DOCSLIB.ORG

Caracterización Del Mecanismo De Acción De Los

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Caracterización Del Mecanismo De Acción De Los ADVERTIMENT. Lʼaccés als continguts dʼaquesta tesi doctoral i la seva utilització ha de respectar els drets de la persona autora. Pot ser utilitzada per a consulta o estudi personal, així com en activitats o materials dʼinvestigació i docència en els termes establerts a lʼart. 32 del Text Refós de la Llei de Propietat Intel·lectual (RDL 1/1996). Per altres utilitzacions es requereix lʼautorització prèvia i expressa de la persona autora. En qualsevol cas, en la utilització dels seus continguts caldrà indicar de forma clara el nom i cognoms de la persona autora i el títol de la tesi doctoral. No sʼautoritza la seva reproducció o altres formes dʼexplotació efectuades amb finalitats de lucre ni la seva comunicació pública des dʼun lloc aliè al servei TDX. Tampoc sʼautoritza la presentació del seu contingut en una finestra o marc aliè a TDX (framing). Aquesta reserva de drets afecta tant als continguts de la tesi com als seus resums i índexs. ADVERTENCIA. El acceso a los contenidos de esta tesis doctoral y su utilización debe respetar los derechos de la persona autora. Puede ser utilizada para consulta o estudio personal, así como en actividades o materiales de investigación y docencia en los términos establecidos en el art. 32 del Texto Refundido de la Ley de Propiedad Intelectual (RDL 1/1996). Para otros usos se requiere la autorización previa y expresa de la persona autora. En cualquier caso, en la utilización de sus contenidos se deberá indicar de forma clara el nombre y apellidos de la persona autora y el título de la tesis doctoral. No se autoriza su reproducción u otras formas de explotación efectuadas con fines lucrativos ni su comunicación pública desde un sitio ajeno al servicio TDR. Tampoco se autoriza la presentación de su contenido en una ventana o marco ajeno a TDR (framing). Esta reserva de derechos afecta tanto al contenido de la tesis como a sus resúmenes e índices. WARNING. The access to the contents of this doctoral thesis and its use must respect the rights of the author. It can be used for reference or private study, as well as research and learning activities or materials in the terms established by the 32nd article of the Spanish Consolidated Copyright Act (RDL 1/1996). Express and previous authorization of the author is required for any other uses. In any case, when using its content, full name of the author and title of the thesis must be clearly indicated. Reproduction or other forms of for profit use or public communication from outside TDX service is not allowed. Presentation of its content in a window or frame external to TDX (framing) is not authorized either. These rights affect both the content of the thesis and its abstracts and indexes. Universidad Autónoma de Barcelona Departamento de Medicina Facultad de Medicina Programa de Doctorado en Medicina CARACTERIZACIÓN DEL MECANISMO DE ACCIÓN DE LOS PAN-INHIBIDORES SELECTIVOS DEL RECEPTOR DEL FACTOR DE CRECIMIENTO FIBROBLÁSTICO E IDENTIFICACIÓN DE POTENCIALES BIOMARCADORES PREDICTIVOS DE RESPUESTA MEDIANTE LA UTILIZACIÓN DE XENOINJERTOS DERIVADOS DE PACIENTES CON ALTERACIONES EN ESTA VÍA MOLECULAR Tesis doctoral para optar al grado de Doctor Cinta Hierro Carbó Directores de la tesis: Jordi Rodón Ahnert Violeta Serra