Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic MYCBP monoclonal antibody (M13), clone 1B12

Catalog # : H00026292-M13 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Transfected lysate) Description: MYCBP.

Immunogen: MYCBP (NP_036465.2, 34 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: LYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENK KLKAKLAQYEPPQEEKRAE enlarge

Host: Mouse Western Blot (Recombinant protein) Reactivity: Human Sandwich ELISA (Recombinant Isotype: IgG2a Kappa protein)

Quality Control Antibody Reactive Against Recombinant Protein. Testing:

enlarge

ELISA

Western Blot detection against Immunogen (33.44 KDa) .

Storage Buffer: In 1x PBS, pH 7.4

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download

Datasheet: Download

Applications

Western Blot (Transfected lysate)

Page 1 of 3 2016/5/23 Western Blot analysis of MYCBP expression in transfected 293T cell line by MYCBP monoclonal antibody (M13), clone 1B12.

Lane 1: MYCBP transfected lysate(12 KDa). Lane 2: Non-transfected lysate. Protocol Download

Western Blot (Recombinant protein) Protocol Download

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged MYCBP is 0.1 ng/ml as a capture antibody. Protocol Download

ELISA

Gene Information

Entrez GeneID: 26292

GeneBank NM_012333 Accession#:

Protein NP_036465.2 Accession#:

Gene Name: MYCBP

Gene Alias: AMY-1

Gene c-myc binding protein Description:

Omim ID: 606535

Gene Ontology: Hyperlink

Gene Summary: The MYCBP gene encodes a protein that binds to the N-terminal region of MYC (MIM 190080) and stimulates the activation of E box-dependent transcription by MYC.[supplied by OMIM

Other OTTHUMP00000000543,associate of myc-1 Designations: Page 2 of 3 2016/5/23 Related Disease Tobacco Use Disorder

Page 3 of 3 2016/5/23