DOCSLIB.ORG

T2DM: KOL Insight Contents

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
T2DM: KOL Insight Contents T2DM: KOL Insight Contents T2DM: KOL Insight Report Overview > Pipeline Programmes > Marketed Therapies > KOLs Interviewed > Methodology > Research Objectives > Ongoing Benefits > 2 Report Overview T2DM: KOL Insight Instead of asking KOLs generic questions about the strengths and weaknesses of current and pipeline therapies, Therapy Trends analysts focus the research on the key battlegrounds for market share, i.e. the emphasis is on segments of the market which are likely to have the greatest impact going forward. We are able to spend more time asking very in-depth questions about specific products ensuring more valuable insights are generated. 3 Pipeline Therapies T2DM: KOL Insight Efficacy At-a-glance view of key data on late-stage Tolerability pipeline therapies. For most of the programmes Safety listed below, the report includes tables covering: Key Trials to Watch GLP-1 agonists Basal insulin Semaglutide franchise (oral & once weekly NN1218/FIAsp (insulin aspart; Novo Nordisk) injectable formulations; Novo Nordisk) ITCA 650 (exenatide; Intarcia Therapeutics) Basal insulin/GLP-1 agonist LixiLan (lixisenatide/Insulin glargine; Sanofi) SGLT-2 inhibitor Ertugliflozin (PF04971729; Pfizer/Merck & Co.) 4 Marketed Therapies T2DM: KOL Insight Commercial Profile At-a-glance view of key data on approved and off-label therapies. For each therapy listed Efficacy below, the report includes tables covering: Tolerability GLP-1 agonists Insulins Safety Lyxumia/Adlynx (lixisenatide; Sanofi) Tresiba (insulin degludec; Novo Nordisk) Tanzeum/ Eperzan (albiglutide; GSK) Toujeo/Optisulin (insulin glargine; Sanofi) Trulicity (delaglutide; Eli Lilly) Abasaglar/Basaglar (insulin glargine biosimilar; Eli Lilly/Boehringer Ingelheim) DPP-4 inhibitors Onglyza (saxagliptin; AstraZeneca) Fixed Dose Combinations (FDCs) Nesina/Vipidia (alogliptin; Takeda) Synjardy (empagliflozin/metformin [SGLT-2i/Biguanide]; Tradjenta/Trajenta (linagliptin; Boehringer Boehringer Ingelheim) Ingelheim) Qtern/SaxaDapa (saxagliptin/dapagliflozin [SGLT- Zafatek (trelagliptin; Takeda/Furiex) 2i/DPP-4i]; AstraZeneca) Glyxambi (empagliflozin/linagliptin [SGLT-2i /DPP-4i]; SGLT-2 inhibitor Boehringer Ingelheim/Eli Lilly) Farxiga/Forxiga (dapagliflozin; AstraZeneca/ Xultophy/IDegLira (insulin degludec/liraglutide Bristol-Myers Squibb) [insulin/GLP-1 agonist]; Novo Nordisk) Invokana (canagliflozin; Johnson & Johnson) Ryzodeg (insulin degludec/insulin aspart [recombinant Jardiance (empagliflozin; Boehringer Ingelheim) human insulin]; Novo Nordisk) 5 KOLs Interviewed T2DM: KOL Insight KOLs from North America KOLs from EU Jay S. Skyler, MD, MACP. Professor of Medicine, Professor Antonio Ceriello, MD. Head of the Research Paediatrics and Psychology and Deputy Director, Department on Diabetes and CVD, Institut Clinical Research and Academic Programmes, d'Investigacions Biomèdiques August Pi i Sunyer Diabetes Research Institute, University of Miami (IDIBAPS), Barcelona, Spain. Miller School of Medicine. Jens Holst, MD, PhD. Professor of medical physiology, Etie Moghissi, MD, FACP, FACE. Associate Clinical University of Copenhagen, Denmark. Professor of Medicine, UCLA David Geffen School of Medicine and Consultant in Diabetes, Endocrinology Bernard Charbonnel, MD. Professor of Endocrinology and Metabolism in Marina del Rey California, USA. and Metabolic Diseases, University of Nantes, France. John E. Anderson, MD. Past President, Medicine & Prof. Marc Y. Donath. Professor for Endocrinology, Head Science, American Diabetes Association (ADA), USA. of the Clinic for Endocrinology, Diabetes