DOCSLIB.ORG

LDB3 Monoclonal Antibody (M06), Gene Alias: CYPHER, FLJ35865, KIAA01613, Clone 3C8 KIAA0613, ORACLE, PDLIM6, ZASP, Ldb3z1, Ldb3z4

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
LDB3 Monoclonal Antibody (M06), Gene Alias: CYPHER, FLJ35865, KIAA01613, Clone 3C8 KIAA0613, ORACLE, PDLIM6, ZASP, Ldb3z1, Ldb3z4 LDB3 monoclonal antibody (M06), Gene Alias: CYPHER, FLJ35865, KIAA01613, clone 3C8 KIAA0613, ORACLE, PDLIM6, ZASP, ldb3z1, ldb3z4 Gene Summary: This gene encodes a PDZ Catalog Number: H00011155-M06 domain-containing protein. PDZ motifs are modular Regulatory Status: For research use only (RUO) protein-protein interaction domains consisting of 80-120 amino acid residues. PDZ domain-containing proteins Product Description: Mouse monoclonal antibody interact with each other in cytoskeletal assembly or with raised against a full-length recombinant LDB3. other proteins involved in targeting and clustering of membrane proteins. The protein encoded by this gene Clone Name: 3C8 interacts with alpha-actinin-2 through its N-terminal PDZ domain and with protein kinase C via its C-terminal LIM Immunogen: LDB3 (AAH10929, 1 a.a. ~ 283 a.a) domains. The LIM domain is a cysteine-rich motif full-length recombinant protein with GST tag. MW of the defined by 50-60 amino acids containing two GST tag alone is 26 KDa. zinc-binding modules. This protein also interacts with all three members of the myozenin family. Mutations in this Sequence: gene have been associated with myofibrillar myopathy MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSK and dilated cardiomyopathy. Alternatively spliced AAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASY transcript variants encoding different isoforms have been NLSLTLQKSKRPIPISTTAPPVQTPLPVIPHQKVVVNSP identified; all isoforms have N-terminal PDZ domains ANADYQERFNPSALKDSALSTHKPIEVKGLGGKATIIHA while only longer isoforms (1 and 2) have C-terminal LIM QYNTPISMYSQDAIMDAIAGQAQAQGSDFSGSLPIKDL domains. [provided by RefSeq] AVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQSR SFRILAQMTGTEFMQDPDEEALRRSRERFETERNSPR References: FAKLRNWHHGLSAQILNVKS 1. Z-disc-associated, Alternatively Spliced, PDZ Motif-containing Protein (ZASP) Mutations in the Host: Mouse Actin-binding Domain Cause Disruption of Skeletal Muscle Actin Filaments in Myofibrillar Myopathy. Lin X, Reactivity: Human Ruiz J, Bajraktari I, Ohman R, Banerjee S, Gribble K, Applications: ELISA, IF, RNAi-Ab, S-ELISA, WB-Ce, Kaufman JD, Wingfield PT, Griggs RC, Fischbeck KH, WB-Re, WB-Tr Mankodi A J Biol Chem. 2014 May 9;289(19):13615-26. (See our web site product page for detailed applications doi: 10.1074/jbc.M114.550418. Epub 2014 Mar 25. information) 2. Impaired binding of ZASP/Cypher with phosphoglucomutase 1 is associated with dilated Protocols: See our web site at cardiomyopathy. Arimura T, Inagaki N, Hayashi T, Shichi http://www.abnova.com/support/protocols.asp or product D, Sato A, Hinohara K, Vatta M, Towbin JA, Chikamori page for detailed protocols T, Yamashina A, Kimura A. Cardiovasc Res. 2009 Jul 1;83(1):80-8. Epub 2009 Apr 17. Isotype: IgG2b Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 11155 Gene Symbol: LDB3 Page 1/1 Powered by TCPDF (www.tcpdf.org).
