Investment Policy Review of Cabo Verde

Total Page:16

File Type:pdf, Size:1020Kb

Load more

UNCTAD UNITED NATIONS CONFERENCE ON TRADE AND DEVELOPMENT The Investment Policy Review of Cabo Verde is the latest in a series of investment policy reviews INVESTMENT POLICY REVIEW undertaken by UNCTAD at the request of countries interested in improving their investment framework and climate. The economies included in this series are: Egypt (1999) Kenya (2005) The former Yugoslav Uzbekistan (1999) Colombia (2006) Republic of Macedonia (2011) Uganda (2000) Rwanda (2006) Mozambique (2012) Djibouti (2013) Peru (2000) Zambia (2007) Mongolia (2013) Mauritius (2001) Morocco (2008) Bangladesh (2013) Ecuador (2001) Viet Nam (2008) Ethiopia (2002) Republic of Moldova (2013) Dominican Republic (2009) United Republic of Republic of the Congo (2015) I Nigeria (2009) Tanzania (2002) The Sudan (2015) CABO VERDE Mauritania (2009) Botswana (2003) Bosnia and Herzegovina (2015) Ghana (2003) Burkina Faso (2009) Kyrgyzstan (2015) Lesotho (2003) Belarus (2009) Madagascar (2015) Nepal (2003) Burundi (2010) Tajikistan (2016) Sri Lanka (2004) Sierra Leone (2010) The Gambia (2017) Algeria (2004) El Salvador (2010) South-East Europe (2017) Benin (2005) Guatemala (2011) Lebanon (2018) CABO VERDE Visit the website on IPRs http://unctad.org/ipr UNITED NATIONS Layout and Printing at United Nations, Geneva – 1821601 (E) – August 2018 – 486 – UNCTAD/DIAE/PCB/2018/2 CABO VERDE New York and Geneva, 2018 © 2018, United Nations The work is available through open access by complying with the Creative Commons licence created for intergovernmental organizations, at http://creativecommons.org/licenses/by/3.0/igo/. The designations employed and the presentation of material in this work do not imply the expression of any opinion whatsoever on the part of the United Nations concerning the legal status of any country, territory, city or area or of its authorities, or concerning the delimitation of its frontiers or boundaries. Photocopies and reproductions of excerpts are allowed with proper credits. The publication has not been formally edited. United Nations publication issued by the United Nations Conference on Trade and Development. UNCTAD/DIAE/PCB/2018/2 UNITED NATIONS PUBLICATION ISSN: 2414-5084 eISSN: 2414-5475 NOTE Under its overall mandate on trade and development, the United Nations Conference on Trade and Development (UNCTAD) serves as the focal point within the United Nations Secretariat for all matters related to foreign direct investment (FDI). Its work is carried out through intergovernmental deliberations, research and analysis, technical assistance activities, seminars, workshops and conferences. The following symbols have been used in the tables: • Two dots (..) indicate that data are not available or not separately reported. Rows in tables have been omitted in those cases where no data are available for any of the elements in the row. • A hyphen (-) indicates that the item is equal to zero or its value is negligible. • A blank in a table indicates that the item is not applicable. • A slash (/) EHWZHHQGDWHVUHSUHVHQWLQJ\HDUVtIRUH[DPSOHLQGLFDWHVDƂQDQFLDO\HDU • Use of an en dash (–) EHWZHHQGDWHVUHSUHVHQWLQJ\HDUVtIRUH[DPSOHtVLJQLƂHVWKH full period involved, including the beginning and end years. • Reference to “dollars” ($) means United States dollars, unless otherwise indicated. • Annual rates of growth or change, unless otherwise stated, refer to annual compound rates. • Details and percentages in tables do not necessarily add to totals because of rounding. Cabo Verde - Note iii ACKNOWLEDGEMENTS This report was prepared by the Investment Policy Reviews Section under the supervision of Chantal Dupasquier, Chief of the Section, Division on Investment and Enterprise (DIAE). Overall guidance was provided by Joerg Weber, Head of the Investment Policies Branch, and James Zhan, Director, DIAE. The report was drafted by Ariel Ivanier, Massimo Meloni, Kai Partale and Irina Stanyukova. Substantive inputs were provided by Hamed El Kady, Fulvia Farinelli, Laina Maia and Irene Rey Landeira. $WYDULRXVVWDJHVRISUHSDUDWLRQWKHUHSRUWEHQHƂWHGIURPFRPPHQWVGLVFXVVLRQVDQGRULQSXWVIURP(UPLDV Biadgleng, Joseph Clements, Maha El Masri, Joachim Karl, Teresa Moreira, Fiorina Mugione, Jason Munyan, Claudia Roethlisberger, Christoph Spennemann, Elisabeth Tuerk and Paul Wessendorp. FDI data were provided by the Central Bank of Cabo Verde and the Trends and Data Section, DIAE. Overall statistical assistance was also provided by Jovan Licina. Graphic, production and printing support was under the responsibility of the Document Management Service of UNCTAD and the Production and Support Service of the United Nations 2IƂFHLQ*HQHYD7KHUHSRUWZDVIXQGHGE\WKH*RYHUQPHQWRI&DER9HUGHDQGE\WKH*RYHUQPHQWRI6ZHGHQ Cabo Verde - Acknowledgements iv PREFACE UNCTAD Investment Policy Reviews (IPRs) are intended to help countries improve