DOCSLIB.ORG

Recombinant Human S100A16 Description Product Info

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Recombinant Human S100A16 Description Product Info 9853 Pacific Heights Blvd. Suite D. San Diego, CA 92121, USA Tel: 858-263-4982 Email: [email protected] 32-8883: Recombinant Human S100A16 Gene : S100A16 Gene ID : 140576 Uniprot ID : Q96FQ6 Description Source: E. coli. MW :11.8kD. Recombinant Human Protein S100-A16 is produced by our E.coli expression system and the target gene encoding Met1-Ser103 is expressed. S100A16 is a member of S100 protein superfamily that carries calcium-binding EF-handmotifs. S100 proteins are cell-and tissue-specific and are involved in many intra-and extracellular processes hrough interacting with specific target proteins. S100A16 expression was found to be astrocyte-specific. The S100A16 protein was found to accumulate within nucleoli and to translocate to the cytoplasm in response to Ca(2+) stimulation. The homodimeric structure of human S100A16 in the apo state has been obtained both in the solid state and insolution, resulting in good agreement between the structures with the exception of two loop regions. The homodimeric solution structure of human S100A16 was also calculated in the calcium(II)- bound form. Immunoprecipitation analysis revealed that S100A16 could physically interact with tumor suppress or protein p53, also a known inhibitor of adipogenesis. Overexpression or RNA interference-initiated reduction of S100A16 led to the inhibition or activation of the expression of p53-responsivegenes, respectively. S100A16 protein is a novel adipogenesis-promoting factor. Product Info Amount : 10 µg / 50 µg Content : Lyophilized from a 0.2 µm filtered solution of 20mM Tris, 500mM NaCl, pH8.0. Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Storage condition : Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. Amino Acid : MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLD ANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS Application Note Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. For Research Use Only. Not for use in diagnostic/therapeutics procedures..
Load more

Recommended publications
  • S41467-020-18249-3.Pdf
    ARTICLE https://doi.org/10.1038/s41467-020-18249-3 OPEN Pharmacologically reversible zonation-dependent endothelial cell transcriptomic changes with neurodegenerative disease associations in the aged brain Lei Zhao1,2,17, Zhongqi Li 1,2,17, Joaquim S. L. Vong2,3,17, Xinyi Chen1,2, Hei-Ming Lai1,2,4,5,6, Leo Y. C. Yan1,2, Junzhe Huang1,2, Samuel K. H. Sy1,2,7, Xiaoyu Tian 8, Yu Huang 8, Ho Yin Edwin Chan5,9, Hon-Cheong So6,8, ✉ ✉ Wai-Lung Ng 10, Yamei Tang11, Wei-Jye Lin12,13, Vincent C. T. Mok1,5,6,14,15 &HoKo 1,2,4,5,6,8,14,16 1234567890():,; The molecular signatures of cells in the brain have been revealed in unprecedented detail, yet the ageing-associated genome-wide expression changes that may contribute to neurovas- cular dysfunction in neurodegenerative diseases remain elusive. Here, we report zonation- dependent transcriptomic changes in aged mouse brain endothelial cells (ECs), which pro- minently implicate altered immune/cytokine signaling in ECs of all vascular segments, and functional changes impacting the blood–brain barrier (BBB) and glucose/energy metabolism especially in capillary ECs (capECs). An overrepresentation of Alzheimer disease (AD) GWAS genes is evident among the human orthologs of the differentially expressed genes of aged capECs, while comparative analysis revealed a subset of concordantly downregulated, functionally important genes in human AD brains. Treatment with exenatide, a glucagon-like peptide-1 receptor agonist, strongly reverses aged mouse brain EC transcriptomic changes and BBB leakage, with associated attenuation of microglial priming. We thus revealed tran- scriptomic alterations underlying brain EC ageing that are complex yet pharmacologically reversible.