Load more

Recommended publications
  • Targeted Genes and Methodology Details for Neuromuscular Genetic Panels
    Targeted Genes and Methodology Details for Neuromuscular Genetic Panels Reference transcripts based on build GRCh37 (hg19) interrogated by Neuromuscular Genetic Panels Next-generation sequencing (NGS) and/or Sanger sequencing is performed Motor Neuron Disease Panel to test for the presence of a mutation in these genes. Gene GenBank Accession Number Regions of homology, high GC-rich content, and repetitive sequences may ALS2 NM_020919 not provide accurate sequence. Therefore, all reported alterations detected ANG NM_001145 by NGS are confirmed by an independent reference method based on laboratory developed criteria. However, this does not rule out the possibility CHMP2B NM_014043 of a false-negative result in these regions. ERBB4 NM_005235 Sanger sequencing is used to confirm alterations detected by NGS when FIG4 NM_014845 appropriate.(Unpublished Mayo method) FUS NM_004960 HNRNPA1 NM_031157 OPTN NM_021980 PFN1 NM_005022 SETX NM_015046 SIGMAR1 NM_005866 SOD1 NM_000454 SQSTM1 NM_003900 TARDBP NM_007375 UBQLN2 NM_013444 VAPB NM_004738 VCP NM_007126 ©2018 Mayo Foundation for Medical Education and Research Page 1 of 14 MC4091-83rev1018 Muscular Dystrophy Panel Muscular Dystrophy Panel Gene GenBank Accession Number Gene GenBank Accession Number ACTA1 NM_001100 LMNA NM_170707 ANO5 NM_213599 LPIN1 NM_145693 B3GALNT2 NM_152490 MATR3 NM_199189 B4GAT1 NM_006876 MYH2 NM_017534 BAG3 NM_004281 MYH7 NM_000257 BIN1 NM_139343 MYOT NM_006790 BVES NM_007073 NEB NM_004543 CAPN3 NM_000070 PLEC NM_000445 CAV3 NM_033337 POMGNT1 NM_017739 CAVIN1 NM_012232 POMGNT2
    [Show full text]
  • The Role of Z-Disc Proteins in Myopathy and Cardiomyopathy
    International Journal of Molecular Sciences Review The Role of Z-disc Proteins in Myopathy and Cardiomyopathy Kirsty Wadmore 1,†, Amar J. Azad 1,† and Katja Gehmlich 1,2,* 1 Institute of Cardiovascular Sciences, College of Medical and Dental Sciences, University of Birmingham, Birmingham B15 2TT, UK; [email protected] (K.W.); [email protected] (A.J.A.) 2 Division of Cardiovascular Medicine, Radcliffe Department of Medicine and British Heart Foundation Centre of Research Excellence Oxford, University of Oxford, Oxford OX3 9DU, UK * Correspondence: [email protected]; Tel.: +44-121-414-8259 † These authors contributed equally. Abstract: The Z-disc acts as a protein-rich structure to tether thin filament in the contractile units, the sarcomeres, of striated muscle cells. Proteins found in the Z-disc are integral for maintaining the architecture of the sarcomere. They also enable it to function as a (bio-mechanical) signalling hub. Numerous proteins interact in the Z-disc to facilitate force transduction and intracellular signalling in both cardiac and skeletal muscle. This review will focus on six key Z-disc proteins: α-actinin 2, filamin C, myopalladin, myotilin, telethonin and Z-disc alternatively spliced PDZ-motif (ZASP), which have all been linked to myopathies and cardiomyopathies. We will summarise pathogenic variants identified in the six genes coding for these proteins and look at their involvement in myopathy and cardiomyopathy. Listing the Minor Allele Frequency (MAF) of these variants in the Genome Aggregation Database (GnomAD) version 3.1 will help to critically re-evaluate pathogenicity based on variant frequency in normal population cohorts.
