DOCSLIB.ORG

JUNE 5-6, 2019 Dr

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
JUNE 5-6, 2019 Dr Leslie Sturmer & JUNE 5-6, 2019 Dr. Huiping Yang FWC Sen. Kirkpatrick Marine Lab UF/IFAS Molluscan Shellfish Program 11350 SW 153rd Court, Cedar Key, FL 32625 NOAA National Sea Grant (Presentations & Demonstrations) • Function of Microalgae • Mass-Culture Strategies • Nutrition of Bivalves • Chemical Ecology of Cultures • Phytoplankton as Bivalve Foods • Media preparation & Aseptic transfers • Quantification Methods www.nefsc.noaa.gov/nefsc/Milford MICROALGAL CULTURE WORSHOP June 5-6, 2019 FWC Senator Kirkpatrick Marine Lab 11350 SW 153rd Court, Cedar Key, FL Guest Speaker: Dr. Gary Wikfors Director, NOAA Fisheries Milford Laboratory, Milford, CT AGENDA Wednesday, June 5, 2019 10:30 - 11:00 AM Registration 11:00 - 11:30 AM Welcome and Introductions 11:30 - 12:30 PM Introduction to Microalgae 12:30 - 1:15 PM Lunch (on site) 1:15 - 2:15 PM Function of Microalgae 2:15 - 3:15 PM Mass-Culture Strategies 3:15 - 3:30 PM Break 3:30 - 4:30 PM Nutrition of Bivalves 4:30 - 5:00 PM Discussion Thursday, June 6, 2019 8:00 - 10:00 AM Hands-on Demonstrations: Quantification methods, Aseptic transfers, Media preparation Meet at UF/IFAS Nature Coast Biological Station, 552 1st St, Cedar Key, FL 10:00 - 10:30 AM Break (head back to FWC Marine Lab) 10:30 - 11:30 PM Chemical Ecology of Microalgal Cultures 11:30 - 12:30 PM Natural Phytoplankton as Bivalve Foods 12:30 - 2:00 PM Box lunch, Q&As, Discussion and Wrap-up Dr. Gary H. Wikfors Chief, Aquaculture Sustainability Branch / Lab Director Email: [email protected] Education •Ph.D. Phycology - University of Connecticut •M.S. Biology - University of Bridgeport CT •B.S. Biology - University of Maine at Orono Gary’s terminal degree is in Phycology – the study of algae – but he always has worked at the intersection of phytoplankton and the bivalve mollusks -- such as oysters, clams, scallops, and mussels -- that derive their nutrition from phytoplankton. Gary has studied trophic transfer of pollutants from phytoplankton to bivalves, biochemical nutrition of shellfish, and harmful- algal effects upon bivalves. Much of his research has employed a laboratory- based, experimental approach, but he also has been involved in large, multidisciplinary field studies. Gary was an early adopter of flow-cytometry for microalgal applications, and use of this technology has sparked a subsequent interest in cellular immunity in bivalves and other invertebrates. As Chief of the Biotechnology Branch, Gary has a hands-on role in several current team initiatives: 1) Nutrient bioextraction using shellfish aquaculture, 2) Probiotic bacteria for use in shellfish hatcheries, and 3) Shellfish cellular immune response to environmental variation. ENCYCLOPEDIA OF AQUACULTURE 520 MICROALGAL CULTURE MICROALGAL CULTURE Table 1. List of Currently Recognized ‘‘Microalgal’’ Classes and Representative Genera Used in Aquaculture GARY H. WIKFORS Representative Northeast Fisheries Science Center Genera Used in Milford, Connecticut Class Common Name Aquaculture Cyanophyceae Blue-green algae Spirulina OUTLINE Prochlorophyceae Prochlorophytes None Rhodophyceae Red algae Porphyridium What are Microalgae? Prasinophyceae Scaled green algae Tetraselmis Pyramimonas Why Culture Microalgae? Chlorophyceae Green algae Chlorella Microalgae for Extractable Chemicals Dunaliella Microalgae as Aquaculture Feeds Haematococcus Cryptophyceae None Cryptomonas How do Microalgae Work? Rhodomonas Energy Chlorarachniophyceae None None Materials, or Nutrients Euglenophyceae None None Microalgal Growth D Population Growth Dinophyceae Dinoflagellates Crypthecodinium (Pyrrophyceae) How are Microalgae Cultured? Chrysophyceae Golden-brown algae None Containers Raphidophyceae None None Energy Eustigmatophyceae None Nannochloropsis Xanthophyceae None None Materials (Tribophyceae) Culture Management Bacillariophyceae Diatoms Thalassiosira What Innovations are Expected? Chaetoceros Nitzschia Bibliography Dictyophyceae None None Pelagophyceae None None Haptophyceae None Isochrysis WHAT ARE MICROALGAE? (Prymnesiophyceae) Pavlova By direct translation from Latin, microalgae are ‘‘little seaweeds.’’ However, defining microalgae further is not simple, because the microalgae represent a the category is necessary (see Table 1). Higher level sys- taxonomically diverse group of organisms, rather than tematics of these groups are under revision; hence, only a single, phylogenetic category. A functional definition the class level is specified. The diversity of the group is of microalgae might be ‘‘photosynthetic single-celled or underscored by the presence of both prokaryotic (not con- colonial microorganisms’’; however, most of these microbes taining a nucleus, Cyanophyceae, or cyanobacteria) and are able to grow without light if dissolved sugars eukaryotic (nucleated) taxa. The eukaryotic groups are are provided. Microalgal cells range in size from one thought to have arisen from the incorporation of photo- micrometer — roughly the size of a bacterium — to several synthetic prokaryotes (or, subsequently, photosynthetic hundred micrometers (1 µm) — barely visible to the naked eukaryotes) within protozoan-like host organisms. This eye. Colonies and chains of some microalgal cells can hypothesized process is referred to as the endosymbiosis attain a length of several centimeters 2.5cmD 1in..This theory. Evidence from both electron microscope studies of group of organisms contains remarkable morphological microalgal cells (usually focused upon numbers and types diversity, with shapes ranging from simple spheres to of membranes within the cell) and more recent molecular the ornate, silica shells of one group, the diatoms. sequencing work indicates that endosymbiotic creation of Many microalgae are motile, propelling themselves with ‘‘new’’ organisms may have occurred a number of times in flagella, by amoeboid motion, or by gliding on extruded evolutionary history, leading to the diversity in morphol- mucilage. Microalgae are found in an astonishing range of ogy and physiology seen today. This diversity, especially in habitats, such as in fresh, saline and hypersaline waters, terms of physiology, provides opportunities for the current in polar ice, in soil, attached to plants and animals, and potential use of these organisms in the aquaculture and even in symbiotic relationships with fungi (e.g., industry. lichens) and animals (e.g., corals). Historically, many of these organisms have been claimed and named by both zoologists and botanists; therefore, taxonomy has WHY CULTURE MICROALGAE? been, and remains, problematic. From the perspective of aquaculture, there are common characteristics that There are two main reasons for which microalgae are warrant their consideration as a functional group; the grown: (1) for extractable chemicals and (2) as feeds for foregoing definition will suffice for this discussion. aquacultured animals. Efforts to produce foods for direct As ‘‘microalgae’’ is a functional rather than phyloge- human consumption have met with limited success, and netic group, a list of taxa that would reasonably fit within crops such as the cyanobacterium Spirulina remain in the MICROALGAL CULTURE 521 realm of ‘‘dietary supplement,’’ rather than food crop; these such as temperature and salinity. An alga’s ability to cases are considered along with extractable chemicals. coexist with or exclude microbial contaminants, ranging from bacteria to fungi and protozoans, also