    [Show full text]
  • Epidermal Wnt Signalling Regulates Transcriptome Heterogeneity and Proliferative Fate in Neighbouring Cells
    bioRxiv preprint doi: https://doi.org/10.1101/152637; this version posted June 20, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Title: Epidermal Wnt signalling regulates transcriptome heterogeneity and proliferative fate in neighbouring cells Arsham Ghahramani1,2 , Giacomo Donati2,3 , Nicholas M. Luscombe1,4,5,† and Fiona M. Watt2,† 1The Francis Crick Institute, 1 Midland Road, London NW1 1AT, United Kingdom 2King’s College London, Centre for Stem Cells and Regenerative Medicine, 28th 8 Floor, Tower Wing, Guy’s Hospital, Great Maze Pond, London SE1 9RT, United Kingdom 3Department of Life Sciences and Systems Biology, University of Turin, Via Accademia Albertina 13, 10123 Torino, Italy 4UCL Genetics Institute, University College London, London WC1E 6BT, United Kingdom 5Okinawa Institute of Science & Technology Graduate University, Okinawa 904-0495, Japan † Correspondence to: [email protected] and [email protected] Abstract: Canonical Wnt/beta-catenin signalling regulates self-renewal and lineage selection within the mouse epidermis. Although the transcriptional response of keratinocytes that receive a Wnt signal is well characterised, little is known about the mechanism by which keratinocytes in proximity to the Wnt- receiving cell are co-opted to undergo a change in cell fate. To address this, we performed single-cell mRNA-Seq on mouse keratinocytes co-cultured with and without the presence of beta-catenin activated neighbouring cells. We identified seven distinct cell states in cultures that had not been exposed to the beta-catenin stimulus and show that the stimulus redistributes wild type subpopulation proportions.
    [Show full text]
  • Mouse S100a16 Conditional Knockout Project (CRISPR/Cas9)
    https://www.alphaknockout.com Mouse S100a16 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a S100a16 conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The S100a16 gene (NCBI Reference Sequence: NM_026416 ; Ensembl: ENSMUSG00000074457 ) is located on Mouse chromosome 3. 3 exons are identified, with the ATG start codon in exon 2 and the TAG stop codon in exon 3 (Transcript: ENSMUST00000098910). Exon 2~3 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse S100a16 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP24-204K10 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 2~3 covers 100.0% of the coding region. Start codon is in exon 2, and stop codon is in exon 3. The size of intron 1 for 5'-loxP site insertion: 676 bp. The size of effective cKO region: ~1882 bp. The cKO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 2 3 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Homology arm Exon of mouse S100a16 cKO region loxP site Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats.
    [Show full text]
  • S100 Calcium Binding Protein Family Members Associate with Poor Patient Outcome and Response to Proteasome Inhibition in Multiple Myeloma
    fcell-09-723016 August 10, 2021 Time: 12:24 # 1 ORIGINAL RESEARCH published: 16 August 2021 doi: 10.3389/fcell.2021.723016 S100 Calcium Binding Protein Family Members Associate With Poor Patient Outcome and Response to Proteasome Inhibition in Multiple Myeloma Minxia Liu1†, Yinyin Wang2†, Juho J. Miettinen1, Romika Kumari1, Muntasir Mamun Majumder1, Ciara Tierney3,4, Despina Bazou3, Alun Parsons1, Edited by: Minna Suvela1, Juha Lievonen5, Raija Silvennoinen5, Pekka Anttila5, Paul Dowling4, Lawrence H. Boise, Peter O’Gorman3, Jing Tang2 and Caroline A. Heckman1* Emory University, United States Reviewed by: 1 Institute for Molecular Medicine Finland – FIMM, HiLIFE – Helsinki Institute of Life Science, iCAN Digital Cancer Medicine Paola Neri, Flagship, University of Helsinki, Helsinki, Finland, 2 Research Program in Systems Oncology, Faculty of Medicine, University University of Calgary, Canada of Helsinki, Helsinki, Finland, 3 Department of Hematology, Mater Misericordiae University Hospital, Dublin, Ireland, Linda B. Baughn, 4 Department of Biology, National University of Ireland, Maynooth, Ireland, 5 Department of Hematology, Helsinki University Mayo Clinic, United States Hospital Comprehensive Cancer Center, University of Helsinki, Helsinki, Finland *Correspondence: Caroline A. Heckman Despite several new therapeutic options, multiple myeloma (MM) patients experience caroline.heckman@helsinki.fi multiple relapses and inevitably become refractory to treatment. Insights into drug †These authors have contributed equally to this work and share first resistance mechanisms may lead to the development of novel treatment strategies. authorship The S100 family is comprised of 21 calcium binding protein members with 17 S100 genes located in the 1q21 region, which is commonly amplified in MM. Dysregulated Specialty section: This article was submitted to expression of S100 family members is associated with tumor initiation, progression and Cell Death and Survival, inflammation.