Elizalde Tutor de la tesis: Francesc Bosch Albareda Barcelona, 2020 “Y una vez que la tormenta termine, no recordarás cómo lo lograste, cómo sobreviviste. Ni siquiera estarás seguro de si la tormenta ha terminado realmente. Pero una cosa si es segura. Cuando salgas de esa tormenta, no serás la misma persona que entró en ella” Haruki Murakami A Gara AGRADECIMIENTOS Al Dr. Josep Tabernero, por la confianza depositada en mí y por ofrecerme esta gran oportunidad en mi carrera. Al Dr. Jordi Rodón y la Dra. Violeta Serra, ambos directores de esta tesis. Porque nunca dos mentores tan antagónicos tuvieron un efecto tan sinérgico, a ellos les debo haber sacado lo mejor de mí como investigadora. Echaré de menos nuestras teleconferencias en franjas horarias imposibles, y la fuga de ideas que apuntar en mi libreta. A Mònica Sánchez-Guixé, por su dedicación en el laboratorio y por compartir conmigo la ilusión de este proyecto. Ha sido un lujazo trabajar juntas. A la Dra. Elena Garralda y todo el equipo humano que vertebra la UITM, por el apoyo a todo este proyecto; en especial, gracias a Laura Maynes, la mejor coordinadora que el FGFR 360º RESISTANCE podría haber tenido. A la Dra. Ana Vivancos, el Dr. Paolo Nuciforo, el Dr. Rodrigo Dienstmann y sus respectivos equipos, cuyo trabajo ha hecho posible esta tesis. Al Prof. José Jiménez, por su inestimable ayuda con la gestión de muestras. Definitivamente, si no existiera tendrían que inventarlo. A las Dras. Cristina Saura y Mafalda Oliveira, por entender como nadie que para el éxito de los proyectos es imprescindible colaborar. Definitivamente, todas las direcciones siempre me han llevado a la mama, aunque yo me haya resistido. Al Dr. Ricard Mesía y la Dra. Maica Galán, por enseñarme ese algo más de la Oncología, y por haber creído siempre en mí. 1 A los pacientes y sus famílias, por recordarme a diario porqué elegí esta profesión. A mi tribu de amigos, mi gran família elegida, por estar ahí 24/7/365 desde las antípodas o en medio de una pandemia mundial: #Este gato é una mielda, #Pasajeritos confinados, #Sukiyaki friends, #Sinó a Bcn a SF, #AlbaRipoll, #Meprecipitodelavida, #You’ll never walk alone, #Gossip girls, #Pirri the ripper is back, #Ebre connection, #Tu pelo tu pelooo. A mi padres, Tere y Fermín, por su cariño y valores inculcados, pero sobretodo, por su apoyo total a pesar de no siempre entender mis decisiones. A mi hermana Maite y Ismael, luchadores como nadie y cómplices en la vida. A Ismael e Iván, por querer a su tía de forma incondicional. A Juanjo y Susana, por recargarme las pilas siempre que ha hecho falta, y a Marta, por aceptar el reto de compartir conmigo el título de aventurera de la família. A Pilar, Álvaro y Mariona, por tener la gran suerte de haber encontrado en ellos la a otra mitad de mis imprescindibles. A J. J. Carbó, mi genial abuelo pintor que impregnó mi infancia de pasión cromática. Por enseñarme a ir contracorriente, no conformarme nunca con nada y cuestionarlo todo siempre. Creo que estaría orgulloso. A Joan, mi perfecto compañero de viaje. Por entender como nadie lo que significa ser médico, e intentar superarse cada día en el empeño de hacerlo mejor. Por ser mi crítico más duro y al mismo tiempo, mi mayor fan durante todo este proyecto. Gracias por no dejarme tirar la toalla nunca. A mis hijas, por enseñarme el verdadero significado de la resiliencia humana. Y por último, a la ciudad