is critically Microalgae for Extractable Chemicals important in most commercial applications. A number of specific, clonal strains of microalgae have Chemical analyses of microalgae have led to the discovery been found, empirically, to possess desired characteristics of many novel chemical compounds, some of which are and are in wide use; these can be obtained from useful as food additives, pharmaceuticals, cosmetics, or aquaculture supply companies, academic institutions, and in other high-value applications. Examples of microalgae government-funded institutions that maintain microalgal currently commercially cultured for extractable chemicals culture collections. The strain level of identity is include (1) Dunaliella for ˇ-carotene, a human nutritional appropriate, because microalgal taxonomy remains in a supplement; (2) Haematococcus for the pigments astax- state of continuing development and because different anthin and canthaxanthin, which are used as coloring isolates of the same taxonomic species may differ widely agents in salmon feeds; (3) Crypthecodinium for docosa- in growth or nutritional characteristics relevant to their hexaenoic acid (DHA), which is incorporated into infant use as aquaculture feeds. formula; and (4) the aforementioned Spirulina,whichis used as a dietary supplement or additive to cosmetic prod- ucts. In most cases, the chemical compound of commercial HOW DO MICROALGAE WORK? interest is present as a small fraction of the total algal biomass; therefore, the scale of cultures for commercial Energy production generally is in the range of many cubic meters 3 Microalgae are referred to as autotrophs, a word that 1m3 D 35.3ft . When a selected portion of the algal translates literally as self-feeding. This term is wholly biomass is extracted and refined, the presence of chemical appropriate because the process of photosynthesis, by and biological contaminants within production cultures is which light energy is converted to chemical energy, not relevant, unless overall production is constrained or an provides sugars that are subsequently eaten, or burned, undesired chemical is coextracted with
Load more

Recommended publications
  • VACUUM RECOVERY of ASPHALT EMULSION RESIDUE (An Arizona Method)
    ARIZ 504 July 1980 (3 Pages) VACUUM RECOVERY OF ASPHALT EMULSION RESIDUE (An Arizona Method) Scope (d) No. 10 sieve conforming to AASHTO designation M 92. I. This method describes a low temperature vacuum procedure for recovery of the asphalt residue (e) Vacuum recovery apparatus as shown from asphalt emulsions. It is is not suitable for assembled in Fig. I. quantitative recovery of solvents from emulsions I) Vacuum source capable of producing an containing low boiling range distillates. absolute vacuum within the system of approximately 710 mm (28 in.) mercury. Apparatus 2) Thermometer - shall have a range of _5° to 1. The apparatus shall consist of the following: +200°C (23°F to 392°F). The overall length (a) Brass stirring rod. shall be 600 mm (24 in.) and the distance from the bottom of the bulb to the zero point (b) 8 oz. ointment can. shall be 300 mm (12 in.) (c) 100 ml. stainless steel beaker. 3) Stirrer hot plate. VACUUM RECOVERY APPARATUS 300 mm Allihn condenser H20 Out / Thermometer Vacuum Release Pinch Clamp 500 m. 1,000 ml. Filtration Flask Filtration Flask Teflon Stirring Bar H20 In 500 ml. Filtration Flask Portable Heat Gun FIGURE I ARIZ 504 July 1980 4) Teflon covered stirring bar. (g) Insert the stoppered themometer (positioned 5) 1000 ml. and two 500 ml. filtering flasks with in the stopper at an angle to prevent contact with tubulation. stirring bar) into the flask and set on hot plate at a medium high heat setting (#4). The bulb of the 6) 300 mm Allihn condensor.