    [Show full text]
  • Zimmer Cell Calcium 2013 Mammalian S100 Evolution.Pdf
    Cell Calcium 53 (2013) 170–179 Contents lists available at SciVerse ScienceDirect Cell Calcium jo urnal homepage: www.elsevier.com/locate/ceca Evolution of the S100 family of calcium sensor proteins a,∗ b b,1 b Danna B. Zimmer , Jeannine O. Eubanks , Dhivya Ramakrishnan , Michael F. Criscitiello a Center for Biomolecular Therapeutics and Department of Biochemistry & Molecular Biology, University of Maryland School of Medicine, 108 North Greene Street, Baltimore, MD 20102, United States b Comparative Immunogenetics Laboratory, Department of Veterinary Pathobiology, College of Veterinary Medicine & Biomedical Sciences, Texas A&M University, College Station, TX 77843-4467, United States a r t i c l e i n f o a b s t r a c t 2+ Article history: The S100s are a large group of Ca sensors found exclusively in vertebrates. Transcriptomic and genomic Received 4 October 2012 data from the major radiations of mammals were used to derive the evolution of the mammalian Received in revised form 1 November 2012 S100s genes. In human and mouse, S100s and S100 fused-type proteins are in a separate clade from Accepted 3 November 2012 2+ other Ca sensor proteins, indicating that an ancient bifurcation between these two gene lineages Available online 14 December 2012 has occurred. Furthermore, the five genomic loci containing S100 genes have remained largely intact during the past 165 million years since the shared ancestor of egg-laying and placental mammals. Keywords: Nonetheless, interesting births and deaths of S100 genes have occurred during mammalian evolution. Mammals The S100A7 loci exhibited the most plasticity and phylogenetic analyses clarified relationships between Phylogenetic analyses the S100A7 proteins encoded in the various mammalian genomes.
    [Show full text]
  • UNIVERSITY of CALIFORNIA, IRVINE Gene Regulatory
    UNIVERSITY OF CALIFORNIA, IRVINE Gene Regulatory Mechanisms in Epithelial Specification and Function DISSERTATION submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in Biomedical Sciences by Rachel Herndon Klein Dissertation Committee: Professor Bogi Andersen, M.D., Chair Professor Xing Dai, Ph.D. Professor Anand Ganesan, M.D. Professor Ali Mortazavi, Ph.D Professor Kyoko Yokomori, Ph.D 2015 © 2015 Rachel Herndon Klein DEDICATION To My parents, my sisters, my husband, and my friends for your love and support, and to Ben with all my love. ii TABLE OF CONTENTS Page LIST OF FIGURES iv LIST OF TABLES vi ACKNOWLEDGMENTS vii CURRICULUM VITAE viii-ix ABSTRACT OF THE DISSERTATION x-xi CHAPTER 1: INTRODUCTION 1 CHAPTER 2: Cofactors of LIM domain (CLIM) proteins regulate corneal epithelial progenitor cell function through noncoding RNA H19 22 CHAPTER 3: KLF7 regulates the corneal epithelial progenitor cell state acting antagonistically to KLF4 49 CHAPTER 4: GRHL3 interacts with super enhancers and the neuronal repressor REST to regulate keratinocyte differentiation and migration 77 CHAPTER 5: Methods 103 CHAPTER 6: Summary and Conclusions 111 REFERENCES 115 iii LIST OF FIGURES Page Figure 1-1. Structure and organization of the epidermis. 3 Figure 1-2. Structure of the limbus, and cornea epithelium. 4 Figure 1-3. Comparison of H3K4 methylating SET enzymes between S. cerevisiae, D. melanogaster, and H. sapiens. 18 Figure 1-4. The WRAD complex associates with Trithorax SET enzymes. 18 Figure 1-5. Model for GRHL3, PcG, and TrX –mediated regulation of epidermal differentiation genes. 19 Figure 2-1. Microarray gene expression analysis of postnatal day 3 (P3) whole mouse corneas reveals genes and pathways with altered expression in K14-DN-Clim mice.
