynabeads untouched mouse T cells, 11413D, Invitrogen). After surface staining for CD4 (GK1.5), CD8 (53-6.7), CD62L (MEL-14), CD25 (PC61) and CD44 (IM7), naïve CD4+CD62L hiCD25-CD44lo and naïve CD8+CD62L hiCD25-CD44lo were obtained by sorting (BD FACS Aria). Additionally, for the RNAseq experiments, CD4 and CD8 naïve cells were isolated by sorting T cells from the Foxp3- IRES-GFP mice: CD4+CD62LhiCD25–CD44lo GFP(FOXP3)– and CD8+CD62LhiCD25– CD44lo GFP(FOXP3)– (antibodies were from Biolegend). In some cases, naïve CD4 cells were cultured in vitro under Th1 or Th2 polarizing conditions (3, 4).
    [Show full text]
  • S41467-020-18249-3.Pdf
    ARTICLE https://doi.org/10.1038/s41467-020-18249-3 OPEN Pharmacologically reversible zonation-dependent endothelial cell transcriptomic changes with neurodegenerative disease associations in the aged brain Lei Zhao1,2,17, Zhongqi Li 1,2,17, Joaquim S. L. Vong2,3,17, Xinyi Chen1,2, Hei-Ming Lai1,2,4,5,6, Leo Y. C. Yan1,2, Junzhe Huang1,2, Samuel K. H. Sy1,2,7, Xiaoyu Tian 8, Yu Huang 8, Ho Yin Edwin Chan5,9, Hon-Cheong So6,8, ✉ ✉ Wai-Lung Ng 10, Yamei Tang11, Wei-Jye Lin12,13, Vincent C. T. Mok1,5,6,14,15 &HoKo 1,2,4,5,6,8,14,16 1234567890():,; The molecular signatures of cells in the brain have been revealed in unprecedented detail, yet the ageing-associated genome-wide expression changes that may contribute to neurovas- cular dysfunction in neurodegenerative diseases remain elusive. Here, we report zonation- dependent transcriptomic changes in aged mouse brain endothelial cells (ECs), which pro- minently implicate altered immune/cytokine signaling in ECs of all vascular segments, and functional changes impacting the blood–brain barrier (BBB) and glucose/energy metabolism especially in capillary ECs (capECs). An overrepresentation of Alzheimer disease (AD) GWAS genes is evident among the human orthologs of the differentially expressed genes of aged capECs, while comparative analysis revealed a subset of concordantly downregulated, functionally important genes in human AD brains. Treatment with exenatide, a glucagon-like peptide-1 receptor agonist, strongly reverses aged mouse brain EC transcriptomic changes and BBB leakage, with associated attenuation of microglial priming. We thus revealed tran- scriptomic alterations underlying brain EC ageing that are complex yet pharmacologically reversible.
    [Show full text]
  • Análise Integrativa De Perfis Transcricionais De Pacientes Com
    UNIVERSIDADE DE SÃO PAULO FACULDADE DE MEDICINA DE RIBEIRÃO PRETO PROGRAMA DE PÓS-GRADUAÇÃO EM GENÉTICA ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas Ribeirão Preto – 2012 ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas Tese apresentada à Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo para obtenção do título de Doutor em Ciências. Área de Concentração: Genética Orientador: Prof. Dr. Eduardo Antonio Donadi Co-orientador: Prof. Dr. Geraldo A. S. Passos Ribeirão Preto – 2012 AUTORIZO A REPRODUÇÃO E DIVULGAÇÃO TOTAL OU PARCIAL DESTE TRABALHO, POR QUALQUER MEIO CONVENCIONAL OU ELETRÔNICO, PARA FINS DE ESTUDO E PESQUISA, DESDE QUE CITADA A FONTE. FICHA CATALOGRÁFICA Evangelista, Adriane Feijó Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas. Ribeirão Preto, 2012 192p. Tese de Doutorado apresentada à Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo. Área de Concentração: Genética. Orientador: Donadi, Eduardo Antonio Co-orientador: Passos, Geraldo A. 1. Expressão gênica – microarrays 2. Análise bioinformática por module maps 3. Diabetes mellitus tipo 1 4. Diabetes mellitus tipo 2 5. Diabetes mellitus gestacional FOLHA DE APROVAÇÃO ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas.