de Melbourne. Por estar allí cuando más la necesitaba. Sin ella, esta tesis nunca hubiera visto la luz. 2 LISTADO DE ABREVIACIONES FGFR: del inglés Fibroblast Growth Factor Receptor FGF: del inglés Fibroblast Growth Factor MTKI: del inglés Multi-Tyrosin Kinase Inhibitor ORR: del inglés Overall Response Rate DCR: del inglés Disease Control Rate ALK: del inglés Anaplastic Lymphoma Kinase NTRK: del inglés Neutrotrophic Tyrosin Receptor Kinase MSI-H: del inglés MiscroSatellite Instability High dMMR: del inglés deficient in MisMatch Repair PTEN: del inglés Phosphatase and TENsin homolog EGFR: del inglés Epidermal Growth Factor Receptor IGFR: del inglés Insulin Growth Factor Receptor VEGFR: del inglés Vascular Endothelial Growth Factor Receptor PDGFR: del inglés Platelet Derived Growth Factor Receptor MAPK: del inglés Mitogen-Activated Pathway Kinase PI3K: del inglés PhosphatidylInositol-4,5-bisphosphate-3-Kinase BRAF: del inglés v-Raf murine sarcoma viral oncogene homolog B1 HER: del inglés Human Epidermal Receptor EMT: del inglés Epithelial-Mesenchymal Transition ADCC: del inglés Antibody-Dependent Cellular-mediated Cytotoxicity IRB: del inglés Institutional Review Board FDA: del inglés Food and Drug Administration NCCN: del inglés National Comprehensive Cancer Network WMA: del inglés World Medical Association RECIST: del inglés Response Evaluation Criteria In Solid Tumors CR: del inglés Complete Response PR: del inglés Partial Response SD: del inglés Stable Disease PD: del inglés Progressive Disease mRNA: Ácido RiboNucleico mensajero 3 ADN: Ácido DesoxirriboNucleico CNA: del inglés Copy Number Alteration NGS: del inglés Next Generation Sequencing FACT: del inglés Functional Annotation for Cancer Treatment qRT-PCR: del inglés Reverse Transcription-Polymerase Chain Reaction WES: del inglés Whole Exome Sequencing RNAseq: del inglés RiboNucleic Acid sequencing EGFP: del inglés Enhanced Green Fluorescent Protein ROC: del inglés Receiver Operating Characteristics TMB: del inglés Tumor Mutational Burden ICI: del inglés Immune Checkpoint Inhibitors PBMCs: del inglés Peripheral Blood Mononuclear Cell 4 LISTADO DE FIGURAS Figura 1. Identificación de poblaciones de pacientes seleccionados molecularmente y aplicación de protocolos traslacionales. Figura 2. Esquema de la vía del FGFR:FGF. Figura 3. Potenciales biomarcadores predictivos a los FGFRinh y métodos de detección. Figura 4. Potenciales mecanismos de resistencia a los FGFRinh. Figura 5. Protocolo de generación de PDXs y líneas celulares FGFR-alteradas y su utilidad como herramienta investigacional. Figura 6. Bloqueo de la angiogénesis en modelos PDXs FGFR-alterados. Figura 7. Proyecto traslacional FGFR 360º RESISTANCE. Figura 8. Esquema de la generación de PDXs FGFR:FGF-amplificados de cáncer de mama seleccionados para experimentos in vivo y caracterización molecular. Figura 9. Porcentaje de cambio en las lesiones diana en casos con FGFRamp/mRNAh según el subtipo tumoral y características moleculares de los pacientes. Figura 10. Correlación entre ClinBen a FGFRinh y nivel de amplificación génica del FGFR en el subgrupo pacientes FGFRamp. Figura 11. Porcentaje de cambio en las lesiones diana en casos con FGFRmut según el subtipo tumoral y características moleculares de los pacientes. Figura 12. Predicción in vitro de la actividad oncogénica de las mutaciones FGFR detectadas en el subgrupo de pacientes FGFRmut.