    [Show full text]
  • University of Oklahoma
    UNIVERSITY OF OKLAHOMA GRADUATE COLLEGE MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION SUBMITTED TO THE GRADUATE FACULTY in partial fulfillment of the requirements for the Degree of DOCTOR OF PHILOSOPHY By JOSHUA THOMAS COOPER Norman, Oklahoma 2017 MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION APPROVED FOR THE DEPARTMENT OF MICROBIOLOGY AND PLANT BIOLOGY BY ______________________________ Dr. Boris Wawrik, Chair ______________________________ Dr. J. Phil Gibson ______________________________ Dr. Anne K. Dunn ______________________________ Dr. John Paul Masly ______________________________ Dr. K. David Hambright ii © Copyright by JOSHUA THOMAS COOPER 2017 All Rights Reserved. iii Acknowledgments I would like to thank my two advisors Dr. Boris Wawrik and Dr. J. Phil Gibson for helping me become a better scientist and better educator. I would also like to thank my committee members Dr. Anne K. Dunn, Dr. K. David Hambright, and Dr. J.P. Masly for providing valuable inputs that lead me to carefully consider my research questions. I would also like to thank Dr. J.P. Masly for the opportunity to coauthor a book chapter on the speciation of diatoms. It is still such a privilege that you believed in me and my crazy diatom ideas to form a concise chapter in addition to learn your style of writing has been a benefit to my professional development. I’m also thankful for my first undergraduate research mentor, Dr. Miriam Steinitz-Kannan, now retired from Northern Kentucky University, who was the first to show the amazing wonders of pond scum. Who knew that studying diatoms and algae as an undergraduate would lead me all the way to a Ph.D.
    [Show full text]
  • Maintenance of Bacterial Strains
    Maintenance of Bacterial Strains Short-term growth and maintenance The simplest method for obtaining strains is to order them from a microbiological supply company. Presque Isle, Ward, and Carolina Biological (see “Resources” page of the Microbes Web site: www.umsl.edu/~microbes) are economical sources of strains that are commonly used in the classroom. Another possible source is a local college or university that teaches a microbiology lab course. If they have strains already prepared for their class, they will probably be willing to provide you with a culture. This is probably not a reasonable ongoing source of strains, but can be useful in an emergency. For short-term maintenance and use, it is best to streak bacteria on some type of rich agar petri plate, such as nutrient agar. Label and date the plate on the bottom of the plate. Streak from the source culture using good sterile technique. The quadrant streak method (see the article on quadrant streaking) is good for obtaining well-isolated colonies. Incubate the plate only until good colonies have formed. Do not leave the culture in the incubator beyond that time, or the cells will die on the plate. Store the plate in the refrigerator. It will keep for about a month. For class use, it is best to streak a fresh plate 2-3 days before the strain will be needed for class. Use the fresh plate as the source of cultures for the class. For broth cultures for a class, it is best to grow a larger volume culture in a flask (if possible, with shaking) overnight and then dispense aliquots of the master culture into sterile test tubes using a sterile pipette.
    [Show full text]
  • Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016
    Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016 April 1981 Revised, May 1982 2nd revision, April 1983 3rd revision, December 1999 4th revision, May 2011 Prepared for U.S. Department of Commerce Ohio Department of Natural Resources National Oceanic and Atmospheric Administration Division of Wildlife Office of Ocean and Coastal Resource Management 2045 Morse Road, Bldg. G Estuarine Reserves Division Columbus, Ohio 1305 East West Highway 43229-6693 Silver Spring, MD 20910 This management plan has been developed in accordance with NOAA regulations, including all provisions for public involvement. It is consistent with the congressional intent of Section 315 of the Coastal Zone Management Act of 1972, as amended, and the provisions of the Ohio Coastal Management Program. OWC NERR Management Plan, 2011 - 2016 Acknowledgements This management plan was prepared by the staff and Advisory Council of the Old Woman Creek National Estuarine Research Reserve (OWC NERR), in collaboration with the Ohio Department of Natural Resources-Division of Wildlife. Participants in the planning process included: Manager, Frank Lopez; Research Coordinator, Dr. David Klarer; Coastal Training Program Coordinator, Heather Elmer; Education Coordinator, Ann Keefe; Education Specialist Phoebe Van Zoest; and Office Assistant, Gloria Pasterak. Other Reserve staff including Dick Boyer and Marje Bernhardt contributed their expertise to numerous planning meetings. The Reserve is grateful for the input and recommendations provided by members of the Old Woman Creek NERR Advisory Council. The Reserve is appreciative of the review, guidance, and council of Division of Wildlife Executive Administrator Dave Scott and the mapping expertise of Keith Lott and the late Steve Barry.
