DOCSLIB.ORG

S100A2, a Putative Tumor Suppressor Gene, Regulates in Vitro

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
S100A2, a Putative Tumor Suppressor Gene, Regulates in Vitro 0023-6837/01/8104-599$03.00/0 LABORATORY INVESTIGATION Vol. 81, No. 4, p. 599, 2001 Copyright © 2001 by The United States and Canadian Academy of Pathology, Inc. Printed in U.S.A. S100A2, a Putative Tumor Suppressor Gene, Regulates In Vitro Squamous Cell Carcinoma Migration Nathalie Nagy, Carmen Brenner, Nicolas Markadieu, Carole Chaboteaux, Isabelle Camby, Beat W. Schäfer, Roland Pochet, Claus W. Heizmann, Isabelle Salmon, Robert Kiss, and Christine Decaestecker Department of Pathology (NN, IS), Erasmus University Hospital, and Laboratories of Molecular Virology (CB) and Histopathology (NM, CC, IC, RP, RK, CD), Faculty of Medicine; Université Libre de Bruxelles, Brussels, Belgium; Division of Clinical Chemistry and Biochemistry (BWS, CWH), Department of Pediatrics, University of Zürich, Zürich, Switzerland; and Fonds National de la Recherche Scientifique (RK, CD), Brussels, Belgium SUMMARY: It has been previously shown that S100A2 is down-regulated in tumor cells and can be considered a tumor suppressor. We have recently shown that this down-regulation can be observed particularly in epithelial tissue, where S100A2 expression decreases remarkably in tumors as compared with normal specimens. In the present paper we investigate whether S100A2 could play a tumor-suppressor role in certain epithelial tissues by acting at the cell migration level. To this end, we made use of five in vitro human head and neck squamous cell carcinoma lines in which we characterized S100A2 expression at both RNA and protein level. To characterize the influence of S100A2 on cell kinetic and cell motility features, we used two complementary approaches involving specific antisense oligonucleotides and the addition of S100A2 to the culture media. The different expression analyses gave a coherent demonstration of the fact that the FADU and the RPMI-2650 cell lines exhibit high and low levels of S100A2 expression, respectively. Antisense oligonucleotides (in FADU) and extracellular treatments (in RPMI) showed that, for these two models, S100A2 had a clear inhibitory influence on cell motility while modifying the cell kinetic parameters only slightly. These effects seem to be related, at least in part, to a modification in the polymerization/ depolymerization dynamics of the actin microfilamentary cytoskeleton. Furthermore, we found evidence of the presence of the receptor for advanced glycation end-products (RAGE) in RPMI cells, which may act as a receptor for extracellular S100A2. The present study therefore presents experimentally based evidence showing that S100A2 could play a tumor-suppressor role in certain epithelial tissues by restraining cell migration features, at least in the case of head and neck squamous cell carcinomas. (Lab Invest 2001, 81:599–612). alcium regulates a variety of biological pro- Heizmann and Cox, 1998; Schäfer and Heizmann, C cesses as a second messenger, and Ca2ϩ sig- 1996). To date, some 19 different proteins have been nals are transduced into intracellular responses via an assigned to the S100 protein family, and the genes interaction with numerous Ca2ϩ-binding proteins encoding more than ten S100 proteins are located in a characterized by the EF-hand motif (Donato, 1999; cluster on human chromosome 1q21 (Schäfer and Schäfer and Heizmann, 1996). The biological pro- Heizmann, 1996). cesses upon which calcium exerts a significant influ- S100A2 is of particular interest because its cDNA ence include cell proliferation, cell migration, and coding was identified in a search for novel tumor- muscle contraction (Donato 1999; Gimona et al, 1997; suppressor genes as the result of subtractive hybrid- Schäfer and Heizmann, 1996). The family of S100 ization