their investment policies with the objective of meeting the Sustainable Development Goals and to familiarize governments and the international private sector with an individual country’s investment environment. The reviews are considered by the UNCTAD Commission on Investment, Enterprise and Development. The analysis is based on the UNCTAD Investment Policy Framework for Sustainable Development (IPFSD) and its core principles and guidelines (UNCTAD, 2015a). The recommendations of the IPR are then implemented with the technical assistance of development partners, including UNCTAD. The support to beneficiary countries is delivered through a series of activities that can span several years. &RQVLVWHQWZLWKWKH6'*V,35VHQFRXUDJHRIƂFLDOGHYHORSPHQWDVVLVWDQFHDQGLQYHVWPHQWLQFRXQWULHVZKHUH needs are greatest. The IPR recommendations are in line with countries’ national development plans and focus on key development sectors, including agriculture, mining, manufacturing, tourism and infrastructure. By helping countries in this manner, the IPR programme contributes to: SDG 1 target b: “to create sound policy frameworks at the national, regional and international levels, based on pro-poor and gender-sensitive development strategies, to support accelerated investment in poverty eradication actions”. 6'* WDUJHW WR qDFKLHYH KLJKHU OHYHOV RI HFRQRPLF SURGXFWLYLW\ WKURXJK GLYHUVLƂFDWLRQ technological upgrading and innovation, including through a focus on high-value added and labour-intensive sectors”. 6'*WDUJHWEqWRHQFRXUDJHRIƂFLDOGHYHORSPHQWDVVLVWDQFHDQGƂQDQFLDOƃRZVLQFOXGLQJ foreign direct investment, to States where the need is greatest, in particular least developed countries, African countries, small island developing States and landlocked developing countries, in accordance with their national plans and programmes”. 6'*WDUJHWqWRPRELOL]HDGGLWLRQDOƂQDQFLDOUHVRXUFHVIRUGHYHORSLQJFRXQWULHVIURPPXOWLSOH sources”. The IPR of Cabo Verde was initiated at the request of the Government. It analyses the legal and regulatory framework for investment, and contains a strategic analysis on how to better utilize FDI in the tourism sector as DOHYHUDJHIRUVXVWDLQDEOHGHYHORSPHQW7KH,35LVEDVHGRQWZRIDFWƂQGLQJPLVVLRQVXQGHUWDNHQLQ-XO\DQG December 2017 and information current at that time, as well as additional information made available to UNCTAD until May 2018. The mission received the full cooperation of the relevant ministries, departments and agencies, LQSDUWLFXODU&DER9HUGH7UDGH,QYHVW7KHPLVVLRQDOVREHQHƂWHGIURPWKHYLHZVRIWKHSULYDWHVHFWRUERWKIRUHLJQ and domestic, as well as bilateral donors and development agencies. The Government and the United Nations Development Programme (UNDP) in Cabo Verde provided substantive contributions as well as logistical support to the IPR process. A preliminary version of this report was discussed at national validation workshops in Praia RQ$SULO6DQWD0DULDRQ$SULODQG0LQGHORRQ$SULO7KHƂQDOUHSRUWUHƃHFWVFRPPHQWVIURP stakeholders, including ministries and agencies of the Government of Cabo Verde. Geneva, June 2018 Cabo Verde - Preface v CONTENTS NOTE ........................................................................................................................................................................iii ACKNOWLEDGEMENTS ............................................................................................................................................iv PREFACE ...................................................................................................................................................................v ABBREVIATIONS .......................................................................................................................................................ix KEY MESSAGES .....................................................................................................................................................xiii CONTEXT ...................................................................................................................................................................1 CHAPTER 1. THE INVESTMENT FRAMEWORK. 9 $ )',VSHFLƂFSROLF\IUDPHZRUN. 10 1. Entry and establishment ...........................................................10 2. Treatment and protection ..........................................................11 3. International investment agreements ..................................................13 B. Company establishment ...............................................................17 C. Environment .......................................................................20 D. Labour and skills development ..........................................................23 1. General labour regulations .........................................................23
Recommended publications
  • Cabo Verde Emergency Preparedness and Response Diagnostic: Building a Culture of Preparedness

