Figure S1. Simplified Map of the Bacterial Expression Vector. IPTG, Isopropyl Β‑D‑Thiogalactoside
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Supplementary File 1
Supplementary The Effect of Increasing Inclusion Levels of a Fucoidan Rich Extract Derived from Ascophyllum nodosum on Growth Performance and Aspects of Intestinal Health of Pigs Post-Weaning Ruth Rattigan 1, Stafford Vigors 1, Gaurav Rajauria 1, Torres Sweeney 2, Kevin Thornton 2 and John V O’Doherty 1,* Supplementary document 1. Alpha diversity & gene expression Figure S1. The effect of fucoidan supplementation at 250ppm on Observed, Shannon and Simpson measures of alpha diversity in caecal and colonic digesta. Table DS1. Effect of fucoidan on gene expression in the duodenum (Least-square means with their standard errors) Group Gene Basal Fucoidan SEM P value 250ppm Digestive SI 23195.53 21920.53 3734.92 0.813 enzymes CNDP1 220.76 195.56 57.42 0.761 FABP2 64101.33 63277.94 13214.97 0.966 SLC2A1 340.44 103.05 47.20 0.364 SLC2A2 3501.49 3760.72 603.38 0.766 SLC2A5 979.44 789.62 90.78 0.163 SLC2A7 508.99 496.96 88.62 0.925 SLC2A8 226.76 401.46 66.18 0.083 Nutrient SLC16A1 2246.59 2698.03 218.08 0.165 transporters SLC15A1 3936.03 4139.35 585.09 0.810 SLC5A1 11917.91 11381.36 1652.19 0.822 SLC16A10 649.47 581.32 71.64 0.512 SLC6A19 2623.95 2733.15 213.52 0.723 SLC7A1 157.24 181.69 12.93 0.202 SLC5A8 3214.00 4059.56 199.78 0.010 GLP2R 153.47 163.79 10.00 0.479 Appetite GCG 723.21 264.69 275.57 0.261 regulators CCK 825.90 813.21 98.49 0.929 CLDN3 2284.64 2545.28 135.22 0.194 CLDN5 65.53 55.71 3.18 0.047 Tight junctions OCLN 2290.33 2235.59 148.52 0.798 TJP1 1050.29 1051.15 28.50 0.983 NFKB1 561.69 598.47 16.04 0.127 IFNG 90.61 110.40 16.36 -
PRODUCT SPECIFICATION Anti-SLC2A7 Product
Anti-SLC2A7 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-SLC2A7 Product Number HPA039931 Gene Description solute carrier family 2 (facilitated glucose transporter), member 7 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SVVNTPHKVFKSFYNETYFERHATFMDGKLM Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:20 - 1:50 - Retrieval method: HIER pH6 Characterization Data Available at atlasantibodies.com/products/HPA039931 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price. -
Upregulation of SLC2A3 Gene and Prognosis in Colorectal Carcinoma
Kim et al. BMC Cancer (2019) 19:302 https://doi.org/10.1186/s12885-019-5475-x RESEARCH ARTICLE Open Access Upregulation of SLC2A3 gene and prognosis in colorectal carcinoma: analysis of TCGA data Eunyoung Kim1†, Sohee Jung2†, Won Seo Park3, Joon-Hyop Lee4, Rumi Shin5, Seung Chul Heo5, Eun Kyung Choe6, Jae Hyun Lee7, Kwangsoo Kim2* and Young Jun Chai5* Abstract Background: Upregulation of SLC2A genes that encode glucose transporter (GLUT) protein is associated with poor prognosis in many cancers. In colorectal cancer, studies reporting the association between overexpression of GLUT and poor clinical outcomes were flawed by small sample sizes or subjective interpretation of immunohistochemical staining. Here, we analyzed mRNA expressions in all 14 SLC2A genes and evaluated the association with prognosis in colorectal cancer using data from the Cancer Genome Atlas (TCGA) database. Methods: In the present study, we analyzed the expression of SLC2A genes in colorectal cancer and their association with prognosis using data obtained from the TCGA for the discovery sample, and a dataset from the Gene Expression Omnibus for the validation sample. Results: SLC2A3 was significantly associated with overall survival (OS) and disease-free survival (DFS) in both the discovery sample (345 patients) and validation sample (501 patients). High SLC2A3 expression resulted in shorter OS and DFS. In multivariate analyses, high SLC2A3 levels predicted unfavorable OS (adjusted HR 1.95, 95% CI 1.22–3.11; P = 0.005) and were associated with poor DFS (adjusted HR 1.85, 95% CI 1.10–3.12; P = 0.02). Similar results were found in the discovery set. -
Glucose Transporters As a Target for Anticancer Therapy