Load more

Recommended publications
  • MAGE-A5 Rabbit Pab Antibody
    MAGE-A5 rabbit pAb antibody Catalog No : Source: Concentration : Mol.Wt. (Da): A17280 Rabbit 1 mg/ml 13016 Applications WB,ELISA Reactivity Human Dilution WB: 1:500 - 1:2000. ELISA: 1:10000. Not yet tested in other applications. Storage -20°C/1 year Specificity MAGE-A5 Polyclonal Antibody detects endogenous levels of MAGE-A5 protein. Source / Purification The antibody was affinity-purified from rabbit antiserum by affinity- chromatography using epitope-specific immunogen. Immunogen The antiserum was produced against synthesized peptide derived from human MAGEA5. AA range:68-117 Uniprot No P43359 Alternative names MAGEA5; MAGE5; Melanoma-associated antigen 5; Cancer/testis antigen 1.5; CT1.5; MAGE-5 antigen Form Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Clonality Polyclonal Isotype IgG Conjugation Background MAGE family member A5(MAGEA5) Homo sapiens This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Gene record in accordance with the assumed protein-coding status defined in the literature.
    [Show full text]
  • Pan-Cancer Immunogenomic Analyses Reveal Genotype-Immunophenotype Relationships and Predictors of Response to Checkpoint Blockade
    bioRxiv preprint doi: https://doi.org/10.1101/056101; this version posted November 1, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Pan-cancer immunogenomic analyses reveal genotype-immunophenotype relationships and predictors of response to checkpoint blockade Pornpimol Charoentong†, Francesca Finotello†, Mihaela Angelova†, Clemens Mayer, Mirjana Efremova, Dietmar Rieder, Hubert Hackl, Zlatko Trajanoski* 1Biocenter, Division of Bioinformatics, Medical University of Innsbruck, Innsbruck, Austria †Equal contribution *To whom correspondence should be addressed: [email protected] Zlatko Trajanoski, PhD Biocenter, Division of Bioinformatics Medical University of Innsbruck Innrain 80, 6020 Innsbruck Austria Email: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/056101; this version posted November 1, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. SUMMARY: The Cancer Genome Atlas revealed the genomic landscapes of common human cancers. In parallel, immunotherapy with checkpoint blockers is transforming the treatment of advanced cancers. As only a minority of the patients is responsive to checkpoint blockers, the identification of predictive markers and the mechanisms of resistance is a subject of intense research. To facilitate understanding of the tumor-immune cell interactions, we characterized the intratumoral immune landscapes and the cancer antigenomes from 20 solid cancers, and created The Cancer Immunome Atlas (http://tcia.at).
    [Show full text]
  • Biological Models of Colorectal Cancer Metastasis and Tumor Suppression
    BIOLOGICAL MODELS OF COLORECTAL CANCER METASTASIS AND TUMOR SUPPRESSION PROVIDE MECHANISTIC INSIGHTS TO GUIDE PERSONALIZED CARE OF THE COLORECTAL CANCER PATIENT By Jesse Joshua Smith Dissertation Submitted to the Faculty of the Graduate School of Vanderbilt University In partial fulfillment of the requirements For the degree of DOCTOR OF PHILOSOPHY In Cell and Developmental Biology May, 2010 Nashville, Tennessee Approved: Professor R. Daniel Beauchamp Professor Robert J. Coffey Professor Mark deCaestecker Professor Ethan Lee Professor Steven K. Hanks Copyright 2010 by Jesse Joshua Smith All Rights Reserved To my grandparents, Gladys and A.L. Lyth and Juanda Ruth and J.E. Smith, fully supportive and never in doubt. To my amazing and enduring parents, Rebecca Lyth and Jesse E. Smith, Jr., always there for me. .my sure foundation. To Jeannine, Bill and Reagan for encouragement, patience, love, trust and a solid backing. To Granny George and Shawn for loving support and care. And To my beautiful wife, Kelly, My heart, soul and great love, Infinitely supportive, patient and graceful. ii ACKNOWLEDGEMENTS This work would not have been possible without the financial support of the Vanderbilt Medical Scientist Training Program through the Clinical and Translational Science Award (Clinical Investigator Track), the Society of University Surgeons-Ethicon Scholarship Fund and the Surgical Oncology T32 grant and the Vanderbilt Medical Center Section of Surgical Sciences and the Department of Surgical Oncology. I am especially indebted to Drs. R. Daniel Beauchamp, Chairman of the Section of Surgical Sciences, Dr. James R. Goldenring, Vice Chairman of Research of the Department of Surgery, Dr. Naji N.