between normal and tumor-derived human proteins has grown to be one of the largest superfami- mammary epithelial cells (Lee et al, 1991). Extending lies of EF-hand proteins since the first S100 protein this observation to breast tumors, Lee et al (1992) was identified from brain tissue more than 30 years showed a marked down-regulation of S100A2 in 2ϩ ago as an acidic, low-molecular-mass, Ca -binding breast tumor biopsies. In the same way, we have protein (Moore, 1965). The physiological and struc- shown that, whereas no expression of the S100A2 tural properties of S100 proteins suggest that they are gene could be detected on 11 tumorigenic human 2ϩ trigger or activator proteins, whereas other Ca - breast epithelial cell lines, a normal breast epithelial binding proteins act mainly as buffers (Donato, 1999; cell line and biopsy specimens did express S100A2 (Pedrocchi et al, 1994). The down-regulation of Received January 22, 2001. S100A2 is not restricted to breast cancer but is also Address reprint requests to: Dr. Christine Decaestecker, Laboratory of found in melanomas (Maelandsmo et al, 1997) and Histopathology, Faculty of Medicine, Université Libre de Bruxelles, 808 other tumor types (Ilg et al, 1996). All these data have route de Lennik, 1070 Brussels, Belgium. E-mail: [email protected] thus led to the designation of the S100A2 gene as a Laboratory Investigation • April 2001 • Volume 81 • Number 4 599 Nagy et al Figure 1. 600 Laboratory Investigation • April 2001 • Volume 81 • Number 4 S100A2 Influence on Cell Carcinoma Migration tumor suppressor, and S100A2 might therefore be literature (Komada et al, 1996). We also investigated generally down-regulated when cells acquire a tumor- the presence of the receptor for advanced glycation igenic phenotype, a factor which implies that the end products (RAGE), a candidate receptor for S100/ protein may play a role in inhibiting tumor progression calgranulin polypeptides (Hofmann et al, 1999), which or suppressing tumor cell growth (Wicki et al, 1997). In we found evidence of particularly in the RPMI model. addition, the expression of S100A2 can be induced by growth factors (Lee et al, 1992; Stoll et al, 1998). For Results example, epidermal growth factor (EGF) receptor ac- tivation selectively stimulates S100A2 gene expres- S100A2 Expression in Five In Vitro Models of Human Squamous Cell Carcinomas sion at the transcriptional level in human keratinocytes (Stoll et al, 1998). Taking the five HNSCC cell lines analyzed, Figure 2, A In a recent study (N Nagy, D Hoyaux, I Gielen, BW and B, illustrates the results obtained by RT-PCR (A) to Schafer, R Pochet, CW Heizmann, R Kiss, I Salmon, reveal the presence of S100A2 mRNAs and by Western and C Decaestecker, unpublished data), we charac- blotting (B) to show S100A2 expression at the protein terized the level of immunohistochemical S100A2 ex- level. To confirm and refine these first results, quantita- pression in a large set of normal and tumoral (benign tive analyses of S100A2 expression were undertaken by and malignant) tissues of various histological origins, means of computer-assisted microscopy applied to but epithelial in the great majority of cases (with either conventional immunohistochemistry. In Figure 2C, the glandular, squamous, respiratory, or urothelial differ- labeling index (LI) reports the percentage of immunopo- entiation). The data show that S100A2 is expressed sitive cells, and in Figure 2D, the mean optical density only marginally, if at all, in nonepithelial tissue. In (MOD) denotes staining intensity computed on the im- epithelial tissue its level of expression decreases dra- munopositive cells only. Because of standardization (see matically in tumors compared with normal specimens “Materials and Methods”), these two variables enable a (Fig. 1, A and B). We also showed that S100A2 is precise quantitative evaluation and