and Metabolism at the University Hospital of Basel, George Grunberger, MD, FACP, FACE. Chairman, Switzerland. Grunberger Diabetes Institute (GDI) in Bloomfield Hills, Michigan, USA. Prof. David Matthews, MA (Oxon), DPhil, BM, BCh, FRCP. Professor of Diabetes Medicine, University of Dr. Silvio Inzucchi MD. Professor of Medicine, Yale Oxford, and Medical Tutor & Dean at Harris Manchester University School of Medicine, New Haven, USA. College, Oxford, UK. Prof. Carol Wysham, MD. Research Professor, German KOL (Anonymous). Professor and head of Washington State University & Assistant Clinical Clinical Research in Diabetes at a leading university Professor of Medicine, University of Washington hospital in Germany. School of Medicine, USA. 6 Methodology T2DM: KOL Insight Secondary Research Detailed analysis of key marketed products and pipeline programmes, including key clinical data and trials Primary Research Interviews with 12 of the world’s foremost KOLs Analysis A balanced and independent qualitative review which clearly presents the factors impacting current and future product positioning and competitiveness 7 Methodology T2DM: KOL Insight Secondary Research: Analysis of key clinical data and ongoing trials enables the analyst to develop a robust understanding of each drug and develop research objectives which will answer important business questions about current and future product positioning and competitiveness. 8 Methodology T2DM: KOL Insight Primary Research: The KOLs are selected based on criteria which ensure we are getting feedback from the most influential leaders in the field of T2DM such as: • greater than 10 years experience in the field • greater than 30 percent of their time is spent treating patients • greater than 10 papers published in peer reviewed journals in the last 5 years • lead or principal investigator on clinical trials within last 5 years • has presented at major conferences at least 3 times in last 5 years • has recently served or currently serves as reviewer for peer reviewed scientific journals 9 Methodology T2DM: KOL Insight In-depth secondary research and (where appropriate) preparatory discussions with KOLs allows the analyst to develop the research objectives and discussion guide to ensure the research will gain valuable insights from KOLs and answer important business questions. The analyst interviewing KOLs constantly monitors the market, is aware of the latest news/data and has a track record of gaining valuable insights from KOLs. Analysis: Therapy Trends analysts review the interview transcripts and present an organised and balanced view of KOL opinions, adding clarity to complex issues. 10 Research Objectives T2DM: KOL Insight • Analysis of product attributes which confer preferred status • Product perception by the medical community • Clinical trials with greatest potential to impact prescribing trends • Therapy attributes needed to become the treatment of choice • The future role and potential impact of current and late-stage pipeline therapies • Mapping the future evolution of the treatment landscape 11 Ongoing Benefits T2DM: KOL Insight PLUS – 3 quarterly updates on the treatment landscape: FirstWord provides regular update bulletins in a disease area following the publication of a related Therapy Trends KOL Insight report. FirstWord analysts constantly monitor the market and at regular intervals obtain the reactions of KOLs to significant events, such as marketing approvals or the results of pivotal clinical trials. This continuous monitoring and frequent engagement with experts provides timely access to the strategic insights that support critical business decisions. Buy online now 12 .