    [Show full text]
  • 1 SUPPLEMENTAL MATERIALS a Transcriptome Database For
    SUPPLEMENTAL MATERIALS A Transcriptome Database for Astrocytes, Neurons, and Oligodendrocytes: A New Resource for Understanding Brain Development and Function JD Cahoy, B Emery, A Kaushal, LC Foo, JL Zamanian, KS Christopherson, Y Xing, JL Lubischer, P Krieg, SA Krupenko, WJ Thompson, BA Barres Supplemental Experimental Procedures The purification procedures are based on previously described dissociation (Huettner and Baughman, 1986; Segal et al., 1998) and immunopanning purification protocols for other cell types (Barres et al., 1988; Barres et al., 1992; Meyer-Franke et al., 1995). All aspects of the panning and FACS purification procedures are summarized below. Preparation Of Mouse Forebrain Cell Suspensions Six to eight mice from a wild-type litter (C57BL/6, Charles River, Wilmington, MA) or S100- EGFP transgenic litter (C57BL/6 x DBA (F1), Kosmos line, Zuo et al., 2004) were used. The forebrain was isolated by removal of the olfactory lobes, cerebellum, and midbrain/hindbrain structures by crude dissection, and the tissue was diced with a curved-blade surgical scalpel (Feather, Osaka, Japan, GRF-2976 #10). To isolate cerebral cortical gray matter astrocytes, the brain was sliced in 2-3 1 Page 1 of 58 mm coronal sections and the cerebral cortex was carefully dissected away from the ventral white matter tracks. This tissue was enzymatically dissociated to make a suspension of single cells, essentially as described by Huettner and Baughman (Huettner and Baughman, 1986; Segal et al., 1998). Briefly, the tissue was incubated at 33 °C for 80 minutes (90 minutes for animals P16 and older) in 20 ml of a papain solution (20 U/ml, Worthington, Lakewood, NJ, LS03126) prepared in dissociation buffer with EDTA (0.5 mM), and L-cysteine-HCl (necessary to activate the papain, 1 mM, Sigma, St.
    [Show full text]
  • Prediction of EF-Hand Calcium Binding Proteins and Analysis of Bacterial EF-Hand Proteins
    Prediction of EF-hand Calcium Binding Proteins and Analysis of Bacterial EF-Hand Proteins Yubin Zhou, Wei Yang, Michael Kirberger, Hsiau-Wei Lee, Gayatri Ayalasomayajula, and Jenny J. Yang* Department of Chemistry, Georgia State University, Atlanta, GA 30303, USA *To whom correspondence should be addressed Jenny J. Yang Department of Chemistry, Georgia State University University Plaza, Atlanta, Georgia 30302 USA Tel: 404-651-4620 Fax: 404-651-2751 Email: [email protected] Running title: Prediction of EF-hand Ca(II)-binding proteins Key words: EF-hand; S100; pattern search; bacterial genomes; prediction; evolution 1 Abstract The EF-hand proteins with a helix-loop-helix Ca2+ binding motif are one of the largest protein families and are involved in numerous biological processes. To facilitate the understanding of the role of Ca2+ in biological systems using genomic information, we report herein our improvement on the pattern serach method for the identification of EF-hand and EF-like Ca2+-binding proteins. The canonical EF-hand patterns are modified to cater to different flanking structural elements. In addition, based on the conserved sequence of both the N- and C-terminal EF-hands within S100 and S100-like proteins, a new signature profile has been established to allow for the identification of pseudo EF-hand and S100 proteins from genomic information. The new patterns have a positive predictive value of 99% and a sensitivity of 96% for pseudo EF-hands. Furthermore, using the developed patterns, we have identified zero pseudo EF-hand motif and 467 canonical EF-hand Ca2+ binding motifs with diverse cellular functions in the bacteria genome.