    [Show full text]
  • The N-Cadherin Interactome in Primary Cardiomyocytes As Defined Using Quantitative Proximity Proteomics Yang Li1,*, Chelsea D
    © 2019. Published by The Company of Biologists Ltd | Journal of Cell Science (2019) 132, jcs221606. doi:10.1242/jcs.221606 TOOLS AND RESOURCES The N-cadherin interactome in primary cardiomyocytes as defined using quantitative proximity proteomics Yang Li1,*, Chelsea D. Merkel1,*, Xuemei Zeng2, Jonathon A. Heier1, Pamela S. Cantrell2, Mai Sun2, Donna B. Stolz1, Simon C. Watkins1, Nathan A. Yates1,2,3 and Adam V. Kwiatkowski1,‡ ABSTRACT requires multiple adhesion, cytoskeletal and signaling proteins, The junctional complexes that couple cardiomyocytes must transmit and mutations in these proteins can cause cardiomyopathies (Ehler, the mechanical forces of contraction while maintaining adhesive 2018). However, the molecular composition of ICD junctional homeostasis. The adherens junction (AJ) connects the actomyosin complexes remains poorly defined. – networks of neighboring cardiomyocytes and is required for proper The core of the AJ is the cadherin catenin complex (Halbleib and heart function. Yet little is known about the molecular composition of the Nelson, 2006; Ratheesh and Yap, 2012). Classical cadherins are cardiomyocyte AJ or how it is organized to function under mechanical single-pass transmembrane proteins with an extracellular domain that load. Here, we define the architecture, dynamics and proteome of mediates calcium-dependent homotypic interactions. The adhesive the cardiomyocyte AJ. Mouse neonatal cardiomyocytes assemble properties of classical cadherins are driven by the recruitment of stable AJs along intercellular contacts with organizational and cytosolic catenin proteins to the cadherin tail, with p120-catenin β structural hallmarks similar to mature contacts. We combine (CTNND1) binding to the juxta-membrane domain and -catenin β quantitative mass spectrometry with proximity labeling to identify the (CTNNB1) binding to the distal part of the tail.
    [Show full text]
  • Gen LDB3 Y Mutaciones Dr
    Gen LDB3 y mutaciones Dr. Andrés R. Pérez Riera La mutación encontrada en el gen LDB3 está asociada a cardiomiopatía hipertrófica, dilatada, no compactada y miopatía miofibrilar y que muy probablemente nada tiene a ver con el fenotipo encontrado "overlappying Brugada syndrome/ARVC/D. Este gen LDB3 que Ramón Brugada ha encontrado tiene por tarea proporciona instrucciones para crear una proteína llamada enlace de dominio LIM 3 (LDB3). La proteína LDB3 se encuentra en el miocardio y en el músculo esquelético. Las proteínas LDB3 se encuentran dentro del sarcómero (unidad funcional de la contraccion y relajación del músculo cardiaco). Esta proteína se une a otras proteínas participando del mantenimiento de la estabilidad de los discos Z que forman el limite de la unidad contráctil. Los discos Z unen a los sarcómeros vecinos para formar miofibrilas de actina (finas) y de miosina (gruesas), interdigitadas forman la unidad básica de las fibras musculares. La unión de los sarcómeros y la formación de miofibrillas proporcionan la fuerza de contracción y relajación muscular mecanismo conocido como translapación y destraslapación. Varias versiones diferentes (isoformas) de la proteína LDB3 se producen a partir del gen LDB3. Mutaciones em este gen causan las 4 entidades mencionadas (cardiomiopatía hipertrófica, dilatada, no compactada y miopatía miofibrilar), y la ubicación citogenética de este gen se encuentra en el brazo largo del cromossoma 10 (10q23.2) en la posición 23.2. El gen LBD3 há recebido várias otras denominaciones: LDB3Z1, ZASP, LDBEZ4, y LDB3Z4. El tema es tan nuevo que hasta la fecha apenas se han publicado 40 artículos em el Pubmed acerca de este gen (Casi todos em 2016, 2017 y 2018.