Load more

Recommended publications
  • Treatment Patterns, Persistence and Adherence Rates in Patients with Type 2 Diabetes Mellitus in Japan: a Claims- Based Cohort Study
    Open access Research BMJ Open: first published as 10.1136/bmjopen-2018-025806 on 1 March 2019. Downloaded from Treatment patterns, persistence and adherence rates in patients with type 2 diabetes mellitus in Japan: a claims- based cohort study Rimei Nishimura,1 Haruka Kato,2 Koichi Kisanuki,2 Akinori Oh,2 Shinzo Hiroi,2 Yoshie Onishi,3 Florent Guelfucci,4 Yukio Shimasaki2 To cite: Nishimura R, Kato H, ABSTRACT Strengths and limitations of this study Kisanuki K, et al. Treatment Objective To determine real-world trends in antidiabetic patterns, persistence and drug use, and persistence and adherence, in Japanese ► This retrospective evaluation of administrative adherence rates in patients patients with type 2 diabetes mellitus (T2DM). with type 2 diabetes mellitus claims data (2011–2015) using the Japan Medical Design Retrospective evaluation of administrative claims in Japan: a claims-based Data Center (JMDC) and Medical Data Vision (MDV) data (2011–2015) using the Japan Medical Data Center cohort study. BMJ Open databases was conducted to determine real-world (JMDC) and Medical Data Vision (MDV) databases. 2019;9:e025806. doi:10.1136/ trends in antidiabetic drug use, and persistence and Setting Analysis of two administrative claims databases bmjopen-2018-025806 adherence, in Japanese patients with type 2 dia- for Japanese patients with T2DM. betes mellitus (T2DM); 40 908 and 90 421 patients ► Prepublication history and Participants Adults (aged ≥18 years) with an International additional material for this were included from the JMDC and MDV databases, Classification of Diseases, 10th Revision code of T2DM and paper are available online. To respectively. at least one antidiabetic drug prescription.
    [Show full text]
  • Renato Wilberto Zilli Eficácia Em Longo Prazo Das
    RENATO WILBERTO ZILLI EFICÁCIA EM LONGO PRAZO DAS GLIFLOZINAS VERSUS GLIPTINAS NO TRATAMENTO DO DIABETES MELLITUS TIPO 2 APÓS FALÊNCIA DA METFORMINA COMO MONOTERAPIA: REVISÃO SISTEMÁTICA E METANÁLISE EM REDE Tese apresentada ao Programa de Ciências Médicas da Faculdade de Medicina da Universidade de São Paulo para obtenção do título de Doutor em Ciências. Área de Concentração: Processos Imunes e Infecciosos Orientador: Prof. Dr. Fabiano Pinheiro da Silva (Versão corrigida. Resolução CoPGr 6018/11, de 13 de outubro de 2011. A versão original está disponível na Biblioteca da FMUSP) São Paulo 2017 Dados Internacionais de Catalogação na Publicação (CIP) Preparada pela Biblioteca da Faculdade de Medicina da Universidade de São Paulo ©reprodução autorizada pelo autor Zilli, Renato Wilberto Eficácia em longo prazo das gliflozinas versus gliptinas no tratamento do diabetes mellitus tipo 2 após falência da metformina como monoterapia : revisão sistemática e metanálise em rede / Renato Wilberto Zilli ‐‐ São Paulo, 2017. Tese(doutorado)--Faculdade de Medicina da Universidade de São Paulo. Programa de Ciências Médicas. Área de concentração: Processos Imunes e Infecciosos. Orientador: Fabiano Pinheiro da Silva. Descritores: 1.Diabetes mellitus tipo 2 2.Metanálise 3.Terapia combinada 4.Falha de tratamento 5.Metformina 6.Inibidores da dipeptidil peptidase IV 7.Transportador 2 de glucose‐sódio/inibidores 8.Empagliflozina 9.Dapagliflozina 10.Saxagliptina USP/FM/DBD ‐302/17 Esta tese de doutorado está de acordo com as seguintes normas, em vigor no momento desta publicação: Referências: adaptado de International Committee of Medical Journals Editors (Vancouver). Guia de apresentação e dissertações, teses e monografias. Elaborado por Anneliese Cordeiro da Cunha, Maria Julia de A.L.
