LDB3 monoclonal antibody (M06), Gene Alias: CYPHER, FLJ35865, KIAA01613, clone 3C8 KIAA0613, ORACLE, PDLIM6, ZASP, ldb3z1, ldb3z4 Gene Summary: This gene encodes a PDZ Catalog Number: H00011155-M06 domain-containing protein. PDZ motifs are modular Regulatory Status: For research use only (RUO) protein-protein interaction domains consisting of 80-120 amino acid residues. PDZ domain-containing proteins Product Description: Mouse monoclonal antibody interact with each other in cytoskeletal assembly or with raised against a full-length recombinant LDB3. other proteins involved in targeting and clustering of membrane proteins. The protein encoded by this gene Clone Name: 3C8 interacts with alpha-actinin-2 through its N-terminal PDZ domain and with protein kinase C via its C-terminal LIM Immunogen: LDB3 (AAH10929, 1 a.a. ~ 283 a.a) domains. The LIM domain is a cysteine-rich motif full-length recombinant protein with GST tag. MW of the defined by 50-60 amino acids containing two GST tag alone is 26 KDa. zinc-binding modules. This protein also interacts with all three members of the myozenin family. Mutations in this Sequence: gene have been associated with myofibrillar myopathy MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSK and dilated cardiomyopathy. Alternatively spliced AAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASY transcript variants encoding different isoforms have been NLSLTLQKSKRPIPISTTAPPVQTPLPVIPHQKVVVNSP identified; all isoforms have N-terminal PDZ domains ANADYQERFNPSALKDSALSTHKPIEVKGLGGKATIIHA while only longer isoforms (1 and 2) have C-terminal LIM QYNTPISMYSQDAIMDAIAGQAQAQGSDFSGSLPIKDL domains. [provided by RefSeq] AVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQSR SFRILAQMTGTEFMQDPDEEALRRSRERFETERNSPR References: FAKLRNWHHGLSAQILNVKS 1. Z-disc-associated, Alternatively Spliced, PDZ Motif-containing Protein (ZASP) Mutations in the Host: Mouse Actin-binding Domain Cause Disruption of Skeletal Muscle Actin Filaments in Myofibrillar Myopathy. Lin X, Reactivity: Human Ruiz J, Bajraktari I, Ohman R, Banerjee S, Gribble K, Applications: ELISA, IF, RNAi-Ab, S-ELISA, WB-Ce, Kaufman JD, Wingfield PT, Griggs RC, Fischbeck KH, WB-Re, WB-Tr Mankodi A J Biol Chem. 2014 May 9;289(19):13615-26. (See our web site product page for detailed applications doi: 10.1074/jbc.M114.550418. Epub 2014 Mar 25. information) 2. Impaired binding of ZASP/Cypher with phosphoglucomutase 1 is associated with dilated Protocols: See our web site at cardiomyopathy. Arimura T, Inagaki N, Hayashi T, Shichi http://www.abnova.com/support/protocols.asp or product D, Sato A, Hinohara K, Vatta M, Towbin JA, Chikamori page for detailed protocols T, Yamashina A, Kimura A. Cardiovasc Res. 2009 Jul 1;83(1):80-8. Epub 2009 Apr 17. Isotype: IgG2b Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 11155 Gene Symbol: LDB3 Page 1/1 Powered by TCPDF (www.tcpdf.org).