    [Show full text]
  • METHODS & STANDARD OPERATING PROCEDURES (Sops)
    METHODS & STANDARD OPERATING PROCEDURES (SOPs) OF EMISSION TESTING IN HAZARDOUS WASTE INCINERATOR FOREWARD COVR PAGE TEAM CHAPTER TITLE PAGE NO Chapter - 1 Stack Monitoring – Material And Methodology For Isokinetic Sampling 1-28 Chapter - 2 Standard Operating Procedure (SOP) For Particulate Matter Determination 29-38 Chapter - 3 Determination Of Hydrogen Halides (Hx) And Halogens From Source Emission 39-54 Chapter - 4 Standard Operating Procedure For The Sampling Of Hydrogen Halides And Halogens From Source Emission 55-61 Determination Of Metals And Non Metals Emissions From Chapter - 5 Stationarysources 62-79 Standard Operating Procedure (Sop) For Sampling Of Metals And Non Chapter - 6 Metals & 80-97 Standard Operating Procedure (Sop) Of Sample Preparation For Analysis Of Metals And Non Metals Chapter - 7 Determination Of Polychlorinated Dibenzo-P-Dioxins And 98-127 Polychlorinated Dibenzofurans Standard Operating Procedure For Sampling Of Polychlorinated Chapter - 8 Dibenzo-P-Dioxins And Polychlorinated Dibenzofurans & 128-156 Standard Operating Procedure For Analysis Of Polychlorinated Dibenzo- P-Dioxins And Polychlorinated Dibenzofurans Project Team 1. Dr. B. Sengupta, Member Secretary - Overall supervision 2. Dr. S.D. Makhijani, Director - Report Editing 3. Sh. N.K. Verma, Ex Additional Director - Project co-ordination 4. Sh. P.M. Ansari, Additional Director - Report Finalisation 5. Dr. D.D. Basu, Senior Scientist - Guidance and supervision 6. Sh. Paritosh Kumar, Sr. Env. Engineer - Report processing 7. Sh. Dinabandhu Gouda, Env. Engineer - Data compilation, analysis and preparation of final report 8. Sh. G. Thirumurthy, AEE - - do - 9. Sh. Abhijit Pathak, SSA - - do - 10. Ms. Trapti Dubey, Jr. Professional (Scientist) - - do - 11. Er. Purushotham, Jr. Professional (Engineer) - - do - 12.
    [Show full text]
  • Laboratory Equipment Reference Sheet
    Laboratory Equipment Stirring Rod: Reference Sheet: Iron Ring: Description: Glass rod. Uses: To stir combinations; To use in pouring liquids. Evaporating Dish: Description: Iron ring with a screw fastener; Several Sizes Uses: To fasten to the ring stand as a support for an apparatus Description: Porcelain dish. Buret Clamp/Test Tube Clamp: Uses: As a container for small amounts of liquids being evaporated. Glass Plate: Description: Metal clamp with a screw fastener, swivel and lock nut, adjusting screw, and a curved clamp. Uses: To hold an apparatus; May be fastened to a ring stand. Mortar and Pestle: Description: Thick glass. Uses: Many uses; Should not be heated Description: Heavy porcelain dish with a grinder. Watch Glass: Uses: To grind chemicals to a powder. Spatula: Description: Curved glass. Uses: May be used as a beaker cover; May be used in evaporating very small amounts of Description: Made of metal or porcelain. liquid. Uses: To transfer solid chemicals in weighing. Funnel: Triangular File: Description: Metal file with three cutting edges. Uses: To scratch glass or file. Rubber Connector: Description: Glass or plastic. Uses: To hold filter paper; May be used in pouring Description: Short length of tubing. Medicine Dropper: Uses: To connect parts of an apparatus. Pinch Clamp: Description: Glass tip with a rubber bulb. Uses: To transfer small amounts of liquid. Forceps: Description: Metal clamp with finger grips. Uses: To clamp a rubber connector. Test Tube Rack: Description: Metal Uses: To pick up or hold small objects. Beaker: Description: Rack; May be wood, metal, or plastic. Uses: To hold test tubes in an upright position.