    [Show full text]
  • Und Endothelzellen
    Aus dem Universitätsklinikum Münster Klinik und Poliklinik für Mund-, und Kiefer-Gesichtschirurgie des Zentrums für Zahn-, Mund- und Kieferheilkunde - Direktor: Univ.- Prof. Dr. Dr. Dr.h.c. U. Joos - ____________________________________________________________________ Genexpressionsanalyse der kokulturellen Verhältnisse zwischen Tumor- und Endothelzellen INAUGURAL-DISSERTATION zur Erlangung des doctor medicinae dentium der Medizinischen Fakultät der Westfälischen Wilhelms-Universität Münster vorgelegt von Krause, Thomas Fritz Rudi Gerhard aus Mühlhausen/Thüringen 2006 Gedruckt mit Genehmigung der Medizinischen Fakultät der Westfälischen Wilhelms-Universität Münster Dekan: Univ.-Prof. Dr. Heribert Jürgens 1. Berichterstatter: Priv.-Doz. Dr. Dr. J. Kleinheinz 2. Berichterstatter: Prof. Dr. P.Scheutzel Tag der mündlichen Prüfung: 30.10.20006 Aus dem Universitätsklinikum Münster Klinik und Poliklinik für Mund-, und Kiefer-Gesichtschirurgie des Zentrums für Zahn-, Mund- und Kieferheilkunde - Direktor: Univ.- Prof. Dr. Dr. Dr.h.c. U. Joos - Zusammenfassung Genexpressionsanalyse der kokulturellen Verhältnisse zwischen Tumor- und Endothelzellen Thomas Krause Die Behandlung von neoplastischen Gewebsveränderungen des Kopf-Halsbereiches hat sich in den letzten Jahrzehnten stetig verbessert. Gerade das Plattenepithelkarzinom, als häufigstes Malignom dieser Region, zeigt jedoch eine relativ schlechte Gesamtprognose. Diese Tatsache kann durch einen stärkeren Bezug der Diagnostik und Therapie auf die eigentliche Tumorbiologie verbessert werden. Die
    [Show full text]
  • Characterization of X-Linked SNP Genotypic Variation in Globally Distributed Human Populations Genome Biology 2010, 11:R10
    Casto et al. Genome Biology 2010, 11:R10 http://genomebiology.com/2010/11/1/R10 RESEARCH Open Access CharacterizationResearch of X-Linked SNP genotypic variation in globally distributed human populations Amanda M Casto*1, Jun Z Li2, Devin Absher3, Richard Myers3, Sohini Ramachandran4 and Marcus W Feldman5 HumanAnhumanulation analysis structurepopulationsX-linked of X-linked variationand provides de geneticmographic insights variation patterns. into in pop- Abstract Background: The transmission pattern of the human X chromosome reduces its population size relative to the autosomes, subjects it to disproportionate influence by female demography, and leaves X-linked mutations exposed to selection in males. As a result, the analysis of X-linked genomic variation can provide insights into the influence of demography and selection on the human genome. Here we characterize the genomic variation represented by 16,297 X-linked SNPs genotyped in the CEPH human genome diversity project samples. Results: We found that X chromosomes tend to be more differentiated between human populations than autosomes, with several notable exceptions. Comparisons between genetically distant populations also showed an excess of X- linked SNPs with large allele frequency differences. Combining information about these SNPs with results from tests designed to detect selective sweeps, we identified two regions that were clear outliers from the rest of the X chromosome for haplotype structure and allele frequency distribution. We were also able to more precisely define the geographical extent of some previously described X-linked selective sweeps. Conclusions: The relationship between male and female demographic histories is likely to be complex as evidence supporting different conclusions can be found in the same dataset.