    Cabo Verde Emergency Preparedness and Response Diagnostic: Building a Culture of Preparedness

    Cabo Verde Emergency Preparedness and Response Diagnostic: Building a Culture of Preparedness financed by through CABO VERDE EMERGENCY PREPAREDNESS AND RESPONSE DIAGNOSTIC © 2020 International Bank for Reconstruction and Development / The World Bank 1818 H Street NW Washington DC 20433 Telephone: 202-473-1000 Internet: www.worldbank.org This report is a product of the staff of The World Bank and the Global Facility for Disaster Reduction and Recovery (GFDRR). The findings, interpretations, and conclusions expressed in this work do not necessarily reflect the views of The World Bank, its Board of Executive Directors or the governments they represent. The World Bank and GFDRR does not guarantee the accuracy of the data included in this work. The boundaries, colors, denominations, and other information shown on any map in this work do not imply any judgment on the part of The World Bank concerning the legal status of any territory or the endorsement or acceptance of such boundaries. Rights and Permissions The material in this work is subject to copyright. Because the World Bank encourages dissemination of its knowledge, this work may be reproduced, in whole or in part, for noncommercial purposes as long as full attribution to this work is given. 2 CABO VERDE EMERGENCY PREPAREDNESS AND RESPONSE DIAGNOSTIC List of Abbreviations AAC Civil Aviation Agency AHBV Humanitarian Associations of Volunteer Firefighters ASA Air Safety Agency CAT DDO Catastrophe Deferred Drawdown Option CNOEPC National Operations Centre of Emergency and Civil Protection
  • Instituto Superior De Educação Departamento De Geociências Licenciatura Em Biologia

    Instituto Superior De Educação Departamento De Geociências Licenciatura Em Biologia

    INSTITUTO SUPERIOR DE EDUCAÇÃO DEPARTAMENTO DE GEOCIÊNCIAS LICENCIATURA EM BIOLOGIA Aspectos da Biodiversidade no Parque Natural da Serra de Malagueta Linda Lopes Fevereiro de 2007 LINDA MARIA FERNANDES BARRETO LOPES ASPECTOS DA BIODIVERSIDADE NO PARQUE NATURAL DE SERRA DE MALAGUETA Projecto de pesquisa apresentado ao I.S.E – como requisito parcial para obtenção do título de licenciatura em Biologia Orientadora: Dra. Vera Gominho Praia 2007 DEPARTAMENTO DE GEOCIÊNCIAS Trabalho científico apresentado ao I.S.E. para obtenção do grau de licenciatura em ensino de biologia. Elaborado por, Linda Fernandes Barreto Lopes, aprovado pelos membros do júri, foi homologado pelo concelho científico -pedagógico, como requisito parcial à obtenção do grau de licenciatura em ensino de biologia. O JURI ______________________________________________________________________ ______________________________________________________________________ ______________________________________________________________________ PRAIA ____/____/____ DEDICATÓRIA Dedico este trabalho aos meus queridos pais, que com toda a dedicação e carinho, sempre me incentivaram a prosseguir os estudos. Aos meus irmãos, em especial a Nilde, aos meus sobrinhos, enfim a todos os meus familiares, com os quais sempre eu pude contar. De uma forma muito especial ao meu esposo Aristides e minha filha Denise, pelo apoio em todos os sentidos, mas também pelo tempo subtraído ao convívio familiar. 3 AGRADECIMENTOS A realização deste dependeu muito do apoio e colaboração dada por diversas individualidades e instituições, que de uma forma calorosa, responderam as nossas solicitações, ao longo desse tempo. Assim sendo não poderíamos deixar de manifestar a nossa gratidão aos funcionários da Direcção geral do Ambiente (D.G.A), aos do Instituto Nacional de Investigação e Desenvolvimento Agrário (I.N.I.D.A.), e do Instituto Nacional de Meteorologia e Geofísica (I.N.M.G.), pela tolerância e informações prestadas.
  • REFLEXO DA CIDADE VELHA Arquitectura, Património E Turismo: O Caso Cidade Velha Em Cabo Verde