comparison of colocated with cytokeratin K14, an intermediate fila- S100A2 expression to be established in the five cell lines ment protein characteristic of epithelial cells, which is analyzed. All of these data give a consistent representa- expressed in basal proliferative keratinocytes. tion of the different levels of S100A2 expression encoun- The present study aims to investigate whether tered in the five cell lines analyzed. Of these, the FADU S100A2 could play its tumor-suppressor role in epi- and RPMI models exhibited particularly high and low thelium tissue by acting at the cell-migration level. To levels of S100A2 expression, respectively. This is why this end, we first characterized the S100A2 expression we chose these two models to investigate the influence levels in five in vitro human head and neck squamous of S100A2 on HNSCC cell kinetic and migration proper- cell carcinoma (HNSCC) lines (the FADU, Det-562, ties, as reported below. RPMI, SCC-9, and SCC-25 models). This was done at the RNA level by means of reverse transcription- S100A2 Inhibition in FADU Cells by Means of Specific polymerase chain reaction (RT-PCR) and at the pro- Antisense Oligonucleotides tein level by means of Western blotting and immuno- histochemistry. Two models (FADU and RPMI) We chose the FADU and the RPMI cell lines as biological expressing S100A2 at a high and a low level, respec- models. As reported above, while the RPMI model tively, were selected on the basis of the results ob- shows a relatively low level of expression, the FADU tained. The influence of S100A2 on these two models model shows a high one. We accordingly analyzed the was then analyzed at the cell kinetic and cell motility effects of S100A2 inhibition in the FADU cells by means levels. This was carried out in two complementary of antisense oligonucleotides and S100A2 added exter- ways: S100A2 expression was inhibited in the FADU nally to the RPMI cells (see below). model (high natural expression)
Load more

Recommended publications
  • Rage (Receptor for Advanced Glycation End Products) in Melanoma
    RAGE (RECEPTOR FOR ADVANCED GLYCATION END PRODUCTS) IN MELANOMA PROGRESSION A Dissertation Submitted to the Graduate Faculty of the North Dakota State University of Agriculture and Applied Science By Varsha Meghnani In Partial Fulfillment for the Degree of DOCTOR OF PHILOSOPHY Major Department: Pharmaceutical Sciences May 2014 Fargo, North Dakota North Dakota State University Graduate School Title RAGE (RECEPTOR FOR ADVANCED GLYCATION END PRODUCTS) IN MELANOMA PROGRESSION By VARSHA MEGHNANI The Supervisory Committee certifies that this disquisition complies with North Dakota State University’s regulations and meets the accepted standards for the degree of DOCTOR OF PHILOSOPHY SUPERVISORY COMMITTEE: ESTELLE LECLERC Chair BIN GUO STEPHEN O’ROURKE JANE SCHUH Approved: 5/22/2014 JAGDISH SINGH Date Department Chair ABSTRACT The Receptor for Advanced Glycation End Products (RAGE) and its ligands are expressed in multiple cancer types and are implicated in cancer progression. Our lab has previously reported higher transcript levels of RAGE and S100B in advanced staged melanoma patients. The contribution of RAGE in the pathophysiology of melanoma has not been well studied. Based on previous reports, we hypothesized that RAGE, when over-expressed in melanoma cells, promotes melanoma progression. To study the pathogenic role of RAGE in melanoma, a primary melanoma cell line, WM115, was selected and stably transfected with full length RAGE (FL_RAGE) to generate a model cell line over-expressing RAGE (WM115_RAGE). WM266, a sister cell line of WM115, originated from a metastatic tumor of the same patient was used as a metastatic control cell line in the study. After assessing the expression levels of RAGE in the transfected cells, the influence of RAGE on their cellular properties was examined.