    [Show full text]
  • Whole-Genome Association Analyses of Sleep-Disordered Breathing Phenotypes in the NHLBI Topmed Program Brian E
    Cade et al. Genome Medicine (2021) 13:136 https://doi.org/10.1186/s13073-021-00917-8 RESEARCH Open Access Whole-genome association analyses of sleep-disordered breathing phenotypes in the NHLBI TOPMed program Brian E. Cade1,2,3* , Jiwon Lee1, Tamar Sofer1,2, Heming Wang1,2,3, Man Zhang4, Han Chen5,6, Sina A. Gharib7, Daniel J. Gottlieb1,2,8, Xiuqing Guo9, Jacqueline M. Lane1,2,3,10, Jingjing Liang11, Xihong Lin12, Hao Mei13, Sanjay R. Patel14, Shaun M. Purcell1,2,3, Richa Saxena1,2,3,10, Neomi A. Shah15, Daniel S. Evans16, Craig L. Hanis5, David R. Hillman17, Sutapa Mukherjee18,19, Lyle J. Palmer20, Katie L. Stone16, Gregory J. Tranah16, NHLBI Trans-Omics for Precision Medicine (TOPMed) Consortium, Gonçalo R. Abecasis21,EricA.Boerwinkle5,22, Adolfo Correa23,24, L. Adrienne Cupples25,26,RobertC.Kaplan27, Deborah A. Nickerson28,29,KariE.North30,BruceM.Psaty31,32, Jerome I. Rotter9,StephenS.Rich33, Russell P. Tracy34, Ramachandran S. Vasan26,35,36, James G. Wilson37,XiaofengZhu11, Susan Redline1,2,38 andTOPMedSleepWorkingGroup Abstract Background: Sleep-disordered breathing is a common disorder associated with significant morbidity. The genetic architecture of sleep-disordered breathing remains poorly understood. Through the NHLBI Trans-Omics for Precision Medicine (TOPMed) program, we performed the first whole-genome sequence analysis of sleep-disordered breathing. Methods: The study sample was comprised of 7988 individuals of diverse ancestry. Common-variant and pathway analyses included an additional 13,257 individuals. We examined five complementary traits describing different aspects of sleep-disordered breathing: the apnea-hypopnea index, average oxyhemoglobin desaturation per event, average and minimum oxyhemoglobin saturation across the sleep episode, and the percentage of sleep with oxyhemoglobin saturation < 90%.