cancers Review Glucose Transporters as a Target for Anticancer Therapy Monika Pliszka and Leszek Szablewski * Chair and Department of General Biology and Parasitology, Medical University of Warsaw, 5 Chalubinskiego Str., 02-004 Warsaw, Poland; [email protected] * Correspondence: [email protected]; Tel.: +48-22-621-26-07 Simple Summary: For mammalian cells, glucose is a major source of energy. In the presence of oxygen, a complete breakdown of glucose generates 36 molecules of ATP from one molecule of glucose. Hypoxia is a hallmark of cancer; therefore, cancer cells prefer the process of glycolysis, which generates only two molecules of ATP from one molecule of glucose, and cancer cells need more molecules of glucose in comparison with normal cells. Increased uptake of glucose by cancer cells is due to increased expression of glucose transporters. However, overexpression of glucose transporters, promoting the process of carcinogenesis, and increasing aggressiveness and invasiveness of tumors, may have also a beneficial effect. For example, upregulation of glucose transporters is used in diagnostic techniques such as FDG-PET. Therapeutic inhibition of glucose transporters may be a method of treatment of cancer patients. On the other hand, upregulation of glucose transporters, which are used in radioiodine therapy, can help patients with cancers. Abstract: Tumor growth causes cancer cells to become hypoxic. A hypoxic condition is a hallmark of cancer. Metabolism of cancer cells differs from metabolism of normal cells. Cancer cells prefer the process of glycolysis as a source of ATP. Process of glycolysis generates only two molecules of ATP per one molecule of glucose, whereas the complete oxidative breakdown of one molecule of glucose yields 36 molecules of ATP. -
Systems Biology of Inborn Errors of Metabolism
Systems biology of inborn errors of metabolism Swagatika Sahoo FacultyFaculty of of Faculty Faculty of of Life Life and and Environmental Environmental Sciences Sciences UniversityUniversity of of Iceland Iceland 20132013 SYSTEMS BIOLOGY OF INBORN ERRORS OF METABOLISM Swagatika Sahoo Dissertation submitted in partial fulllment of Philosophiae Doctor degree in Biology Advisor Professor Ines Thiele Thesis Committee Professor Ólafur S. Andrésson Professor Ines Thiele Professor Jón J. Jónsson Opponents Professor Hermann-Georg Holzhütter Professor Barbara Bakker Life and Environmental Sciences School of Engineering and Natural Sciences University of Iceland Reykjavik, September 2013 Systems biology of inborn errors of metabolism Systems biology : inborn errors of metabolism Dissertation submitted in a partial fulfillment of a Ph.D. degree in Biology Copyright © 2013 Swagatika Sahoo All rights reserved Life and Environmental Sciences School of Engineering and Natural Sciences University of Iceland Sturlugata 8 101, Reykjavik, Reykjavik Iceland Telephone: 525 4000 Bibliographic information: Swagatika Sahoo, 2013, Systems biology of inborn errors of metabolism, Ph.D. the- sis, Faculty of Life and Environmental Sciences, University of Iceland. ISBN 978-9935-9164-5-7 Printing: Háskólaprent, Fálkagata 2, 107 Reykjavik Reykjavik, Iceland, September 2013 Abstract Inborn errors of metabolism (IEMs) are the hereditary metabolic disorders often leading to life threatening conditions when left un-treated. IEMs not only demand better diagnostic methods and efficient therapeutic regimen, but also, a high level understanding of the precise biochemical pathology involved. Constraint-based metabolic network reconstruction and modeling is the core systems biology meth- ods to analyze the complex interactions between cellular components that maintain cellular homeostasis. Simultaneously, the global human metabolic networks, Re- con 1 and Recon 2, are landmarks in this regard. -
RNA-Seq Reveals Conservation of Function Among the Yolk Sacs Of