    [Show full text]
  • WMC-79, a Potent Agent Against Colon Cancers, Induces Apoptosis Through a P53-Dependent Pathway
    1617 WMC-79, a potent agent against colon cancers, induces apoptosis through a p53-dependent pathway Teresa Kosakowska-Cholody,1 Introduction 1 2 W. Marek Cholody, Anne Monks, The bisimidazoacridones are bifunctional antitumor Barbara A. Woynarowska,3 agents with strong selectivity against colon cancers (1, 2). and Christopher J. Michejda1 Recent studies of the effect of bisimidazoacridones on sensitive colon tumors cells revealed that these com- 1 Molecular Aspects of Drug Design, Structural Biophysics pounds act as cytostatic agents that completely arrest cell Laboratory, Center for Cancer Research; 2Screening Technologies Branch, Laboratory of Functional Genomics, Science Applications growth at G1 and G2-M check points but do not trigger International Corporation, National Cancer Institute at Frederick, cell death even at high concentrations (10 Amol/L; ref. 3). Frederick, Maryland; and 3Department of Radiation Oncology, The chemical structure of bisimidazoacridones is symmet- University of Texas Health Science Center, San Antonio, Texas rical in that it consists of two imidazoacridone moieties held together by linkers of various lengths and rigidities. Abstract We recently reported on the synthesis of unsymmetrical variants of the original bisimidazoacridones (4). WMC-79 WMC-79 is a synthetic agent with potent activity (Fig. 1), a compound consisting of an imidazoacridone against colon and hematopoietic tumors. In vitro, the moiety linked to a 3-nitronaphthalimide moiety via agent is most potent against colon cancer cells that 1,4-bispropenopiperazine linker, was found to be a potent carry the wild-type p53 tumor suppressor gene (HCT- but selective cytotoxic agent in a variety of tumor cell f 116 and RKO cells: GI50 <1 nmol/L, LC50 40 nmol/L).
    [Show full text]
  • Current Understanding of the Role of Cytoskeletal Cross-Linkers in the Onset and Development of Cardiomyopathies
    International Journal of Molecular Sciences Review Current Understanding of the Role of Cytoskeletal Cross-Linkers in the Onset and Development of Cardiomyopathies Ilaria Pecorari 1, Luisa Mestroni 2 and Orfeo Sbaizero 1,* 1 Department of Engineering and Architecture, University of Trieste, 34127 Trieste, Italy; [email protected] 2 University of Colorado Cardiovascular Institute, University of Colorado Anschutz Medical Campus, Aurora, CO 80045, USA; [email protected] * Correspondence: [email protected]; Tel.: +39-040-5583770 Received: 15 July 2020; Accepted: 10 August 2020; Published: 15 August 2020 Abstract: Cardiomyopathies affect individuals worldwide, without regard to age, sex and ethnicity and are associated with significant morbidity and mortality. Inherited cardiomyopathies account for a relevant part of these conditions. Although progresses have been made over the years, early diagnosis and curative therapies are still challenging. Understanding the events occurring in normal and diseased cardiac cells is crucial, as they are important determinants of overall heart function. Besides chemical and molecular events, there are also structural and mechanical phenomena that require to be investigated. Cell structure and mechanics largely depend from the cytoskeleton, which is composed by filamentous proteins that can be cross-linked via accessory proteins. Alpha-actinin 2 (ACTN2), filamin C (FLNC) and dystrophin are three major actin cross-linkers that extensively contribute to the regulation of cell structure and mechanics. Hereby, we review the current understanding of the roles played by ACTN2, FLNC and dystrophin in the onset and progress of inherited cardiomyopathies. With our work, we aim to set the stage for new approaches to study the cardiomyopathies, which might reveal new therapeutic targets and broaden the panel of genes to be screened.