    [Show full text]
  • The UVB-Induced Gene Expression Profile of Human Epidermis in Vivo Is Different from That of Cultured Keratinocytes
    Oncogene (2006) 25, 2601–2614 & 2006 Nature Publishing Group All rights reserved 0950-9232/06 $30.00 www.nature.com/onc ORIGINAL ARTICLE The UVB-induced gene expression profile of human epidermis in vivo is different from that of cultured keratinocytes CD Enk1, J Jacob-Hirsch2, H Gal3, I Verbovetski4, N Amariglio2, D Mevorach4, A Ingber1, D Givol3, G Rechavi2 and M Hochberg1 1Department of Dermatology, The Hadassah-Hebrew University Medical Center, Jerusalem, Israel; 2Department of Pediatric Hemato-Oncology and Functional Genomics, Safra Children’s Hospital, Sheba Medical Center and Sackler School of Medicine, Tel-Aviv University,Tel Aviv, Israel; 3Department of Molecular Cell Biology, Weizmann Institute of Science, Rehovot, Israel and 4The Laboratory for Cellular and Molecular Immunology, Department of Medicine, The Hadassah-Hebrew University Medical Center, Jerusalem, Israel In order to obtain a comprehensive picture of the radiation. UVB, with a wavelength range between 290 molecular events regulating cutaneous photodamage of and 320 nm, represents one of the most important intact human epidermis, suction blister roofs obtained environmental hazards affectinghuman skin (Hahn after a single dose of in vivo ultraviolet (UV)B exposure and Weinberg, 2002). To protect itself against the were used for microarray profiling. We found a changed DNA-damaging effects of sunlight, the skin disposes expression of 619 genes. Half of the UVB-regulated genes over highly complicated cellular programs, including had returned to pre-exposure baseline levels at 72 h, cell-cycle arrest, DNA repair and apoptosis (Brash et al., underscoring the transient character of the molecular 1996). Failure in selected elements of these defensive cutaneous UVB response.
    [Show full text]
  • 8296.Full.Pdf
    Inflammation-Induced Chondrocyte Hypertrophy Is Driven by Receptor for Advanced Glycation End Products This information is current as Denise L. Cecil, Kristen Johnson, John Rediske, Martin of September 28, 2021. Lotz, Ann Marie Schmidt and Robert Terkeltaub J Immunol 2005; 175:8296-8302; ; doi: 10.4049/jimmunol.175.12.8296 http://www.jimmunol.org/content/175/12/8296 Downloaded from References This article cites 43 articles, 13 of which you can access for free at: http://www.jimmunol.org/content/175/12/8296.full#ref-list-1 http://www.jimmunol.org/ Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication by guest on September 28, 2021 *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2005 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Inflammation-Induced Chondrocyte Hypertrophy Is Driven by Receptor for Advanced Glycation End Products1 Denise L. Cecil,* Kristen Johnson,* John Rediske,‡ Martin Lotz,§ Ann Marie Schmidt,† and Robert Terkeltaub2* The multiligand receptor for advanced glycation end products (RAGE) mediates certain chronic vascular and neurologic degen- erative diseases accompanied by low-grade inflammation.
    [Show full text]
  • (Rage) in Progression of Pancreatic Cancer
    The Texas Medical Center Library DigitalCommons@TMC The University of Texas MD Anderson Cancer Center UTHealth Graduate School of The University of Texas MD Anderson Cancer Biomedical Sciences Dissertations and Theses Center UTHealth Graduate School of (Open Access) Biomedical Sciences 8-2017 INVOLVEMENT OF THE RECEPTOR FOR ADVANCED GLYCATION END PRODUCTS (RAGE) IN PROGRESSION OF PANCREATIC CANCER Nancy Azizian MS Follow this and additional works at: https://digitalcommons.library.tmc.edu/utgsbs_dissertations Part of the Biology Commons, and the Medicine and Health Sciences Commons Recommended Citation Azizian, Nancy MS, "INVOLVEMENT OF THE RECEPTOR FOR ADVANCED GLYCATION END PRODUCTS (RAGE) IN PROGRESSION OF PANCREATIC CANCER" (2017). The University of Texas MD Anderson Cancer Center UTHealth Graduate School of Biomedical Sciences Dissertations and Theses (Open Access). 