    [Show full text]
  • Catching up with Runaway Hot Plates
    Catching up with Runaway Hot Plates Kimberly Brown1, Mark Mathews2, Joseph Pickel3 1‐ Office of Environmental Health and Radiation Safety University of Pennsylvania, Philadelphia, PA 2‐ Environmental Safety and Health Directorate, Oak Ridge National Laboratory, Oak Ridge TN 3‐ Physical Sciences Directorate, Oak Ridge National Laboratory, Oak Ridge TN Recent Events with Malfunctioning Abstract Cause of Fire identified as Runaway Hot Plates Hotplate Several research institutions report safety events involving hotplates that have been In recent years, there have been numerous reports of runaway hot plates — hot left on and unattended or that have heated uncontrollably, sometimes resulting in plates that heat uncontrolled despite the setting or the fact that the controls are in significant damage in the process. Some of the known events are listed below: the off position. Some of these events have resulted in damage to research • June 29, 2005: Lawrence Berkeley National Laboratory — A laboratory hot plate’s facilities. The Division of Chemical Health and Safety has investigated this issue power switch failed, resulting in a fire in the fume hood. Although the switch using all available information and soliciting additional information viaasurvey position, switch detent, and indicator light demonstrated that the power was off, conducted in April 2017 to determine the cause of these issues and to develop Valid NRTL listing electrical power continued to flow to the heating elements. strategies to prevent future “runaways‘’. Results of this survey and best practices (http://www2.lbl.gov/ehs/Lessons/pdf/FinalHotPlateLL.pdf) are described herein. • April 2007: University of California — Following a March 2007 report of a malfunctioning hot plate that heats while in the ‘off’ position, UC EHS personnel send out a system wide message concerning the issue citing “several explosions or Survey Information fire events involving defective hot plates that resulted in injuries to laboratory employees or damage to laboratories” over the previous five years.
    [Show full text]
  • Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes
    LysR transcriptional regulator Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 13/164 (8%) 70530- SNQAIKTYLMPK*LRLLRQK*SPVEFQLQVHLIKKIRLNIVIRDINLTIIEN-TPVKLKI -70354 ++Q TYLMP+ + L RQK V QLQVH ++I ++ INL II P++LK 86251- ASQTTGTYLMPRLIGLFRQKYPQVAVQLQVHSTRRIAWSVANGHINLAIIGGEVPIELKN -86072 70353- FYTLLRMKERI*H*YCLGFL------FQFLIAYKKKNLYGLRLIKVDIPFPIRGIMNNP* -70192 + E L + F L + +K++LY LR I +D IR +++ 86071- MLQVTSYAED-----ELALILPKSHPFSMLRSIQKEDLYRLRFIALDRQSTIRKVIDKVL -85907 70191- IKTELIPRNLN-EMELSLFKPIKNAV*PGLNVTLIFVSAIAKEL -70063 + + EMEL+ + IKNAV GL + VSAIAKEL 85906- NQNGIDSTRFKIEMELNSVEAIKNAVQSGLGAAFVSVSAIAKEL -85775 ycf3 Photosystem I assembly protein Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 3/59 (5%) 19162- NRSYML-SIQCM-PNNSDYVNTLKHCR*ALDLSSKL-LAIRNVTISYYCQDIIFSEKKD -19329 +RSY+L +I + +N +YV L++ ALDL+S+L AI N+ + Y+ Q + SEKKD 19583- DRSYILYNIGLIYASNGEYVKALEYYHQALDLNSRLPPAINNIAVIYHYQGVKASEKKD -19759 Fig.S1. The pairwise aligments of high scoring pairs of recognizable pseudogenes. The upper amino acid sequences indicates Cryptomonas sp. SAG977-2f. The lower sequences are corresponding amino acid sequences of homologs in C. curvata CCAP979/52. Table S1. Presence/absence of protein genes in the plastid genomes of Cryptomonas and representative species of Cryptomonadales. Note; y indicates pseudogenes. Photosynthetic Non-Photosynthetic Guillardia Rhodomonas Cryptomonas C. C. curvata C. curvata parameciu Guillardia Rhodomonas FBCC300 CCAP979/ SAG977 CCAC1634 m theta salina -2f B 012D 52 CCAP977/2 a rps2 + + + +
    [Show full text]
  • Science Safety