    [Show full text]
  • An Integrated Genome-Wide Approach to Discover Tumor- Specific Antigens As Potential Immunologic and Clinical Targets in Cancer
    Published OnlineFirst November 7, 2012; DOI: 10.1158/0008-5472.CAN-12-1656 Cancer Integrated Systems and Technologies Research An Integrated Genome-Wide Approach to Discover Tumor- Specific Antigens as Potential Immunologic and Clinical Targets in Cancer Qing-Wen Xu1, Wei Zhao1, Yue Wang8,9, Maureen A. Sartor11, Dong-Mei Han2, Jixin Deng10, Rakesh Ponnala8,9, Jiang-Ying Yang3, Qing-Yun Zhang3, Guo-Qing Liao4, Yi-Mei Qu4,LuLi5, Fang-Fang Liu6, Hong-Mei Zhao7, Yan-Hui Yin1, Wei-Feng Chen1,†, Yu Zhang1, and Xiao-Song Wang8,9 Abstract Tumor-specific antigens (TSA) are central elements in the immune control of cancers. To systematically explore the TSA genome, we developed a computational technology called heterogeneous expression profile analysis (HEPA), which can identify genes relatively uniquely expressed in cancer cells in contrast to normal somatic tissues. Rating human genes by their HEPA score enriched for clinically useful TSA genes, nominating candidate targets whose tumor-specific expression was verified by reverse transcription PCR (RT-PCR). Coupled with HEPA, we designed a novel assay termed protein A/G–based reverse serological evaluation (PARSE) for quick detection of serum autoantibodies against an array of putative TSA genes. Remarkably, highly tumor-specific autoantibody responses against seven candidate targets were detected in 4% to 11% of patients, resulting in distinctive autoantibody signatures in lung and stomach cancers. Interrogation of a larger cohort of 149 patients and 123 healthy individuals validated the predictive value of the autoantibody signature for lung cancer. Together, our results establish an integrated technology to uncover a cancer-specific antigen genome offering a reservoir of novel immunologic and clinical targets.
    [Show full text]
  • View a Copy of This Licence, Visit
    Colemon et al. Genes and Environment (2020) 42:24 https://doi.org/10.1186/s41021-020-00162-2 RESEARCH Open Access DNA hypomethylation drives changes in MAGE-A gene expression resulting in alteration of proliferative status of cells Ashley Colemon1, Taylor M. Harris2 and Saumya Ramanathan2,3* Abstract Melanoma Antigen Genes (MAGEs) are a family of genes that have piqued the interest of scientists for their unique expression pattern. A subset of MAGEs (Type I) are expressed in spermatogonial cells and in no other somatic tissue, and then re-expressed in many cancers. Type I MAGEs are often referred to as cancer-testis antigens due to this expression pattern, while Type II MAGEs are more ubiquitous in expression. This study determines the cause and consequence of the aberrant expression of the MAGE-A subfamily of cancer-testis antigens. We have discovered that MAGE-A genes are regulated by DNA methylation, as revealed by treatment with 5-azacytidine, an inhibitor of DNA methyltransferases. Furthermore, bioinformatics analysis of existing methylome sequencing data also corroborates our findings. The consequence of expressing certain MAGE-A genes is an increase in cell proliferation and colony formation and resistance to chemo-therapeutic agent 5-fluorouracil and DNA damaging agent sodium arsenite. Taken together, these data indicate that DNA methylation plays a crucial role in regulating the expression of MAGE-A genes which then act as drivers of cell proliferation, anchorage-independent growth and chemo-resistance that is critical for cancer-cell survival. Keywords: Cancer, Cancer-testis antigens, Melanoma antigen genes, Anchorage-independent growth, Epigenetics, DNA methylation, Gene expression, Cell proliferation, Chemo-resistance Introduction antigens, and located on the X-chromosome, whereas Type Melanoma Antigen Genes (MAGEs) were first discovered II MAGEs are ubiquitous in expression and some members because a patient with melanoma and a few melanoma cell such as MAGEL2 are located on autosomes [3].