    REFLEXO DA CIDADE VELHA Arquitectura, Património E Turismo: O Caso Cidade Velha Em Cabo Verde

    UNIVERSIDADE DA BEIRA INTERIOR Engenharia REFLEXO DA CIDADE VELHA Arquitectura, Património e Turismo: O caso Cidade Velha em Cabo Verde Tatiana Pavliuc Dissertação para obtenção do Grau de Mestre em Arquitectura (ciclo de estudos integrado) Orientador: Prof. Doutor Cláudia Sofia São Marcos Miranda Beato Co-orientador: Prof. Susana Martins Covilhã, Outubro de 2013 ii Agradecimentos A minha mãe e irmã. A todos que de forma directa ou indirecta me auxiliaram ao longo deste percurso académico. iii iv Resumo A partir das últimas décadas do séc. XX, o turismo em Cabo Verde tem sido um dos sectores que mais cresceu, atraindo maior investimento directo estrangeiro. Contudo, este crescimento pode criar maior pressão sobre os recursos existentes, com impactos negativos a vários níveis. Há uma clara reflexão sobre a valorização, preservação e conservação do património nacional, em que se apostou no centro histórico de Ribeira Grande, Cidade Velha, portadora de uma história única no mundo inteiro, sendo o berço da nação crioula e o lugar onde nasceu o comércio dos escravos. Teve uma existência de tempos dourados quase efémera, mas soube tirar partido disso e ser eficiente na altura. O tema desta dissertação constitui um estudo que relaciona a história com o desenho urbano, a imagem da cidade a partir de vários pontos da mesma, a economia, a sociologia, e a arquitectura com o património e o turismo. Uma forma de demostração em como revitalizar o lugar histórico, quase rural da Cidade Velha de Ribeira Grande, é valorizando o meio ambiente, conservando o património cultural, natural, construído e subaquático. Alia-se dessa maneira um estudo de pesquisa sobre história, paisagem, dotações urbanas e equipamentos, para assim dar lugar a uma “reciclagem” ao espaço e ao Património Mundial, sem perturbar o meio ambiente, tornando-o atractivo, e desenvolvendo a sua economia no sector de Turismo Sustentável.
  • Perfil Urbano Nacional República De Cabo Verde

    Perfil Urbano Nacional República De Cabo Verde

    PERFIL URBANO NACIONAL REPÚBLICA DE CABO VERDE Setembro de 2013 1 Direitos Autorais © Programa das Nações Unidas para os Assentamentos Humanos (ONU-Habitat), 2013 Todos os direitos reservados As publicações do Programa das Nações Unidas para os Assentamentos Humanos das Nações Unidas podem ser obtidas no seguinte endereço: Escritórios Regionais e de Informação ou diretamente: Caixa Postal 30030, GPO 00100 Nairobi, Quénia. Fax: + (254 20) 762 4266/7 E-mail: [email protected] Website: http://www.unhabitat.org Este projecto foi preparado e gerido pela Direcção Geral do Ordenamento do Território e Desenvolvimento Urbano, DGOTDU do Ministério do Ambiente, Habitação e Ordenamento do Território, de Cabo Verde em Parceria com o Escritório Local do Programa das Nações Unidas para os Assentamentos Humanos, ONUHABITAT, no quadro do Programa Único das Nações Unidas em Cabo Verde. O presente Perfil Urbano foi coordenado, a nível do país pela Empresa de Estudos Afrosondagem e pelos Especialistas da DGOTDU. A equipa de Gestão do Programa PSUP foi composta por Janice Helena Da Silva, Coordenadora da ONU-HABITAT para Cabo Verde; Kerstin Sommer – Responsável Global do PSUP e Mathias Spaliviero, Conselheiro Regional, ONUHABITAT REPÚBLICA DE CABO VERDE: PERFIL URBANO NACIONAL DE CABO VERDE HS Number: HS/021/14P ISBN Number (Series): 978-92-1-132023-7 ISBN Number (Volume): 978-92-1-132610-9 Renúncias de Responsabilidades A designação empregada bem como a apresentação do material contido nesta publicação não implicam a expressão de qualquer opinião por parte do Secretariado das Nações Unidas sobre o status legal de qualquer país, território, cidade ou área, ou de suas autoridades, ou a respeito da delimitação de suas fronteiras ou limites, ou ainda, sobre o seu sistema económico ou grau de desenvolvimento.
  • Undiscovered Cape Verde