    [Show full text]
  • Comparison of Clinical Outcomes and Adverse Events Associated with Glucose-Lowering Drugs in Patients with Type 2 Diabetes: a Meta-Analysis
    Online Supplementary Content Palmer SC, Mavridis D, Nicolucci A, et al. Comparison of clinical outcomes and adverse events associated with glucose-lowering drugs in patients with type 2 diabetes: a meta-analysis. JAMA. doi:10.1001/jama.2016.9400. eMethods. Summary of Statistical Analysis eTable 1. Search Strategies eTable 2. Description of Included Clinical Trials Evaluating Drug Classes Given as Monotherapy eTable 3. Description of Included Clinical Trials Evaluating Drug Classes Given as Dual Therapy Added to Metformin eTable 4. Description of Included Clinical Trials Evaluating Drug Classes Given as Triple Therapy When Added to Metformin Plus Sulfonylurea eTable 5. Risks of Bias in Clinical Trials Evaluating Drug Classes Given as Monotherapy eTable 6. Risks of Bias in Clinical Trials Evaluating Drug Classes Given as Dual Therapy Added to Metformin eTable 7. Risks of Bias in Clinical Trials Evaluating Drug Classes Given as Triple Therapy When Added to Metformin plus Sulfonylurea eTable 8. Estimated Global Inconsistency in Networks of Outcomes eTable 9. Estimated Heterogeneity in Networks eTable 10. Definitions of Treatment Failure Outcome eTable 11. Contributions of Direct Evidence to the Networks of Treatments eTable 12. Network Meta-analysis Estimates of Comparative Treatment Associations for Drug Classes Given as Monotherapy eTable 13. Network Meta-analysis Estimates of Comparative Treatment Associations for Drug Classes When Used in Dual Therapy (in Addition to Metformin) eTable 14. Network Meta-analysis Estimates of Comparative Treatment Effects for Drug Classes Given as Triple Therapy eTable 15. Meta-regression Analyses for Drug Classes Given as Monotherapy (Compared With Metformin) eTable 16. Subgroup Analyses of Individual Sulfonylurea Drugs (as Monotherapy) on Hypoglycemia eTable 17.
    [Show full text]
  • Trelagliptin (SYR-472, Zafatek), Novel Once- Weekly Treatment for Type 2 Diabetes, Inhibits Dipeptidyl Peptidase-4 (DPP-4) Via a Non-Covalent Mechanism
    RESEARCH ARTICLE Trelagliptin (SYR-472, Zafatek), Novel Once- Weekly Treatment for Type 2 Diabetes, Inhibits Dipeptidyl Peptidase-4 (DPP-4) via a Non-Covalent Mechanism Charles E. Grimshaw1*, Andy Jennings2, Ruhi Kamran1, Hikaru Ueno3, Nobuhiro Nishigaki3, Takuo Kosaka4, Akiyoshi Tani4, Hiroki Sano5, Yoshinobu Kinugawa5, Emiko Koumura5, Lihong Shi1¤, Koji Takeuchi3 a11111 1 Enzymology and Biophysical Chemistry, Takeda California, Inc., San Diego, California, United States of America, 2 Computational Sciences and Crystallography, Takeda California, Inc., San Diego, California, United States of America, 3 Cardiovascular and Metabolic Drug Discovery Unit, Pharmaceutical Research Division, Takeda Pharmaceutical Company Limited, Fujisawa, Kanagawa, Japan, 4 Bio-Molecular Research Laboratories, Pharmaceutical Research Division, Takeda Pharmaceutical Company Limited, Fujisawa, Kanagawa, Japan, 5 Takeda Development Center Japan, Takeda Pharmaceutical Company Limited, Osaka, Japan OPEN ACCESS ¤ Current address: Celgene Quanticel Research, San Diego, California, United States of America * Citation: Grimshaw CE, Jennings A, Kamran R, [email protected] Ueno H, Nishigaki N, Kosaka T, et al. (2016) Trelagliptin (SYR-472, Zafatek), Novel Once-Weekly Treatment for Type 2 Diabetes, Inhibits Dipeptidyl Peptidase-4 (DPP-4) via a Non-Covalent Mechanism. Abstract PLoS ONE 11(6): e0157509. doi:10.1371/journal. Trelagliptin (SYR-472), a novel dipeptidyl peptidase-4 inhibitor, shows sustained efficacy by pone.0157509 once-weekly dosing in type 2 diabetes patients. In this study, we characterized in vitro proper- Editor: Alessandro Giuffrè, National Research ties of trelagliptin, which exhibited approximately 4- and 12-fold more potent inhibition against Council of Italy (CNR), ITALY human dipeptidyl peptidase-4 than alogliptin and sitagliptin, respectively, and >10,000-fold Received: February 10, 2016 selectivity over related proteases including dipeptidyl peptidase-8 and dipeptidyl peptidase-9.