    [Show full text]
  • Supporting Information
    Supporting Information Guo et al. 10.1073/pnas.1208807109 SI Materials and Methods was confirmed by genotyping, sequencing the mutant transcript Cell Culture and Reagents. Human colorectal carcinoma cell line (RT-PCR), and anti-MLL2 immunoblot. HCT116 (American Type Culture Collection) was cultured in McCoy’s 5A medium (Gibco) with 10% (vol/vol) FBS (HyClone). Nuclear Extraction, Immunoprecipitation, and Western Blot. The Cells were grown up to 70% confluency in 100 × 20 mm cell- protocol for nuclear extraction was previously described (2). culture dishes (Corning) for genomic DNA, RNA, or nuclear Chemicals were ordered from Sigma unless otherwise stated. − − fl protein extraction. HCT116-MLL2 / cells were maintained in Brie y, parental HCT116 cells or HCT116 cells expressing Flag- complete medium containing 0.5 mg/mL Geneticin. HEK 293FT MLL2 fusion protein were harvested, washed with buffer A [10 · cells (Invitrogen) were cultured in DMEM with high glucose mM Hepes KOH (EMD), pH 7.9, 1.5 mM magnesium chloride, fl (Gibco) containing 10% (vol/vol) FBS and used for rAAV tar- 10 mM potassium chloride, 0.5 mM DTT, 5 mM sodium uoride, μ geting virus production as previously described (1). Exponentially 2 M sodium orthovanadate (MP Biomedical), protease inhibitor growing cells were used for ChIP and microarray gene expression mixture (Roche)], and lysed in buffer A with 0.1% Nonidet P-40. × profiling. For retinoic acid treatment, cells in six-well plates were The nuclei were collected by centrifugation (4 °C, at 18,000 g · treated with 1 μM all-trans retinoic acid (Sigma) for 48 h before for 30 min) and lysed in high-salt buffer C [20 mM Hepes KOH, cells were harvested for RNA preparation.
    [Show full text]
  • Immune Cells in Spleen and Mucosa + CD127 Neg Production of IL-17
    Downloaded from http://www.jimmunol.org/ by guest on September 26, 2021 neg is online at: average * The Journal of Immunology published online 21 June 2010 Immune Cells in Spleen and Mucosa from submission to initial decision + 4 weeks from acceptance to publication TLR5 Signaling Stimulates the Innate Production of IL-17 and IL-22 by CD3 CD127 Laurye Van Maele, Christophe Carnoy, Delphine Cayet, Pascal Songhet, Laure Dumoutier, Isabel Ferrero, Laure Janot, François Erard, Julie Bertout, Hélène Leger, Florent Sebbane, Arndt Benecke, Jean-Christophe Renauld, Wolf-Dietrich Hardt, Bernhard Ryffel and Jean-Claude Sirard http://www.jimmunol.org/content/early/2010/06/21/jimmun ol.1000115 J Immunol Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2010/06/21/jimmunol.100011 5.DC1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 26, 2021. Published June 21, 2010, doi:10.4049/jimmunol.1000115
    [Show full text]
  • The EF-Handome: Combining Comparative Genomic Study Using Famdbtool, a New Bioinformatics Tool, and the Network of Expertise of the European Calcium Society
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Biochimica et Biophysica Acta 1742 (2004) 179–183 http://www.elsevier.com/locate/bba Review The EF-Handome: combining comparative genomic study using FamDBtool, a new bioinformatics tool, and the network of expertise of the European Calcium Society Jacques Haiech*, Saad B.M. Moulhaye, Marie-Claude Kilhoffer UMR 7034 CNRS and IFR 85 Gilbert Laustriat, 74, route du Rhin, 67401 ILLKIRCH France Received 9 August 2004; received in revised form 1 October 2004; accepted 4 October 2004 Available online 20 October 2004 Abstract By combining a bioinformatics tool (FamDBTool) and the expertise of a network of calcium binding proteins specialists (European Calcium Society), we aim to accelerate and to rationalize the curation of the public general biological database such as Swissprot and Entrez Gene with respect to specific protein families. In this paper, we show the feasibility of such rationale in order to set and to curate the human, mouse and rat sets of EF-Hand genes, the EF-Handome. D 2004 Elsevier B.V. All rights reserved. Keywords: EF-Handome; FamDBtool; European Calcium Society 1. Introduction in the human genome. Most of these genes present orthologs in mouse and rat. The proteins coded by these Calcium is one of the most important second mes- genes are divided in several subfamilies based on sequence sengers in eukaryotic cells, and probably also in similarities. prokaryotic cells [1,2]. Upon cellular stimulation, the One of the largest subfamily is constituted by the S100 cytosolic calcium concentration undergoes either a tran- proteins (see http://www.unizh.ch/ ~kispi/clinchem/calzium/ sient increase or a set of calcium oscillations.
    [Show full text]