    Undiscovered Cape Verde

    Tour Code: 48950 UNDISCOVERED CAPE Grade 6 Holiday Duration: 14 nights VERDE HOLIDAY DATES 26th Jan 2019 - 9th Feb 2019, 26th Oct 2019 - 9th Nov 2019 Exploring rugged Atlantic Islands... 19th Dec 2019 - 2nd Jan 2020 The Cape Verde Islands offer a unique blend of African and Portuguese history. We go to the geologically younger, where the way of life is relatively untouched by the outside world HOLIDAY HIGHLIGHTS Explore the dramatic canyons and fertile oases of Cape Verde’s "ribeiras". Meet friendly farmers and children on cobbled mountain and coastal trails. Discover Cidade Velha, the earliest colonial city - now a World Heritage site. Enjoy the blend of African and Portuguese culture, music and cuisine. UNDISCOVERED CAPE VERDE A day's good walking up the ribeiras on Santo Anto rewards you with stunning vistas over volcanic mountains, deep gorges and the bluest of seas. The prospect of a refreshing ocean dip, perhaps accompanied by a well- earned sundowner drink, entices you on the downward slope towards the white sand beaches. Tourism is still in its infancy here with the main development beside the sandy beaches of the flatter eastern islands. Instead, we head for the geologically younger, more rugged islands where there is some superb walking, and where the way of life is often relatively untouched by the outside world. We can enjoy the freshness of this new destination, while recognising that facilities will sometimes be limited. Our introduction to the archipelago is with the largest island of Santiago. Here we first stay on the coast at Cidade Velha, before travelling into the mountains to So Domingos, to see a glimpse of life in the very African interior.
  • TESE FINAL MARIA.Pdf

    TESE FINAL MARIA.Pdf

    Escola de Ciências Sociais e Humanas Departamento de Economia Política A Patrimonialização da Cidade-Velha e o Seu Contributo para Desenvolvimento Local Maria Clementina Marques Fernandes Dissertação submetida como requisito parcial para obtenção do grau de Mestre em Estudos de Desenvolvimento, Diversidades Locais e Desafios Mundiais. Orientador: Pedro Miguel Alves Felício Seco da Costa, Professor Auxiliar ISCTE-IUL – Instituto Universitário de Lisboa Outubro, 2015 i Dedicado à minha avó Beatriz ii AGRADECIMENTOS A realização deste trabalho não seria possível, sem o apoio de algumas pessoas. Primeiramente agradeço ao meu orientador Prof. Dr. Pedro Costa, que se mostrou incansável e sempre disponível para colaborar, desde o início e até à conclusão deste trabalho. Agradeço à minha família em especial ao meu irmão, Jeremias Fernandes, que possibilitou a minha estadia em Cabo-Verde, durante a realização do trabalho de campo. Aos amigos e colegas de trabalho pelo incentivo e apoio, especialmente a Patrícia Sequeira que acompanhou, desde o início, o meu percurso académico. Agradeço ao governo de Cabo-Verde, em especial à secretária do Ministro da Cultura, Dr.ª Lígia Barbosa. O meu profundo agradecimento à instituição, Instituto da Investigação e do Património Culturais, em especial ao Presidente Dr. Humberto Lima, Dr. Charles Akibodé e ao Dr. Victor Semedo, Curadoria da Cidade-Velha em especial ao Curador Hamilton Jair M. L. Fernandes, à historiadora Yolanda Gomes e à psicóloga Dr.ª Lenira. Gostaria de agradecer à Câmara Municipal da Ribeira Grande, em especial, ao presidente Manuel Monteiro de Pina pela conceção da entrevista. O meu especial agradecimento à população da Cidade-Velha, que sempre se mostrou paciente e disponível às minhas perguntas.
  • Bryophytes from the Cape Verde Islands