    [Show full text]
  • Recombinant Human MAGEA5 Protein Catalog Number: ATGP1477
    Recombinant human MAGEA5 protein Catalog Number: ATGP1477 PRODUCT INPORMATION Expression system E.coli Domain 1-124aa UniProt No. P43359 NCBI Accession No. NP_066387 Alternative Names Melanoma-associated antigen 5, CT1.5, MAGE5, MAGEA4 PRODUCT SPECIFICATION Molecular Weight 15.6 kDa (148aa) confirmed by MALDI-TOF, (Molecular weight on SDS-PAGE will appear higher) Concentration 0.5mg/ml (determined by Bradford assay) Formulation Liquid in. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1mM PMSF Purity > 85% by SDS-PAGE Tag His-Tag Application SDS-PAGE Storage Condition Can be stored at +2C to +8C for 1 week. For long term storage, aliquot and store at -20C to -80C. Avoid repeated freezing and thawing cycles. BACKGROUND Description MAGEA5, also known as melanoma-associated antigen 5, is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family 1 Recombinant human MAGEA5 protein Catalog Number: ATGP1477 members, and this gene can be alternatively interpreted to be a pseudogene. Recombinant human MAGEA5 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.
    [Show full text]
  • MAGEA5 (NM 021049) Human Tagged ORF Clone – RC218575
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC218575 MAGEA5 (NM_021049) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: MAGEA5 (NM_021049) Human Tagged ORF Clone Tag: Myc-DDK Symbol: MAGEA5 Synonyms: CT1.5; MAGE5; MAGEA4 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC218575 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTCTTGAGCAGAAGAGTCAGCACTGCAAGCCTGAGGAAGGCCTTGACACCCAAGAAGAGGCCCTGG GCCTGGTGGGTGTGCAGGCTGCCACTACTGAGGAGCAGGAGGCTGTGTCCTCCTCCTCTCCTCTGGTCCC AGGCACCCTGGGGGAGGTGCCTGCTGCTGGGTCACCAGGTCCTCTCAAGAGTCCTCAGGGAGCCTCCGCC ATCCCCACTGCCATCGATTTCACTCTATGGAGGCAATCCATTAAGGGCTCCAGCAACCAAGAAGAGGAGG GGCCAAGCACCTCCCCTGACCCAGAGTCTGTGTTCCGAGCAGCACTCAGTAAGAAGGTGGCTGACTTGAT TCATTTTCTGCTCCTCAAGTAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC218575 protein sequence Red=Cloning site Green=Tags(s) MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASA IPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6457_d05.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic
    [Show full text]
  • Avaliação Do Nível De Expressão De MAGE A1 E BORIS E Do Perfil De Metilação Em Carcinoma De Células Escamosas Bucal
    UNIVERSIDADE FEDERAL DE MINAS GERAIS PROGRAMA DE PÓS-GRADUAÇÃO EM EM CIÊNCIAS BIOLÓGICAS: FARMACOLOGIA, BIOQUÍMICA E MOLECULAR Avaliação do nível de expressão de MAGE A1 e BORIS e do perfil de metilação em carcinoma de células escamosas bucal CLÁUDIA MARIA PEREIRA Belo Horizonte 2011 Avaliação do nível de expressão de MAGE A1 e BORIS e do perfil de metilação em carcinoma de células escamosas bucal CLÁUDIA MARIA PEREIRA Tese apresentada ao Programa de Pós- Graduação em Ciências Biológicas: Farmacologia, Bioquímica e Molecular da Universidade Federal de Minas Gerais como requisito parcial para a obtenção do título de Doutora em Farmacologia, Bioquímica e Molecular Orientador: Prof. Dr. Ricardo Santiago Gomez Belo Horizonte Minas Gerais 2011 “Cuidado com o que você pede e deseja; Você pode conseguir” Autor Desconhecido DEDICATÓRIA Dedico a minha dissertação primeiramente a Deus e à Nossa Senhora, que estiveram sempre ao meu lado, me direcionando e protegendo durante toda esta jornada. Dedico também aos meus pais Eure e Célia, pelo apoio, amor e carinho. Dedico aos meus irmãos (Antônio, Fernando, Carlos, Roberto e Caio), aos meus sobrinhos (Ludmila, Angelina, Matheus, Mariana, Pedro, Marcos e Giovanna) e às minhas cunhadas (Carla, Inês, Mônica e Glaura), que mesmo distantes, estiveram sempre presentes me apoiando e me incentivando. Dedico ao meu orientador Prof. Dr. Ricardo Santiago Gomez por confiar e acreditar em mim durante estes anos. AGRADECIMENTOS Agradeço ao meu orientador Dr. Ricardo Santiago Gomez por ter me acompanhado desde o mestrado, por ter me dado a oportunidade de fazer parte de sua equipe em meu doutorado e por permitir meu crescimento profissional e pessoal.