    [Show full text]
  • System, Method and Software for Calculation of a Cannabis Drug Efficiency Index for the Reduction of Inflammation
    International Journal of Molecular Sciences Article System, Method and Software for Calculation of a Cannabis Drug Efficiency Index for the Reduction of Inflammation Nicolas Borisov 1,† , Yaroslav Ilnytskyy 2,3,†, Boseon Byeon 2,3,4,†, Olga Kovalchuk 2,3 and Igor Kovalchuk 2,3,* 1 Moscow Institute of Physics and Technology, 9 Institutsky lane, Dolgoprudny, Moscow Region 141701, Russia; [email protected] 2 Department of Biological Sciences, University of Lethbridge, Lethbridge, AB T1K 3M4, Canada; [email protected] (Y.I.); [email protected] (B.B.); [email protected] (O.K.) 3 Pathway Rx., 16 Sandstone Rd. S., Lethbridge, AB T1K 7X8, Canada 4 Biomedical and Health Informatics, Computer Science Department, State University of New York, 2 S Clinton St, Syracuse, NY 13202, USA * Correspondence: [email protected] † First three authors contributed equally to this research. Abstract: There are many varieties of Cannabis sativa that differ from each other by composition of cannabinoids, terpenes and other molecules. The medicinal properties of these cultivars are often very different, with some being more efficient than others. This report describes the development of a method and software for the analysis of the efficiency of various cannabis extracts to detect the anti-inflammatory properties of the various cannabis extracts. The method uses high-throughput gene expression profiling data but can potentially use other omics data as well. According to the signaling pathway topology, the gene expression profiles are convoluted into the signaling pathway activities using a signaling pathway impact analysis (SPIA) method. The method was tested by inducing inflammation in human 3D epithelial tissues, including intestine, oral and skin, and then exposing these tissues to various extracts and then performing transcriptome analysis.
    [Show full text]
  • (P -Value<0.05, Fold Change≥1.4), 4 Vs. 0 Gy Irradiation
    Table S1: Significant differentially expressed genes (P -Value<0.05, Fold Change≥1.4), 4 vs. 0 Gy irradiation Genbank Fold Change P -Value Gene Symbol Description Accession Q9F8M7_CARHY (Q9F8M7) DTDP-glucose 4,6-dehydratase (Fragment), partial (9%) 6.70 0.017399678 THC2699065 [THC2719287] 5.53 0.003379195 BC013657 BC013657 Homo sapiens cDNA clone IMAGE:4152983, partial cds. [BC013657] 5.10 0.024641735 THC2750781 Ciliary dynein heavy chain 5 (Axonemal beta dynein heavy chain 5) (HL1). 4.07 0.04353262 DNAH5 [Source:Uniprot/SWISSPROT;Acc:Q8TE73] [ENST00000382416] 3.81 0.002855909 NM_145263 SPATA18 Homo sapiens spermatogenesis associated 18 homolog (rat) (SPATA18), mRNA [NM_145263] AA418814 zw01a02.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:767978 3', 3.69 0.03203913 AA418814 AA418814 mRNA sequence [AA418814] AL356953 leucine-rich repeat-containing G protein-coupled receptor 6 {Homo sapiens} (exp=0; 3.63 0.0277936 THC2705989 wgp=1; cg=0), partial (4%) [THC2752981] AA484677 ne64a07.s1 NCI_CGAP_Alv1 Homo sapiens cDNA clone IMAGE:909012, mRNA 3.63 0.027098073 AA484677 AA484677 sequence [AA484677] oe06h09.s1 NCI_CGAP_Ov2 Homo sapiens cDNA clone IMAGE:1385153, mRNA sequence 3.48 0.04468495 AA837799 AA837799 [AA837799] Homo sapiens hypothetical protein LOC340109, mRNA (cDNA clone IMAGE:5578073), partial 3.27 0.031178378 BC039509 LOC643401 cds. [BC039509] Homo sapiens Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, mRNA 3.24 0.022156298 NM_000043 FAS [NM_000043] 3.20 0.021043295 A_32_P125056 BF803942 CM2-CI0135-021100-477-g08 CI0135 Homo sapiens cDNA, mRNA sequence 3.04 0.043389246 BF803942 BF803942 [BF803942] 3.03 0.002430239 NM_015920 RPS27L Homo sapiens ribosomal protein S27-like (RPS27L), mRNA [NM_015920] Homo sapiens tumor necrosis factor receptor superfamily, member 10c, decoy without an 2.98 0.021202829 NM_003841 TNFRSF10C intracellular domain (TNFRSF10C), mRNA [NM_003841] 2.97 0.03243901 AB002384 C6orf32 Homo sapiens mRNA for KIAA0386 gene, partial cds.