    Bryophytes from the Cape Verde Islands

    123 Tropical Bryology 12: 123-153, 1996 Bryophytes from the Cape Verde Islands Jan-Peter Frahm1, Anja Lindlar1, Philip Sollman2, Eberhard Fischer1 1 Botanisches Institut der Rheinischen Friedrich-Wilhelms-Universität, Meckenheimer Allee 170, 53115 Bonn, Germany 2 Von Weberstraat 32, 6904 KD Zevenaar, The Netherlands Abstract: Almost 450 specimens of bryophytes, so far the largest collection of bryophytes ever made on the Cape Verde Islands, were collected in 1995 by the second author on the major islands of the archipelago. Twenty seven species (3 hepatics, 24 mosses) are reported as new to the Cape Verde Islands: Lejeunea ulicina (Tayl.) Gottsche et al., Riccia cavernosa Hoffm. emend. Raddi, Targionia hypophylla L., Barbula cf. consanguinea (Thwait. & Mitt.) Jaeg., Barbula unguiculata Hedw., Brachymenium exile (Dozy & Molk.) Bosch. & Lac., Bryoerythrophyllum ferruginascens (Stirt.) Giac., Bryoerythrophyllum inaequalifolium (Tayl.) Zander, Bryum cellulare Hook., Chenia leptophylla (C. Müll.) Zander, Desmatodon bogosicus C. Müll., Didymodon australasiae (Hook. & Grev.) Zander, Didymodon maschalogena (Ren. & Card.) Broth. (Didymodon michiganensis [Steere] K. Saito), Didymodon vinealis (Brid.) Zander var. flaccidus (B.S.G.) Zander, Eurhynchium meridionale (B.S.G.) De Not., Eurhynchium speciosum (Brid.) Jur., Fissidens sciophyllus Mitt., F. bogosicus C. Müll., F. flaccidus Mitt., F. helictocaulos C. Müll., Gymnostomiella cf. vernicosa (Hook.) Fleisch., Gymnostomum calcareum Nees & Hornsch., Hyophila involuta (Hook.) Jaeg., Orthotrichum diaphanum Brid., Tortula cuneifolia (With.) Turn., Tortula laevipila (Brid.) Schwaegr. and Weissia microstoma (Hedw.) C. Müll. The doubtful record of Marchantia paleacea Bertol. could be confirmed. Numerous species are recorded as new to single islands. Tortula pierrotii Biz. described from Tanzania has proved to be synyomous with Bryoerythrophyllum inaequalifolium. Didymodon maschalogena (Ren.
  • Cabo Verde As Ilhas Da ‘Morabeza’ 30 De Julho a 18 De Agosto

    Cabo Verde As Ilhas Da ‘Morabeza’ 30 De Julho a 18 De Agosto

    Cabo Verde As ilhas da ‘morabeza’ 30 de julho a 18 de agosto O CAAL vai voltar a um país de língua portuguesa. Cabo Verde foi descoberto pelos portugueses no ano de 1460. A primeira ilha a que acostaram foi a da Boa Vista, nome dado em consequência do longo tempo que permaneceram no mar, sem nenhuma referência de terra. Em seguida os portugueses foram para outras ilhas que foram batizando com o nome do santo correspondente ao dia da descoberta, assim aconteceu com Santo Antão, São Vicente, Santa Luzia, São Nicolau e Santiago. A ilha do Sal foi assim denominada por causa das grandes salinas existentes. A ilha de Maio deve o seu nome ao mês em que foi descoberta e a ilha do Fogo por ter um vulcão, que se supõe ter estado em atividade, no momento da chegada dos navegadores. A ilha Brava foi assim chamada devido ao seu aspeto, um tanto quanto hostil. Como o arquipélago era desabitado os portugueses deram início ao seu povoamento. Por ocupar uma situação privilegiada na encruzilhada entre três continentes - Europa, América e África - Cabo Verde foi um entreposto importante no chamado tráfico negreiro. Os escravos eram capturados e levados para as ilhas de onde seguiam, mais tarde, para trabalhar nas produções de cana-de-açúcar, café e algodão do Brasil e das Antilhas. Na ilha de Santiago, foi erigida a primeira cidade construída por europeus nas colónias, a cidade de Ribeira Grande, hoje mais conhecida por Cidade Velha. A cultura de Cabo Verde possui características singulares. É ‘mestiça’ como a sua população, numa das misturas mais originais e criativas do continente africano.
  • Integrated Participatory Ecosystem Management in and Around Protected Areas