    [Show full text]
  • Selective Silencing of Mutated Mrnas in DM1 by Using Modified Hu7
    Selective silencing of mutated mRNAs in DM1 by using modified hU7-snRNAs Arnaud Klein, Virginie François, Cyriaque Beley, Arnaud Jollet, Camille Lemercier, Luis Garcia, Denis Furling To cite this version: Arnaud Klein, Virginie François, Cyriaque Beley, Arnaud Jollet, Camille Lemercier, et al.. Selective silencing of mutated mRNAs in DM1 by using modified hU7-snRNAs. Nature Structural and Molec- ular Biology, Nature Publishing Group, 2011, 18 (1), pp.85-87. 10.1038/nsmb.1958. hal-03002664 HAL Id: hal-03002664 https://hal.archives-ouvertes.fr/hal-03002664 Submitted on 12 Nov 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Selective silencing of mutated mRNAs in DM1 by using modified hU7-snRNAs Virginie Francois1-4*, Arnaud F. Klein1-4*, Cyriaque Beley1-4, Arnaud Jollet1-4, Camille Lemercier1-4, Luis Garcia1-4§ & Denis Furling1-4§ 1- Université Pierre et Marie Curie-Paris6, Um76, Paris, F-75013, France 2- CNRS, Umr7215, Paris, F-75013, France 3- INSERM, U974, Paris, F-75013, France 4- Institut de Myologie, Paris, F-75013, France *Both authors should be considered as co-first authors Correspondence should be addressed to D.F. ([email protected]) Accepted version of the manuscript published in: Nat Struct Mol Biol .
    [Show full text]
  • Inhibiting the Integrated Stress Response Pathway Prevents
    RESEARCH ARTICLE Inhibiting the integrated stress response pathway prevents aberrant chondrocyte differentiation thereby alleviating chondrodysplasia Cheng Wang1†, Zhijia Tan1†, Ben Niu1, Kwok Yeung Tsang1, Andrew Tai1, Wilson C W Chan1, Rebecca L K Lo1, Keith K H Leung1, Nelson W F Dung1, Nobuyuki Itoh2, Michael Q Zhang3,4, Danny Chan1, Kathryn Song Eng Cheah1* 1School of Biomedical Sciences, University of Hong Kong, Hong Kong, China; 2Graduate School of Pharmaceutical Sciences, University of Kyoto, Kyoto, Japan; 3Department of Biological Sciences, Center for Systems Biology, The University of Texas at Dallas, Richardson, United States; 4MOE Key Laboratory of Bioinformatics, Center for Synthetic and Systems Biology, Tsinghua University, Beijing, China Abstract The integrated stress response (ISR) is activated by diverse forms of cellular stress, including endoplasmic reticulum (ER) stress, and is associated with diseases. However, the molecular mechanism(s) whereby the ISR impacts on differentiation is incompletely understood. Here, we exploited a mouse model of Metaphyseal Chondrodysplasia type Schmid (MCDS) to provide insight into the impact of the ISR on cell fate. We show the protein kinase RNA-like ER kinase (PERK) pathway that mediates preferential synthesis of ATF4 and CHOP, dominates in causing dysplasia by reverting chondrocyte differentiation via ATF4-directed transactivation of Sox9. Chondrocyte survival is enabled, cell autonomously, by CHOP and dual CHOP-ATF4 *For correspondence: transactivation of Fgf21. Treatment of mutant mice with a chemical inhibitor of PERK signaling [email protected] prevents the differentiation defects and ameliorates chondrodysplasia. By preventing aberrant †These authors contributed differentiation, titrated inhibition of the ISR emerges as a rationale therapeutic strategy for stress- equally to this work induced skeletal disorders.
