NR5A1 antibody - middle region (ARP45619_P050) Data Sheet

Product Number ARP45619_P050 Product Name NR5A1 antibody - middle region (ARP45619_P050) Size 50ug Symbol NR5A1 Alias Symbols AD4BP; ELP; FTZ1; FTZF1; SF-1; SF1; POF7; SPGF8; SRXY3 Nucleotide Accession# NM_004959 Size (# AA) 461 amino acids Molecular Weight 52kDa Product Format Lyophilized powder NCBI Gene Id 2516 Host Rabbit Clonality Polyclonal Official Gene Full Name Nuclear subfamily 5, group A, member 1 Gene Family NR This is a rabbit polyclonal antibody against NR5A1. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA Target Reference Clark,H.F., Mol. Cell. Biochem. 307 (1-2), 65-71 (2008) NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. The protein encoded by this gene Description of Target is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. AR, CTNNB1, EDF1, GATA4, GTF2B, JUN, MAPK1, NCOA1, NFKB2, NFYA, NR0B1, NRIP1, PIAS1, PITX1, Partner PNRC2, PROX1, SMARCD3, , SOX8, SOX9, SP1, TBX19, TRERF1, ZNF653, CTNNB1, EDF1, GATA4, GTF2B, JUN, NCOA1, NR0B1, NRIP1, PITX1, SOX9, SP1, TRERF1, ZNF653 Reconstitution and Add 50 ul of distilled water. Final anti-NR5A1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-NR5A1 antibody is Catalog # AAP45619 (Previous Catalog # AAPP11902) Immunogen The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1 Swissprot Id Q13285 Protein Name Protein Accession # NP_004950 Purification Affinity Purified Species Reactivity Human, Pig, Guinea pig, Dog, Horse, Rat, Rabbit, Bovine, Sheep Application IHC, WB Predicted Homology Based on Immunogen Human: 100%; Pig: 92%; Guinea pig: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Sheep: 79%; Bovine: 79%; Rabbit: 79% Sequence

Human THP-1 WB Suggested Anti-NR5A1 Antibody Titration: 0.2- 1 ug/ml ELISA Titer: 1:1562500 Positive Control: THP-1 cell lysate Image 1

______

This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.