    Integrated Participatory Ecosystem Management in and Around Protected Areas

    Integrated Participatory Ecosystem Management in and Around Protected Areas (Cape Verde Protected Areas Project, Phase I) Atlas Project Number GEF 12226-7, UNDP 12226 PIMS # 1382 MID TERM REVIEW 28th May – 30th July 2007 Final Report (20 November 2007) 1 Acknowledgements The two authors of the report – Dr Nigel Varty (International Consultant) and Sonia Elsy Merino (National Consultant) - would like to thank the UNJO in Cape Verde for organising the MTE mission (5-28 June 2007), and providing administrative, logistical (transport, office facilities, etc) and other support to the MTE team. The authors would like to thank especially José Levy, Eunice Gomez, and the Resident Representative, Patricia de Mowbray, for their help and support. The UNDP-GEF Regional Coordination Unit in Dakar also provided support to the evaluation mission and the team would like to thank the UNDP-GEF Regional Technical Advisor, Fabiana Issler, for her input, particularly in arranging for completion of the review of the draft report. The evaluation team also wishes to express its gratitude to the Director of DGA, Ivone Lopes, and the whole of the project team for their time and enjoyable visits to Serra da Malagueta and Monte Gordo, particularly to the Project Coordinator, Maria Teresa Vera Cruz, the two Project Site Coordinators, José Luís Elba Martins (Serra da Malagueta) and Lazaro António Sá (Monte Gordo), and to the project’s Chief Technical Advisor, Abdelkader Bensada. The International Consultant would like to thank José Levy and Jeanne Gouba at the UNJO and Fabiana Issler of UNDP-GEF for very constructive comments on the draft MTE report, which helped to substantially strengthen and balance the final version.
  • Cabo Verde 2.0. Marca Y Desarrollo Turístico En El Archipiélago

    Cabo Verde 2.0. Marca Y Desarrollo Turístico En El Archipiélago

    PASOS. Revista de Turismo y Patrimonio Cultural ISSN: 1695-7121 [email protected] Universidad de La Laguna España Cabo Verde 2.0. Marca y desarrollo turístico en el archipiélago Marcelino, Pedro F.; Oca Gonzaléz, Luzia Cabo Verde 2.0. Marca y desarrollo turístico en el archipiélago PASOS. Revista de Turismo y Patrimonio Cultural, vol. 17, no. Esp.3, 2019 Universidad de La Laguna, España Available in: https://www.redalyc.org/articulo.oa?id=88165935004 DOI: https://doi.org/10.25145/j.pasos.2019.17.037 This work is licensed under Creative Commons Attribution-NonCommercial-NoDerivs 4.0 International. PDF generated from XML JATS4R by Redalyc Project academic non-profit, developed under the open access initiative Pedro F. Marcelino, et al. Cabo Verde 2.0. Marca y desarrollo turístico en el archipiélago Artículos Cabo Verde 2.0. Marca y desarrollo turístico en el archipiélago Cabo Verde 2.0: desarrollo de marca y turismo en todo el archipiélago Pedro F. Marcelino DOI: https://doi.org/10.25145/j.pasos.2019.17.037 Longyearbyen Consulting, Canadá Redalyc: https://www.redalyc.org/articulo.oa? [email protected] id=88165935004 Luzia Oca Gonzaléz University of Trás#os#Montes, Portugal [email protected] Received: 21 January 2019 Accepted: 18 February 2019 Abstract: is article homes in on the genesis and the development process of tourism in the Cabo Verdes Islands, West Africa, from its definition as a national priority in the post#independence period, to its qualification as a strategic sector in the 1990s, to the prioritizing of the sector as a core economic pillar for the 21s Century.
  • Directorio Institucional Del Observatorio Económico Canarias-África Cabo Verde