    [Show full text]
  • A Review on Impact of Glucose-Lowering Therapies on Cardiovascular System in Type 2 Diabetes Mellitus Patients
    World Journal of Advanced Research and Reviews, 2020, 07(01), 162–173 World Journal of Advanced Research and Reviews e-ISSN: 2581-9615, Cross Ref DOI: 10.30574/wjarr Journal homepage: https://www.wjarr.com (REVIEW ARTICLE) A review on impact of glucose-lowering therapies on cardiovascular system in type 2 diabetes mellitus patients Khatoon Ruquiyyah and Hoda Quaisul * Lloyd Institute of Management and Technology (Pharm), Plot No. 11, Knowledge Park-2, Greater Noida, India. Publication history: Received on 01 July 2020; revised on 10 July 2020; accepted on 12 July 2020 Article DOI: https://doi.org/10.30574/wjarr.2020.7.1.0242 Abstract The prevalence of diabetes mellitus (DM), a well-renowned metabolic diseases that comes under Top-10 lethal and incurable disease of the world, is increasing day by day. It is well-reported that the mortality rate of diabetic patients due to comorbidities is higher. Diabetic patients suffer from several cardiovascular events and such risk increases with an intermediate metabolite HbA1c. Control in HbA1c and lowering it does not appear to yield the same benefit on macrovascular endpoints, as observed for microvascular endpoints. Moreover, secondary diseases caused by diabetes mellitus are many and diabetic patients have been found to be more susceptible to diseases like cardiac injury. For instance, rosiglitazone has been found to cause myocardial infarction and ultimately leads to heart failure. Glucagon like Peptide -1 (GLP-1) agonists and sodium- glucose co-transporter 2 (SGLT2) inhibitors causes several cardiac side effects like myocardial infarction and stroke. In this concern, USFDA officially announced in2008 that all new glucose-lowering agents should be tested for its cardiac safety.
    [Show full text]
  • Risk of Any Hypoglycemia with New Antihyperglycemic Agents in Patients with Type 2 Diabetes: a Systematic Review and Meta-Analysis
    Risk of Any Hypoglycemia with New Antihyperglycemic Agents in Patients with Type 2 Diabetes: A Systematic Review and Meta-Analysis by Sanaz Kamalinia A thesis submitted in conformity with the requirements for the degree of Master of Science Institute of Medical Sciences University of Toronto © Copyright by Sanaz Kamalinia (2019) Risk of Any Hypoglycemia with New Antihyperglycemic Agents in Patients with Type 2 Diabetes: A Systematic Review and Meta- Analysis Sanaz Kamalinia Master of Science Institute of Medical Sciences University of Toronto 2019 Abstract Background : Evaluation of hypoglycemia risk relative to placebo with new antihyperglycemic agents (AHA) including the dipeptidyl peptidase-4 inhibitors (DPP4i), glucagon-like peptide-1 receptor agonists (GLP1RA) and sodium-glucose co-transporter- 2 inhibitors (SGLT2i) remains inconclusive. Objective: This systematic review and meta-analysis aimed to assess risk of any and severe hypoglycemia with new AHA relative to placebo by excluding studies with background sulfonylureas and insulin. Methods: Randomized, placebo-controlled studies, 12 weeks or greater in duration were considered for inclusion. Studies allowing background use of any other AHA, apart from metformin, were excluded. This study is registered with PROSPERO (CRD42018095458). Results: 141 studies included in the meta-analysis demonstrate that relative to placebo, risk of any and severe hypoglycemia did not significantly differ for any new AHA. ii Acknowledgments First and foremost, I wish to express my sincere gratitude to my program advisor committee members. To my supervisor Dr Tobe, thank you for accepting me as your student and presenting me with this challenge. I thoroughly enjoyed it. Especially given your positive words of encouragement and insightful guidance for every step of this journey.