    2010 Mississippi Science Framework Science Safety The guides that are cited below were developed by the Council of State Science Supervisors (CSSS) with support from the Eisenhower National Clearinghouse for Mathematics and Science Education, the National Aeronautics and Space Administration, Dupont Corporation, Intel Corporation, Americal Chemical Society, and the National Institutes of Health. Science Safety Booklets may be printed for use by educators. • Science Safety Booklets • Science and Safety: It's Elementary (PDF) - A Elementary Safety Guide • Science and Safety, Making the Connection (PDF) - A Secondary Safety Guide . Approved July 25, 2008 1 2010 Mississippi Science Framework A SUGGESTED PATTERN FOR CHEMICAL STORAGE The alphabetical method for storing chemicals presents hazards because chemicals, which can react violently with each other, may be stored in close proximity. Schools may wish to devise a simple color-coding scheme to address this problem. The code shown below, reproduced with permission from School Science Laboratories-A Guide to Some Hazardous Substances by the Council of State Science Supervisors, includes both solid and striped colors which are used to designate specific hazards as follows: Red - Flammability hazard: Store in a flammable chemical storage area. Red Stripe - Flammability hazard: Do not store in the same area as other flammable substances. Yellow - Reactivity hazard: Store separately from other chemicals. Yellow Stripe - Reactivity hazard: Do not store with other yellow coded chemicals; store separately. White - Contact hazard: Store separately in a corrosion-proof container. White Stripe - Contact hazard: Not compatible with chemicals in solid white category. Blue - Health hazard: Store in a secure poison area. Orange - Not suitably characterized by any of the foregoing categories.
    [Show full text]
  • Assessment of Transoceanic NOBOB Vessels and Low-Salinity Ballast Water As Vectors for Non-Indigenous Species Introductions to the Great Lakes
    A Final Report for the Project Assessment of Transoceanic NOBOB Vessels and Low-Salinity Ballast Water as Vectors for Non-indigenous Species Introductions to the Great Lakes Principal Investigators: Thomas Johengen, CILER-University of Michigan David Reid, NOAA-GLERL Gary Fahnenstiel, NOAA-GLERL Hugh MacIsaac, University of Windsor Fred Dobbs, Old Dominion University Martina Doblin, Old Dominion University Greg Ruiz, Smithsonian Institution-SERC Philip Jenkins, Philip T Jenkins and Associates Ltd. Period of Activity: July 1, 2001 – December 31, 2003 Co-managed by Cooperative Institute for Limnology and Ecosystems Research School of Natural Resources and Environment University of Michigan Ann Arbor, MI 48109 and NOAA-Great Lakes Environmental Research Laboratory 2205 Commonwealth Blvd. Ann Arbor, MI 48105 April 2005 (Revision 1, May 20, 2005) Acknowledgements This was a large, complex research program that was accomplished only through the combined efforts of many persons and institutions. The Principal Investigators would like to acknowledge and thank the following for their many activities and contributions to the success of the research documented herein: At the University of Michigan, Cooperative Institute for Limnology and Ecosystem Research, Steven Constant provided substantial technical and field support for all aspects of the NOBOB shipboard sampling and maintained the photo archive; Ying Hong provided technical laboratory and field support for phytoplankton experiments and identification and enumeration of dinoflagellates in the NOBOB residual samples; and Laura Florence provided editorial support and assistance in compiling the Final Report. At the Great Lakes Institute for Environmental Research, University of Windsor, Sarah Bailey and Colin van Overdijk were involved in all aspects of the NOBOB shipboard sampling and conducted laboratory analyses of invertebrates and invertebrate resting stages.