    [Show full text]
  • Retinoid X Receptor Agonists Increase Bcl2a1 Expression and Decrease Apoptosis of Naive T Lymphocytes1
    The Journal of Immunology Retinoid X Receptor Agonists Increase Bcl2a1 Expression and Decrease Apoptosis of Naive T Lymphocytes1 Reuven Rasooly,* Gertrud U. Schuster,* Jeffrey P. Gregg,† Jia-Hao Xiao,‡ Roshantha A. S. Chandraratna,‡ and Charles B. Stephensen2* Vitamin A affects many aspects of T lymphocyte development and function. The vitamin A metabolites all-trans- and 9-cis-retinoic acid regulate gene expression by binding to the retinoic acid receptor (RAR), while 9-cis-retinoic acid also binds to the retinoid X receptor (RXR). Naive DO11.10 T lymphocytes expressed mRNA and protein for RAR-␣, RXR-␣, and RXR-␤. DNA microar- ray analysis was used to identify RXR-responsive genes in naive DO11.10 T lymphocytes treated with the RXR agonist AGN194204. A total of 128 genes was differentially expressed, including 16 (15%) involved in cell growth or apoptosis. Among these was Bcl2a1, an antiapoptotic Bcl2 family member. Quantitative real-time PCR analysis confirmed this finding and demon- strated that Bcl2a1 mRNA expression was significantly greater in nonapoptotic than in apoptotic T lymphocytes. The RXR agonist 9-cis-retinoic acid also increased Bcl2a1 expression, although all-trans-retinoic acid and ligands for other RXR partner receptors did not. Treatment with AGN194204 and 9-cis-retinoic acid significantly decreased apoptosis measured by annexin V staining but did not affect expression of Bcl2 and Bcl-xL. Bcl2a1 promoter activity was examined using a luciferase promoter construct. Both AGN194204 and 9-cis-retinoic acid significantly increased luciferase activity. In summary, these data demonstrate that RXR agonists increase Bcl2a1 promoter activity and increase expression of Bcl2a1 in naive T lymphocytes but do not affect Bcl2 and Bcl-xL expression in naive T lymphocytes.
    [Show full text]
  • Elucidating the Unknown Role of Cyclin Dependent Kinase 5 in Cardiac Pathophysiological
    Elucidating the Unknown Role of Cyclin Dependent Kinase 5 in Cardiac Pathophysiological Conditions Danielle Aina-Badejo Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy under the Executive Committee of the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2021 © 2021 Danielle Aina-Badejo All Rights Reserved Abstract Elucidating the Unknown Role of Cyclin Dependent Kinase 5 in Cardiac Pathophysiological Conditions Danielle Aina-Badejo Until now, the role of cyclin dependent kinase 5 (CDK5) in cardiac pathophysiology has not been explored. While CDK5 has been well studied in the neuroscience/Alzheimer’s field as a cyclin-independent kinase, there is currently no investigation into the cardiac-specific role of CDK5. Recently, it was established that inhibition of CDK5 in stem cell derived cardiomyocytes from individuals with Timothy Syndrome (TS) rescued the delayed inactivation phenotype; TS is a fatal genetic long QT syndrome (LQTS) caused by delayed inactivation of the L-type voltage 2+ gated Ca channel Ca V1.2. While it is evident that CDK5 plays an important role in regulating Ca V1.2 function, its role in cardiac tissue remains to be elucidated. To determine whether CDK5 is essential for cardiac function, two separate mouse models were established—a cardiac-deficient Cdk5 mouse model ( Cdk5 flox x αMHC-MerCreMer +) and a Cdk5 activation mouse model via overexpression of Cdk5’s known activator, p35 (Cdk5r1/ p35 OE x αMHC-MerCreMer +). Immediately after spatiotemporal induction of deficiency/activation of Cdk5 in adult mice, echocardiography, histology and proteomic analysis were performed to examine effects on cardiac structure and function.