    [Show full text]
  • Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-VPS25 monoclonal antibody, clone T3 (DCABH-13967) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]). Immunogen VPS25 (AAH06282.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone T3 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA Sequence Similarities MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNN VKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFT LYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Size 1 ea Buffer In ascites fluid Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ] 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Official Symbol VPS25 Synonyms VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae);
    [Show full text]
  • WFDC1 (NM 021197) Human Recombinant Protein Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TP306450 WFDC1 (NM_021197) Human Recombinant Protein Product data: Product Type: Recombinant Proteins Description: Purified recombinant protein of Homo sapiens WAP four-disulfide core domain 1 (WFDC1) Species: Human Expression Host: HEK293T Tag: C-Myc/DDK Predicted MW: 20.6 kDa Concentration: >50 ug/mL as determined by microplate BCA method Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. Storage: Store at -80°C. Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. RefSeq: NP_067020 Locus ID: 58189 UniProt ID: Q9HC57 RefSeq Size: 1396 Cytogenetics: 16q24.1 RefSeq ORF: 660 Synonyms: PS20 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 WFDC1 (NM_021197) Human Recombinant Protein – TP306450 Summary: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP- type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor.
    [Show full text]
  • (KPNA2) and Its Potential Novel Cargo Proteins in Nonsmall Cell Lung Cancer *□S
    Research © 2012 by The American Society for Biochemistry and Molecular Biology, Inc. This paper is available on line at http://www.mcponline.org Quantitative Proteomics Reveals Regulation of Karyopherin Subunit Alpha-2 (KPNA2) and Its Potential Novel Cargo Proteins in Nonsmall Cell Lung Cancer *□S Chun-I Wang‡‡‡, Kun-Yi Chien‡¶, Chih-Liang Wangʈ, Hao-Ping Liu¶, Chia-Chen Cheng§, Yu-Sun Chang‡¶, Jau-Song Yu‡§¶, and Chia-Jung Yu‡§¶**‡‡ The process of nucleocytoplasmic shuttling is mediated cancer. Molecular & Cellular Proteomics 11: 10.1074/ by karyopherins. Dysregulated expression of karyo- mcp.M111.016592, 1105–1122, 2012. pherins may trigger oncogenesis through aberrant distri- bution of cargo proteins. Karyopherin subunit alpha-2 (KPNA2) was previously identified as a potential bio- Transportation of proteins and RNAs into (import) and out of marker for nonsmall cell lung cancer by integration of the (export) the nucleus occurs through the nuclear pore complex cancer cell secretome and tissue transcriptome data sets. and is a vital event in eukaryotic cells. Nucleocytoplasmic Knockdown of KPNA2 suppressed the proliferation and shuttling of the large complex (Ͼ40 kDa) is mediated by an migration abilities of lung cancer cells. However, the pre- evolutionarily conserved family of transport factors, desig- cise molecular mechanisms underlying KPNA2 activity in cancer remain to be established. In the current study, we nated karyopherins (1). The family of karyopherins, including applied gene knockdown, subcellular fractionation, and importins and exportins, share limited sequence identity (15– stable isotope labeling by amino acids in cell culture- 25%) but adopt similar conformations. In human cells, at least based quantitative proteomic strategies to systematically 22 importin ␤ and 6 importin ␣ proteins have been identified to analyze the KPNA2-regulating protein profiles in an ade- date (2, 3).
    [Show full text]