RNA-seq reveals conservation of function among the PNAS PLUS yolk sacs of human, mouse, and chicken Tereza Cindrova-Daviesa, Eric Jauniauxb, Michael G. Elliota,c, Sungsam Gongd,e, Graham J. Burtona,1, and D. Stephen Charnock-Jonesa,d,e,1,2 aCentre for Trophoblast Research, Department of Physiology, Development and Neuroscience, University of Cambridge, Cambridge, CB2 3EG, United Kingdom; bElizabeth Garret Anderson Institute for Women’s Health, Faculty of Population Health Sciences, University College London, London, WC1E 6BT, United Kingdom; cSt. John’s College, University of Cambridge, Cambridge, CB2 1TP, United Kingdom; dDepartment of Obstetrics and Gynaecology, University of Cambridge, Cambridge, CB2 0SW, United Kingdom; and eNational Institute for Health Research, Cambridge Comprehensive Biomedical Research Centre, Cambridge, CB2 0QQ, United Kingdom Edited by R. Michael Roberts, University of Missouri-Columbia, Columbia, MO, and approved May 5, 2017 (received for review February 14, 2017) The yolk sac is phylogenetically the oldest of the extraembryonic yolk sac plays a critical role during organogenesis (3–5, 8–10), membranes. The human embryo retains a yolk sac, which goes there are limited data to support this claim. Obtaining experi- through primary and secondary phases of development, but its mental data for the human is impossible for ethical reasons, and importance is controversial. Although it is known to synthesize thus we adopted an alternative strategy. Here, we report RNA proteins, its transport functions are widely considered vestigial. sequencing (RNA-seq) data derived from human and murine yolk Here, we report RNA-sequencing (RNA-seq) data for the human sacs and compare them with published data from the yolk sac of and murine yolk sacs and compare those data with data for the the chicken. -
The Pdx1 Bound Swi/Snf Chromatin Remodeling Complex Regulates Pancreatic Progenitor Cell Proliferation and Mature Islet Β Cell
Page 1 of 125 Diabetes The Pdx1 bound Swi/Snf chromatin remodeling complex regulates pancreatic progenitor cell proliferation and mature islet β cell function Jason M. Spaeth1,2, Jin-Hua Liu1, Daniel Peters3, Min Guo1, Anna B. Osipovich1, Fardin Mohammadi3, Nilotpal Roy4, Anil Bhushan4, Mark A. Magnuson1, Matthias Hebrok4, Christopher V. E. Wright3, Roland Stein1,5 1 Department of Molecular Physiology and Biophysics, Vanderbilt University, Nashville, TN 2 Present address: Department of Pediatrics, Indiana University School of Medicine, Indianapolis, IN 3 Department of Cell and Developmental Biology, Vanderbilt University, Nashville, TN 4 Diabetes Center, Department of Medicine, UCSF, San Francisco, California 5 Corresponding author: [email protected]; (615)322-7026 1 Diabetes Publish Ahead of Print, published online June 14, 2019 Diabetes Page 2 of 125 Abstract Transcription factors positively and/or negatively impact gene expression by recruiting coregulatory factors, which interact through protein-protein binding. Here we demonstrate that mouse pancreas size and islet β cell function are controlled by the ATP-dependent Swi/Snf chromatin remodeling coregulatory complex that physically associates with Pdx1, a diabetes- linked transcription factor essential to pancreatic morphogenesis and adult islet-cell function and maintenance. Early embryonic deletion of just the Swi/Snf Brg1 ATPase subunit reduced multipotent pancreatic progenitor cell proliferation and resulted in pancreas hypoplasia. In contrast, removal of both Swi/Snf ATPase subunits, Brg1 and Brm, was necessary to compromise adult islet β cell activity, which included whole animal glucose intolerance, hyperglycemia and impaired insulin secretion. Notably, lineage-tracing analysis revealed Swi/Snf-deficient β cells lost the ability to produce the mRNAs for insulin and other key metabolic genes without effecting the expression of many essential islet-enriched transcription factors. -
Leucophores Are Similar to Xanthophores in Their Specification and Differentiation Processes in Medaka