    [Show full text]
  • Transcriptional Overlap Links DNA Hypomethylation with DNA Hypermethylation at Adjacent Promoters in Cancer Jean S
    www.nature.com/scientificreports OPEN Transcriptional overlap links DNA hypomethylation with DNA hypermethylation at adjacent promoters in cancer Jean S. Fain1, Axelle Loriot1,2, Anna Diacofotaki1, Aurélie Van Tongelen1 & Charles De Smet1* Tumor development involves alterations in DNA methylation patterns, which include both gains (hypermethylation) and losses (hypomethylation) in diferent genomic regions. The mechanisms underlying these two opposite, yet co-existing, alterations in tumors remain unclear. While studying the human MAGEA6/GABRA3 gene locus, we observed that DNA hypomethylation in tumor cells can lead to the activation of a long transcript (CT-GABRA3) that overlaps downstream promoters (GABRQ and GABRA3) and triggers their hypermethylation. Overlapped promoters displayed increases in H3K36me3, a histone mark deposited during transcriptional elongation and known to stimulate de novo DNA methylation. Consistent with such a processive mechanism, increases in H3K36me3 and DNA methylation were observed over the entire region covered by the CT-GABRA3 overlapping transcript. Importantly, experimental induction of CT-GABRA3 by depletion of DNMT1 DNA methyltransferase, resulted in a similar pattern of regional DNA hypermethylation. Bioinformatics analyses in lung cancer datasets identifed other genomic loci displaying this process of coupled DNA hypo/hypermethylation, and some of these included tumor suppressor genes, e.g. RERG and PTPRO. Together, our work reveals that focal DNA hypomethylation in tumors can indirectly contribute to hypermethylation of nearby promoters through activation of overlapping transcription, and establishes therefore an unsuspected connection between these two opposite epigenetic alterations. Cancer development is driven in part by the accumulation of epigenetic alterations, which render chromatin permissive to changes in gene expression patterns. As a result, tumor cells acquire increased plasticity, thereby facilitating their evolution towards full malignancy 1.
    [Show full text]
  • MAGEA5 (NM 021049) Human Recombinant Protein – TP318575
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TP318575 MAGEA5 (NM_021049) Human Recombinant Protein Product data: Product Type: Recombinant Proteins Description: Recombinant protein of human melanoma antigen family A, 5 (MAGEA5) Species: Human Expression Host: HEK293T Tag: C-Myc/DDK Predicted MW: 12.8 kDa Concentration: >50 ug/mL as determined by microplate BCA method Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. Storage: Store at -80°C. Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. RefSeq: NP_066387 Locus ID: 4104 UniProt ID: P43359 RefSeq Size: 1664 Cytogenetics: Xq28 RefSeq ORF: 372 Synonyms: CT1.5; MAGE5; MAGEA4 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 MAGEA5 (NM_021049) Human Recombinant Protein – TP318575 Summary: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls.
    [Show full text]