    [Show full text]
  • The Neuroprotective Role of the GM1 Oligosaccharide, Ii3neu5ac-Gg4, In
    Molecular Neurobiology (2019) 56:6673–6702 https://doi.org/10.1007/s12035-019-1556-8 The Neuroprotective Role of the GM1 Oligosaccharide, 3 II Neu5Ac-Gg4, in Neuroblastoma Cells Elena Chiricozzi1 & Margherita Maggioni1 & Erika di Biase1 & Giulia Lunghi1 & Maria Fazzari1 & Nicoletta Loberto 1 & Maffioli Elisa2 & Francesca Grassi Scalvini2 & Gabriella Tedeschi 2,3 & Sandro Sonnino1 Received: 10 January 2019 /Accepted: 13 March 2019 /Published online: 26 March 2019 # Springer Science+Business Media, LLC, part of Springer Nature 2019 Abstract 3 Recently, we demonstrated that the GM1 oligosaccharide, II Neu5Ac-Gg4 (OligoGM1), administered to cultured murine Neuro2a neuroblastoma cells interacts with the NGF receptor TrkA, leading to the activation of the ERK1/2 downstream pathway and to cell differentiation. To understand how the activation of the TrkA pathway is able to trigger key biochemical signaling, we performed a proteomic analysis on Neuro2a cells treated with 50 μM OligoGM1 for 24 h. Over 3000 proteins were identified. Among these, 324 proteins were exclusively expressed in OligoGM1-treated cells. Interestingly, several proteins expressed only in OligoGM1-treated cells are involved in biochemical mechanisms with a neuroprotective potential, reflecting the GM1 neuroprotective effect. In addition, we found that the exogenous administration of OligoGM1 reduced the cellular oxidative stress in Neuro2a cells and conferred protection against MPTP neurotoxicity. These results confirm and reinforce the idea that the molecular mechanisms underlying the GM1 neurotrophic and neuroprotective effects depend on its oligosaccharide chain, suggesting the activation of a positive signaling starting at plasma membrane level. Keywords GM1 ganglioside . GM1 oligosaccharide chain . TrkA neurotrophin receptor . Plasma membrane signaling . Neuroprotection .
    [Show full text]
  • Genomic Landscape of Paediatric Adrenocortical Tumours
    ARTICLE Received 5 Aug 2014 | Accepted 16 Jan 2015 | Published 6 Mar 2015 DOI: 10.1038/ncomms7302 Genomic landscape of paediatric adrenocortical tumours Emilia M. Pinto1,*, Xiang Chen2,*, John Easton2, David Finkelstein2, Zhifa Liu3, Stanley Pounds3, Carlos Rodriguez-Galindo4, Troy C. Lund5, Elaine R. Mardis6,7,8, Richard K. Wilson6,7,9, Kristy Boggs2, Donald Yergeau2, Jinjun Cheng2, Heather L. Mulder2, Jayanthi Manne2, Jesse Jenkins10, Maria J. Mastellaro11, Bonald C. Figueiredo12, Michael A. Dyer13, Alberto Pappo14, Jinghui Zhang2, James R. Downing10, Raul C. Ribeiro14,* & Gerard P. Zambetti1,* Paediatric adrenocortical carcinoma is a rare malignancy with poor prognosis. Here we analyse 37 adrenocortical tumours (ACTs) by whole-genome, whole-exome and/or transcriptome sequencing. Most cases (91%) show loss of heterozygosity (LOH) of chromosome 11p, with uniform selection against the maternal chromosome. IGF2 on chromosome 11p is overexpressed in 100% of the tumours. TP53 mutations and chromosome 17 LOH with selection against wild-type TP53 are observed in 28 ACTs (76%). Chromosomes 11p and 17 undergo copy-neutral LOH early during tumorigenesis, suggesting tumour-driver events. Additional genetic alterations include recurrent somatic mutations in ATRX and CTNNB1 and integration of human herpesvirus-6 in chromosome 11p. A dismal outcome is predicted by concomitant TP53 and ATRX mutations and associated genomic abnormalities, including massive structural variations and frequent background mutations. Collectively, these findings demonstrate the nature, timing and potential prognostic significance of key genetic alterations in paediatric ACT and outline a hypothetical model of paediatric adrenocortical tumorigenesis. 1 Department of Biochemistry, St Jude Children’s Research Hospital, Memphis, Tennessee 38105, USA. 2 Department of Computational Biology and Bioinformatics, St Jude Children’s Research Hospital, Memphis, Tennessee 38105, USA.
    [Show full text]