    [Show full text]
  • Eight New Filter Bags from Whirl-Pak® Three New Hydrated Sponge
    NEW PRODUCTS Eight new filter bags from whirl-pak® Specially designed for use with homogenizer blenders. Extra-heavy PET film and special features for easier and more efficient testing. Additional sizes and styles on page 11. Vertical Filter Bags Bags use a special laminated PET film for durability and a vertical nonwoven filter to separate solids for easy pipetting of the liquid sample. Available with or without a closure, each bag contains a 250 micron polyester filter adhered vertically along the side of the 3 mil (0.76 mm) bag. Easy-pour side seal allows you to simply pour liquid out of the bag without also emptying solids. Hydrated PolySponge™ Bags B01586 — 55 oz. With Closure three new Hydrated sponge products from whirl-pak® Make environmental surface sampling faster and easier with these pre-moistened bags. Durable high-density polyurethane sponge is ready to use and resists tearing and fraying. Each is hydrated with HiCap™ Neutralizing Broth. Additional information on page 12. Hydrated PolyProbe™ HiCap™ is a registered trademark of World Bioproducts, LLC. ctured under a ufa qua n li Whirl-Pak® Bags are manufactured under a quality management system certified to ISO9001, except B01299, B01350, a t y M m o , , , , , , , and which require an additional processing step an t B01392 B01422 B01423 B01475 B01478 B01590 B01591 B01592 age fied ISO9001ment system certi done outside of regular production. • Standard Methods Says — Standard Methods (18th edition, 1992, section 9060A, sample containers) states “For some applications, samples may be collected in pre-sterilized plastic bags.” Whirl-Pak® bags meet this description.
    [Show full text]
  • Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea
    Baltic Sea Environment Proceedings No.106 Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Baltic Sea Environment Proceedings No. 106 Biovolumes and size-classes of phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Authors: Irina Olenina, Centre of Marine Research, Taikos str 26, LT-91149, Klaipeda, Lithuania Susanna Hajdu, Dept. of Systems Ecology, Stockholm University, SE-106 91 Stockholm, Sweden Lars Edler, SMHI, Ocean. Services, Nya Varvet 31, SE-426 71 V. Frölunda, Sweden Agneta Andersson, Dept of Ecology and Environmental Science, Umeå University, SE-901 87 Umeå, Sweden, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Norbert Wasmund, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Susanne Busch, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Jeanette Göbel, Environmental Protection Agency (LANU), Hamburger Chaussee 25, D-24220 Flintbek, Germany Slawomira Gromisz, Sea Fisheries Institute, Kollataja 1, 81-332, Gdynia, Poland Siv Huseby, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Maija Huttunen, Finnish Institute of Marine Research, Lyypekinkuja 3A, P.O. Box 33, FIN-00931 Helsinki, Finland Andres Jaanus, Estonian Marine Institute, Mäealuse 10 a, 12618 Tallinn, Estonia Pirkko Kokkonen, Finnish Environment Institute, P.O. Box 140, FIN-00251 Helsinki, Finland Iveta Ledaine, Inst. of Aquatic Ecology, Marine Monitoring Center, University of Latvia, Daugavgrivas str. 8, Latvia Elzbieta Niemkiewicz, Maritime Institute in Gdansk, Laboratory of Ecology, Dlugi Targ 41/42, 80-830, Gdansk, Poland All photographs by Finnish Institute of Marine Research (FIMR) Cover photo: Aphanizomenon flos-aquae For bibliographic purposes this document should be cited to as: Olenina, I., Hajdu, S., Edler, L., Andersson, A., Wasmund, N., Busch, S., Göbel, J., Gromisz, S., Huseby, S., Huttunen, M., Jaanus, A., Kokkonen, P., Ledaine, I.
    [Show full text]