    [Show full text]
  • Implications Current Drugs for Type 2 Diabetes Mellitus
    Pharmacology and therapeutic implications of current drugs for type 2 diabetes mellitus Abd A. Tahrani1,2, Anthony H. Barnett1,2 and Clifford J. Bailey3 Abstract |6[RG|FKCDGVGUOGNNKVWU 6&/ KUCINQDCNGRKFGOKEVJCVRQUGUCOCLQTEJCNNGPIGVQ JGCNVJECTGU[UVGOU+ORTQXKPIOGVCDQNKEEQPVTQNVQCRRTQCEJPQTOCNIN[ECGOKC YJGTG RTCEVKECN ITGCVN[DGPGHKVUNQPIVGTORTQIPQUGUCPFLWUVKHKGUGCTN[GHHGEVKXGUWUVCKPGFCPF UCHGV[EQPUEKQWUKPVGTXGPVKQP+ORTQXGOGPVUKPVJGWPFGTUVCPFKPIQHVJGEQORNGZRCVJQIGPGUKU QH6&/JCXGWPFGTRKPPGFVJGFGXGNQROGPVQHINWEQUGNQYGTKPIVJGTCRKGUYKVJEQORNGOGPVCT[ OGEJCPKUOUQHCEVKQPYJKEJJCXGGZRCPFGFVTGCVOGPVQRVKQPUCPFHCEKNKVCVGFKPFKXKFWCNK\GF OCPCIGOGPVUVTCVGIKGU1XGTVJGRCUVFGECFGUGXGTCNPGYENCUUGUQHINWEQUGNQYGTKPICIGPVU JCXGDGGPNKEGPUGFKPENWFKPIINWECIQPNKMGRGRVKFG|TGEGRVQT ).24 CIQPKUVUFKRGRVKF[N RGRVKFCUG| &22 KPJKDKVQTUCPFUQFKWOINWEQUGEQVTCPURQTVGT| 5).6 KPJKDKVQTU6JGUG CIGPVUECPDGWUGFKPFKXKFWCNN[QTKPEQODKPCVKQPYKVJYGNNGUVCDNKUJGFVTGCVOGPVUUWEJCU DKIWCPKFGUUWNHQP[NWTGCUCPFVJKC\QNKFKPGFKQPGU#NVJQWIJPQXGNCIGPVUJCXGRQVGPVKCN CFXCPVCIGUKPENWFKPINQYTKUMQHJ[RQIN[ECGOKCCPFJGNRYKVJYGKIJVEQPVTQNNQPIVGTOUCHGV[ JCU[GVVQDGGUVCDNKUJGF+PVJKU4GXKGYYGCUUGUUVJGRJCTOCEQMKPGVKEURJCTOCEQF[PCOKEUCPF UCHGV[RTQHKNGUKPENWFKPIECTFKQXCUEWNCTUCHGV[QHEWTTGPVN[CXCKNCDNGVJGTCRKGUHQTOCPCIGOGPV QHJ[RGTIN[ECGOKCKPRCVKGPVUYKVJ6&/YKVJKPVJGEQPVGZVQHFKUGCUGRCVJQIGPGUKUCPFPCVWTCN JKUVQT[+PCFFKVKQPYGDTKGHN[FGUETKDGVTGCVOGPVCNIQTKVJOUHQTRCVKGPVUYKVJ6&/CPFNGUUQPU HTQORTGUGPVVJGTCRKGUVQKPHQTOVJGFGXGNQROGPVQHHWVWTGVJGTCRKGU Type 2 diabetes mellitus (T2DM) is a global epidemic with an dysfunction, as
    [Show full text]
  • Title Long-Term Safety and Efficacy of a Novel Once-Weekly Oral Trelagliptin As Monotherapy Or in Combination with an Existing O
    Long-term safety and efficacy of a novel once-weekly oral trelagliptin as monotherapy or in combination with an existing Title oral antidiabetic drug in patients with type 2 diabetes mellitus: A 52-week open-label, phase 3 study Inagaki, Nobuya; Sano, Hiroki; Seki, Yoshifumi; Kuroda, Author(s) Shingo; Kaku, Kohei Citation Journal of Diabetes Investigation (2016), 7(5): 718-726 Issue Date 2016-09 URL http://hdl.handle.net/2433/215204 © 2016 The Authors. Journal of Diabetes Investigation published by Asian Association for the Study of Diabetes (AASD) and John Wiley & Sons Australia, Ltd; This is an open access article under the terms of the Creative Commons Right Attribution-NonCommercial-NoDerivs License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made. Type Journal Article Textversion publisher Kyoto University CLINICAL TRIAL Long-term safety and efficacy of a novel once- weekly oral trelagliptin as monotherapy or in combination with an existing oral antidiabetic drug in patients with type 2 diabetes mellitus: A 52-week open-label, phase 3 study Nobuya Inagaki1*, Hiroki Sano2,YoshifumiSeki2, Shingo Kuroda2, Kohei Kaku3 1Department of Diabetes, Endocrinology and Nutrition, Kyoto University Graduate School of Medicine, Kyoto, 2Takeda Development Center Japan, Takeda Pharmaceutical Company Limited, Osaka, and 3Department of Internal Medicine, Kawasaki Medical School, Okayama, Japan Keywords ABSTRACT Long-term safety and efficacy, Aims/Introduction: Trelagliptin is a novel once-weekly oral dipeptidyl peptidase-4 inhi- Trelagliptin, Type 2 diabetes mellitus bitor for type 2 diabetes mellitus that was first approved in Japan.