Leucophores are similar to xanthophores in their specification and differentiation processes in medaka Tetsuaki Kimuraa,b,1, Yusuke Nagaoc, Hisashi Hashimotoc, Yo-ichi Yamamoto-Shiraishid, Shiori Yamamotod, Taijiro Yabeb,e, Shinji Takadab,e, Masato Kinoshitaf, Atsushi Kuroiwad, and Kiyoshi Narusea,b,g aInteruniversity Bio-Backup Project Center, National Institute for Basic Biology, Okazaki 444-8787, Aichi, Japan; bDepartment of Basic Biology, School of Life Science, Graduate University for Advanced Studies (SOKENDAI), Okazaki, Aichi 444-8787, Japan; cBioscience and Biotechnology Center and Division of Biological Science, Graduate School of Science, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601, Japan; dDivision of Biological Science, Graduate School of Science, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602, Japan; eOkazaki Institute for Integrative Bioscience and National Institute for Basic Biology, National Institutes of Natural Sciences, Okazaki, Aichi 444-8787, Japan; fDivision of Applied Bioscience, Graduate School of Agriculture, Kyoto University, Sakyo-ku, Kyoto 606-8502, Japan; and gLaboratory of Bioresources, National Institute for Basic Biology, Okazaki 444-8585, Aichi, Japan Edited by Sean B. Carroll, University of Wisconsin, Madison, WI, and approved April 9, 2014 (received for review June 14, 2013) Animal body color is generated primarily by neural crest-derived been considered to be closely related to iridophores based on the pigment cells in the skin. Mammals and birds have only melanocytes primary pigment. Purines are the primary pigment of leucophores on the surface of their bodies; however, fish have a variety of and iridophores (i.e., uric acid in leucophores and guanine in iri- pigment cell types or chromatophores, including melanophores, dophores) (3, 8, 9). -
Predicting the Three-Dimensional Structure of the Human Facilitative Glucose Transporter Glut1 by a Novel Evolutionary Homology
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector 2990 Biophysical Journal Volume 87 November 2004 2990–2999 Predicting the Three-Dimensional Structure of the Human Facilitative Glucose Transporter Glut1 by a Novel Evolutionary Homology Strategy: Insights on the Molecular Mechanism of Substrate Migration, and Binding Sites for Glucose and Inhibitory Molecules Alexis Salas-Burgos,* Pavel Iserovich,* Felipe Zuniga,y Juan Carlos Vera,y and Jorge Fischbarg*z *Department of Ophthalmology, College of Physicians & Surgeons, Columbia University, New York, New York; yDepartment of Pathophysiology, School of Sciences, University of Concepcio´n, Chile; and zDepartment of Physiology and Biophysics, College of Physicians & Surgeons, Columbia University, New York, New York ABSTRACT The glucose transporters (GLUT/SLC2A) are members of the major facilitator superfamily. Here, we generated a three-dimensional model for Glut1 using a two-step strategy: 1), GlpT structure as an initial homology template and 2), evolutionary homology using glucose-6-phosphate translocase as a template. The resulting structure (PDB No. 1SUK) exhibits a water-filled passageway communicating the extracellular and intracellular domains, with a funnel-like exofacial vestibule (infundibulum), followed by a 15 A˚ -long 3 8A˚ -wide channel, and a horn-shaped endofacial vestibule. Most residues which, by mutagenesis, are crucial for transport delimit the channel, and putative sugar recognition motifs (QLS, QLG) border both ends of the channel. On the outside of the structure there are two positively charged cavities (one exofacial, one endofacial) delimited by ATP-binding Walker motifs, and an exofacial large side cavity of yet unknown function. -
Transporters