    Directorio Institucional Del Observatorio Económico Canarias-África Cabo Verde

    DIRECTORIO INSTITUCIONAL DEL OBSERVATORIO ECONÓMICO CANARIAS-ÁFRICA CABO VERDE DIRECTORIO INSTITUCIONAL DEL OBSERVATORIO ECONÓMICO CANARIAS-ÁFRICA CABO VERDE Institución Nombre Cargo Teléfono Email/Web INSTITUCIONES OFICIALES ESPAÑOLAS • Dª Mª Dolores Ríos • Embajadora [email protected] Embajada de España en Cabo Verde • D. Manuel del Rosario • 2ª Jefatura +238 260 18 00 Asuntos consulares: [email protected] • Dª Benilde Florea • Canciller Viceconsulado Honorario en Santa María - con jurisdicción en Sal, Boa D. João Medina Vicecónsul honorario +238 242 20 61 [email protected] Vista y Sao Nicolau Viceconsulado Honorario en Mindelo D. Silvestre Beneditino - con jurisdicción en San Vicente y Vicecónsul honorario +238 231 74 81 [email protected] Evora Santo Antão Oficina Técnica de Cooperación de la Dª Patricia Ramos Coordinadora General +238 262 33 93 / 90. [email protected] AECID Fernández INSTITUCIONES / ORGANISMOS INTERNACIONALES Delegación de la Unión Europea en • Dª Sofia Moreira • Embajadora + 238 262 13 92/93/94 [email protected] Cabo Verde • D. Pedro Campo • Jefe de Cooperación Institución Nombre Cargo Teléfono Email/Web Organización de Naciones Unidas en E-mail [email protected] Dª Ana Graça Coordinadora General +238 260 96 00 / 58 Cabo Verde Web www.caboverde.un.org Instituto Camões - Centro de Língua E-mail [email protected] +238 262 85 22 Portuguesa na Cidade da Praia Web www.clp-camoes-cv.com Agencia Luxemburguesa para la E-mail [email protected] +238 262 47 37 Cooperación al Desarrollo (LuxDev) Web www.caboverde.luxdev.lu Institución Dirección Teléfono Email/Web GOBIERNO DE CABO VERDE Palácio do Governo, CP nº 304, Várzea, Cidade da Presidencia del Gobierno www.governo.cv Praia, Cabo Verde Vice-Presidencia y Ministerio de Av.
  • Tracers of Uplift and Subsidence in the Cape Verde Archipelago

    Tracers of Uplift and Subsidence in the Cape Verde Archipelago

    Tracers of uplift and subsidence in the Cape Verde Archipelago electronic supplement Ramalho*, R.; Helffrich, G.; Schmidt, D.; Vance, D. Department of Earth Sciences, University of Bristol, Wills Memorial Building Bristol, BS8 1RJ, UK *Corresponding author: [email protected]. 1 Introduction This an electronic supplement of the paper ”Tracers of uplift and subsidence in the Cape Verde Archipelago”. The objective of this supplement is to provide more detailed information on the volcanostratigraphy of some of the Cape Verde islands mentioned in the main text, and a detailed description of key palaeo-markers of relative sea-level height used to track the history of vertical movements affecting those islands. 2 Palaeo-markers of sea-level in the Cape Verde islands 2.1 Sal Sal’s volcanostratigraphy comprises (Silva et al. 1990; Torres et al. 2002a): Ancient Eruptive Complex; Principal Eruptive Formation; Ponta do Altar-Baleia Complex; Conglomerate Brec- 1 cia; Ribeira da Fragata Formation; Serra Negra Eruptive Formation; Monte Grande-Pedra Lume Formation; and Quaternary Sediments (see Figure S1, and Table 1 in the main text). 2.1.1 The Ancient Eruptive Complex The Ancient Eruptive Complex constitutes the basement unit and is profoundly eroded and weathered. It occurs mainly in the central part of the island where it reaches the maximum elevation of ∼ 60 m asl. Silva et al. (1990) and Torres et al. (2002b) describe the Ancient Eruptive Complex as a complex sequence of formations mostly comprising hydrovolcanic prod- ucts of effusive and explosive nature. The whole unit is intensively intruded by dykes - up to 95% of the outcropping area - and small plutonic bodies, a condition that in conjunction with the advanced state of weathering exhibited by its products is an obstacle for solid event reconstructions.