    [Show full text]
  • Report on Investigation Results
    Pharmaceuticals and Medical Devices Agency This English version is intended to be a reference material for the convenience of users. In the event of inconsistency between the Japanese original and this English translation, the former shall prevail. Report on Investigation Results August, 21, 2019 Pharmaceuticals and Medical Devices Agency I. Summary of drug [Branded name] Zafatek Tablets 25 mg, 50mg, 100 mg [Non-proprietary name] Trelagliptin succinate [Approval holder] Takeda Pharmaceutical Company Limited. [Indications] Type 2 diabetes mellitus [Dosage and administration] The usual adult dosage is 100 mg of trelagliptin orally administered once weekly. [Investigating office] Office of Pharmacovigilance I II. Investigation background Zafatek Tablets (hereinafter referred to as “Zafatek”) 50 mg and 100 mg is an oral hypoglycemic agent that inhibits dipeptidyl peptidase-4 (hereinafter “DPP-4”) and is administered once weekly. Zafatek was approved for marketing with an indication for “type 2 diabetes mellitus” in March, 2015 in Japan. In the clinical pharmacology study of Zafatek 50 mg and 100 mg (101 Study) conducted up to the products’ application for marketing, the plasma concentration-area under the concentration curve (hereinafter, “AUC”) of unchanged trelagliptin after a single dose of Zafatek at 50 mg was 3.01 fold and 3.68 fold in patients with severe renal impairment and end stage renal failure, respectively, in comparison to that of patients with normal renal function. Based on this result, the marketing authorization holder (hereinafter,
    [Show full text]
  • Canagliflozin, Dapagliflozin and Empagliflozin Monotherapy for Treating Type 2 Diabetes: Systematic Review and Economic Evaluation
    HEALTH TECHNOLOGY ASSESSMENT VOLUME 21 ISSUE 2 JANUARY 2017 ISSN 1366-5278 Canagliflozin, dapagliflozin and empagliflozin monotherapy for treating type 2 diabetes: systematic review and economic evaluation Rhona Johnston, Olalekan Uthman, Ewen Cummins, Christine Clar, Pamela Royle, Jill Colquitt, Bee Kang Tan, Andrew Clegg, Saran Shantikumar, Rachel Court, J Paul O’Hare, David McGrane, Tim Holt and Norman Waugh DOI 10.3310/hta21020 Canagliflozin, dapagliflozin and empagliflozin monotherapy for treating type 2 diabetes: systematic review and economic evaluation Rhona Johnston,1 Olalekan Uthman,2 Ewen Cummins,1 Christine Clar,3 Pamela Royle,2 Jill Colquitt,4 Bee Kang Tan,2 Andrew Clegg,5 Saran Shantikumar,2 Rachel Court,2 J Paul O’Hare,2 David McGrane,6 Tim Holt7 and Norman Waugh2* 1McMDC, Harrogate, UK 2Warwick Evidence, Division of Health Sciences, University of Warwick, Coventry, UK 3Berlin, Germany 4Effective Evidence, Waterlooville, UK 5University of Central Lancashire, Preston, UK 6Queen Elizabeth University Hospital, Glasgow, UK 7University of Oxford, Oxford, UK *Corresponding author Declared competing interests of authors: David McGrane has spoken at educational meetings sponsored by AstraZeneca, Eli Lilly, Sanofi, MSD, Takeda Pharmaceutical Company, Novo Nordisk, Janssen, and has served on Advisory Boards for Eli Lilly, Sanofi, Novo Nordisk. J Paul O’Hare has received lecture fees, advisory board meeting fees, and grants for research from Novo Nordisk and Sanofi. All fees are paid through University of Warwick to fund access to insulin projects in sub-Saharan Africa. Published January 2017 DOI: 10.3310/hta21020 This report should be referenced as follows: Johnston R, Uthman O, Cummins E, Clar C, Royle P, Colquitt J, et al.