University of Dundee The Concise Guide to PHARMACOLOGY 2015/16 Alexander, Stephen P. H.; Kelly, Eamonn; Marrion, Neil; Peters, John A.; Benson, Helen E.; Faccenda, Elena Published in: British Journal of Pharmacology DOI: 10.1111/bph.13355 Publication date: 2015 Licence: CC BY Document Version Publisher's PDF, also known as Version of record Link to publication in Discovery Research Portal Citation for published version (APA): Alexander, S. P. H., Kelly, E., Marrion, N., Peters, J. A., Benson, H. E., Faccenda, E., Pawson, A. J., Sharman, J. L., Southan, C., Davies, J. A., & CGTP Collaborators (2015). The Concise Guide to PHARMACOLOGY 2015/16: Transporters. British Journal of Pharmacology, 172(24), 6110-6202. https://doi.org/10.1111/bph.13355 General rights Copyright and moral rights for the publications made accessible in Discovery Research Portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from Discovery Research Portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain. • You may freely distribute the URL identifying the publication in the public portal. Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. Download date: 06. Oct. 2021 S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2015/16: Transporters. -
{'Ess': 0, 'Noness': 3} True 70007 AAGATCTAAAACTTTACACTAG []
uag2uaa_1_13_window gene gene_ogee gene_essentiality site_index cbe_targets abe_targets 0 1 OR4F5 {'ess': 0, 'noness': 3} True 70007 AAGATCTAAAACTTTACACTAG [] 1 1 PERM1 unavailable False 976171 TGGCTCCTAGGAGCTGGGGCTG [] 2 1 RNF223 unavailable False 1071816 TGGCCCTAATTATCAGTCAGAG [] 3 1 TTLL10 {'ess': 0, 'noness': 7} True 1185524 CCTTAGCTAGGGAGAGTCCGGG [] 4 1 TTLL10 {'ess': 0, 'noness': 7} True 1197846 TGGCTGCCCCTAGGGCCTCGCG[] 5 1 TNFRSF18 {'ess': 0, 'noness': 7} True 1203590 TCCTAAGACCCCACCCCATCAG [] 6 1 ACAP3 {'ess': 0, 'noness': 7} True 1293563 CCGGCCCTAGCTCTCTTCCAGG [] 7 1 CPTP unavailable False 1327762 CCCGCCCCTAGGGCAGGTCCAG[] 8 1 MXRA8 {'ess': 0, 'noness': 7} True 1353603 CCTATTTGCAGTTCTCCTTCCG [] 9 1 MRPL20 {'ess': 6, 'noness': 2} False 1402568 TGGCCTAGGGTAACCCTTTAAG [] 10 1 ATAD3B {'ess': 0, 'noness': 7} True 1495816 CCAGTGCCTACAACAGGGGGTG [] 11 1 MMP23B {'ess': 0, 'noness': 7} True 1634328 TCACTACACTTTCCCTTTCTTG [] 12 1 NADK {'ess': 4, 'noness': 5} False 1752903 -1 -1 13 1 CALML6 {'ess': 1, 'noness': 7} True 1917192 CTGCACCTACTGGATCAGCTTG [] 14 1 PRKCZ {'ess': 1, 'noness': 7} True 2157294 GGGACGCCCTAGTAGCTGGCTG [] 15 1 SKI {'ess': 2, 'noness': 6} False 2306764 GGAATCTACGGCTCCAGCTCCG [] 16 1 MORN1 {'ess': 0, 'noness': 7} True 2355447 CGTCTGATCCTAGAAGAGTGAG [] 17 1 RER1 {'ess': 1, 'noness': 5} False 2403123 TCCCGCTTCTAGCTGGCGAAGG [] 18 1 PRXL2B unavailable False 2589478 AGCACACCTAGGGCAGCAGACG [] 19 1 MMEL1 {'ess': 1, 'noness': 7} True 2590989 TTGGCTACCACACGCGGCATCG [] 20 1 ARHGEF16 {'ess': 0, 'noness': 7} True 3480586 GCTACACGTCCGTCTCCACCCG -
2. Integrated Genomic Analyses Identify ERRFI1 and TACC3 As Glioblastoma-Targeted Genes
Molecular Characterization of Genetic and Epigenetic Alterations in Gliomas by Christopher Gentry Duncan Department of Pathology Duke University Date:_______________________ Approved: ___________________________ Hai Yan, Supervisor ___________________________ Soman N. Abraham ___________________________ Robin E. Bachelder ___________________________ Roger E. McLendon ___________________________ Xiao-Fan Wang Dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Pathology in the Graduate School of Duke University 2012 i v ABSTRACT Molecular Characterization of Genetic and Epigenetic Alterations in Gliomas by Christopher Gentry Duncan Department of Pathology Duke University Date:_______________________ Approved: ___________________________ Hai Yan, Supervisor ___________________________ Soman N. Abraham ___________________________ Robin E. Bachelder ___________________________ Roger E. McLendon ___________________________ Xiao-Fan Wang An abstract of a dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Pathology in the Graduate School of Duke University 2012 i v Copyright by Christopher Gentry Duncan 2012 Abstract Glioma development and progression are driven by complex genetic alterations, including point mutations and gain or loss of genomic copy number, as well as epigenetic aberrations, including DNA methylation and histone modifications. However, the molecular mechanisms underlying the causes