    [Show full text]
  • Anti-Diabetic Drugs - the Future Landscape
    EDITORIAL ANTI-DIABETIC DRUGS - THE FUTURE LANDSCAPE Dr. A. K. Baliarsinha iabetes mellitus is the most common metabolic and endocrine MBBS, MD, DM (Endocrinology) disorder affecting the entire world and it continues to grow at Professor and head, Dept. of Endocrinology, an alarming rate. As per a recent estimate, around 425 million SCB Medical College, Cuttack, Odisha people suffer from diabetes in 2017 and the number is predicted Dto rise beyond 649 million by 2045.1 Majority (around 90%) of them being Type 2 diabetes mellitus (T2DM).2 The disease poses a tremendous health challenge and burden on both affected individuals as well as the healthcare delivery system. The field of drug discovery in diabetes has grown by leaps and bounds in recent decades and now we have multiple agents approved for treatment for T2DM. But despite this fact, more than a third of patients with diabetes do not achieve or maintain an appropriate glycemic target with currently used drugs.3 The drug therapy becomes further challenging and complex in the setting of poor response to multiple oral anti-diabetic drugs (due to progressive beta-cell failure over time), frequent multiple chronic complications of diabetes itself and potential drug interactions with other drugs prescribed for other comorbidities. Hence, current research is directed towards development of novel drugs which are efficacious, safe and can retard these complications of T2DM. Newer therapies are directed towards novel targets which are dysregulated in T2DM and are not currently addressed. Current class of anti-diabetic drugs in clinical practice include biguanides, sulphonylureas, meglitinides, alpha-glucosidase inhibitors, dipeptidyl peptidase-4 (DPP-4) inhibitors, thiozolidinediones, sodium dependent glucose co transporter (SGLT-2) inhibitors, dopamine agonists, bile acid sequestrants, insulin and its analogues, amylin agonist and glucagon like peptide 1 (GLP 1) analogues.
    [Show full text]
  • Stembook 2018.Pdf
    The use of stems in the selection of International Nonproprietary Names (INN) for pharmaceutical substances FORMER DOCUMENT NUMBER: WHO/PHARM S/NOM 15 WHO/EMP/RHT/TSN/2018.1 © World Health Organization 2018 Some rights reserved. This work is available under the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 IGO licence (CC BY-NC-SA 3.0 IGO; https://creativecommons.org/licenses/by-nc-sa/3.0/igo). Under the terms of this licence, you may copy, redistribute and adapt the work for non-commercial purposes, provided the work is appropriately cited, as indicated below. In any use of this work, there should be no suggestion that WHO endorses any specific organization, products or services. The use of the WHO logo is not permitted. If you adapt the work, then you must license your work under the same or equivalent Creative Commons licence. If you create a translation of this work, you should add the following disclaimer along with the suggested citation: “This translation was not created by the World Health Organization (WHO). WHO is not responsible for the content or accuracy of this translation. The original English edition shall be the binding and authentic edition”. Any mediation relating to disputes arising under the licence shall be conducted in accordance with the mediation rules of the World Intellectual Property Organization. Suggested citation. The use of stems in the selection of International Nonproprietary Names (INN) for pharmaceutical substances. Geneva: World Health Organization; 2018 (WHO/EMP/RHT/TSN/2018.1). Licence: CC BY-NC-SA 3.0 IGO. Cataloguing-in-Publication (CIP) data.
    [Show full text]