748. https://digitalcommons.library.tmc.edu/utgsbs_dissertations/748 This Dissertation (PhD) is brought to you for free and open access by the The University of Texas MD Anderson Cancer Center UTHealth Graduate School of Biomedical Sciences at DigitalCommons@TMC. It has been accepted for inclusion in The University of Texas MD Anderson Cancer Center UTHealth Graduate School of Biomedical Sciences Dissertations and Theses (Open Access) by an authorized administrator of DigitalCommons@TMC. For more information, please contact [email protected]. INVOLVEMENT OF THE RECEPTOR FOR ADVANCED GLYCATION END PRODUCTS (RAGE) IN PROGRESSION OF PANCREATIC CANCER by Nancy
    [Show full text]
  • Transcriptional Activation of the Human S100A2 Promoter by Wild-Type P53
    FEBS 21606 FEBS Letters 445 (1999) 265^268 Transcriptional activation of the human S100A2 promoter by wild-type p53 Mingjia Tana, Claus W. Heizmannb, Kunliang Guanc, Beat W. Schaferb, Yi Suna;* aDepartment of Molecular Biology, Parke-Davis Pharmaceutical Research, Division of Warner-Lambert Company, Ann Arbor, MI 48105, USA bDepartment of Pediatrics, Division of Clinical Chemistry and Biochemistry, University of Zurich, Zurich, Switzerland cDepartment of Biological Chemistry, University of Michigan, Ann Arbor, MI 48109, USA Received 18 January 1999 2. Materials and methods Abstract S100A2, a calcium binding protein of the EF-hand family, was recently identified to be inducible by etoposide, a p53 2.1. Cell culture and drug treatment activator. A potential p53 binding site was identified in the Two human osteogenic sarcoma cell lines, U2-OS and Saos-2 promoter of the S100A2 gene, which binds to purified p53 as well (ATCC), were grown in McCory or DMEM supplemented with as p53 in nuclear extract activated by etoposide. Transactivation 10% FCS, respectively. U2-OS cells harbor a wild-type p53 [13], assays using the promoter driven luciferase reporters revealed whereas Saos-2 cells have the p53 gene deleted [14]. For drug treat- that the S100A2 promoter was transcriptionally activated by ment, U2-OS and Saos-2 cells were exposed to etoposide (25 WM, wild-type p53, but not by p53 mutants, in a dose-dependent as Sigma) for various periods of time up to 48 h. well as a p53 binding site-dependent manner. The p53-induced 2.2. Gel shift assay transactivation of the S100A2 promoter was enhanced by The assay was performed as described previously [15], using as the etoposide and blocked by a dominant negative p53 mutant.
    [Show full text]
  • S100 Alpha 2 (S100A2) (NM 005978) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC201203 S100 alpha 2 (S100A2) (NM_005978) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: S100 alpha 2 (S100A2) (NM_005978) Human Tagged ORF Clone Tag: Myc-DDK Symbol: S100A2 Synonyms: CAN19; S100L Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC201203 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGTGCAGTTCTCTGGAGCAGGCGCTGGCTGTGCTGGTCACTACCTTCCACAAGTACTCCTGCCAAG AGGGCGACAAGTTCAAGCTGAGTAAGGGGGAAATGAAGGAACTTCTGCACAAGGAGCTGCCCAGCTTTGT GGGGGAGAAAGTGGATGAGGAGGGGCTGAAGAAGCTGATGGGCAGCCTGGATGAGAACAGTGACCAGCAG GTGGACTTCCAGGAGTATGCTGTTTTCCTGGCACTCATCACTGTCATGTGCAATGACTTCTTCCAGGGCT GCCCAGACCGACCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC201203 protein sequence Red=Cloning site Green=Tags(s) MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQ VDFQEYAVFLALITVMCNDFFQGCPDRP myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6143_g11.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical
    [Show full text]
  • Global Identification of MLL2-Targeted Loci Reveals Mll2ts Role in Diverse
    Global identification of MLL2-targeted loci reveals MLL2’s role in diverse signaling pathways Changcun Guoa,b,c,1, Chun-Chi Changa,b,c,1, Matthew Worthama,b,c, Lee H. Chena,b,c, Dawn N. Kernagisc, Xiaoxia Qind, Young-Wook Choe,2, Jen-Tsan Chid, Gerald A. Granta,b,f, Roger E. McLendona,b,c, Hai Yana,b,c, Kai Gee, Nickolas Papadopoulosg, Darell D. Bignera,b,c, and Yiping Hea,b,c,3 aThe Preston Robert Tisch Brain Tumor Center at Duke, bPediatric Brain Tumor Foundation Institute, cDepartment of Pathology, dInstitute for Genome Sciences and Policy, and fDepartment of Surgery, Duke University, Durham, NC 27710; eLaboratory of Endocrinology and Receptor Biology, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD 20892; and gLudwig Center for Cancer Genetics and Therapeutics, Sidney Kimmel Comprehensive Cancer Center, Baltimore, MD 21231 Edited* by Bert Vogelstein, Johns Hopkins University, Baltimore, MD, and approved September 14, 2012 (received for review June 1, 2012) Myeloid/lymphoid or mixed-lineage leukemia (MLL)-family genes SWI/SNF, the MLL2 or MLL3 (hereafter referred to as MLL2/ encode histone lysine methyltransferases that play important 3) complex has been found to play essential roles as a coactivator roles in epigenetic regulation of gene transcription. MLL genes for transcriptional activation by nuclear hormone receptors (11). are frequently mutated in human cancers. Unlike MLL1, MLL2 (also Consistent with this notion, previous studies have shown that known as ALR/MLL4) and its homolog MLL3 are not well-under- MLL2/3 complexes regulate Hox gene transcription in an es- stood.
    [Show full text]
  • Identification of S100A2 As a Target of the Np63 Oncogenic Pathway
    4282 Vol. 9, 4282–4285, September 15, 2003 Clinical Cancer Research Identification of S100A2 as a Target of the ⌬Np63 Oncogenic Pathway 1 2 Kenji Hibi, Shin-ichi Fujitake, p53. A transcript that lacked the NH2-terminal TA domain of Tsunenobu Takase, Yasuhiro Kodera, p53 (⌬Np63) was found to act in a dominant-negative fashion 3 Katsuki Ito, Seiji Akiyama, Masatoshi Shirane, and to be able to suppress p53 TA. We additionally examined ⌬Np63 status and observed ⌬Np63 overexpression in head and and Akimasa Nakao neck cancer cell lines and primary lung cancers associated with Gastroenterological Surgery, Nagoya University Graduate School of a low-level increase in chromosomal copy number (7). More- Medicine, Nagoya 466-8560 [K. H., S. F., T. T., Y. K., K. I., S. A., over, we found that increased expression of ⌬Np63 in mouse A. N.], and Department of Product Research, Nippon Roche Research Center, Kanagawa 247-8530 [M. S.], Japan fibroblast cells led to a transformed phenotype. Conversely, no evidence of a tumor-suppressive function of ⌬Np63 in these cancers was found. In addition, proliferating human keratino- ABSTRACT cytes and various epithelial neoplastic cells and lesions predom- Purpose and Experimental Design: It has been proved inantly express the ⌬Np63 isotypes (8–10). We found recently recently that ⌬Np63 may play an oncogenic role in the that high ⌬Np63 gene expression was significantly associated tumorigenic pathway of squamous cell cancers. To gain with lymph node metastasis in esophageal squamous cell cancer additional insight into this pathway, we examined global (11). These data suggested that ⌬Np63 might play an oncogenic patterns of gene expression in cancer cells after ⌬Np63 role in squamous cell cancers.
    [Show full text]
  • RAGE Signaling in Melanoma Tumors
    International Journal of Molecular Sciences Review RAGE Signaling in Melanoma Tumors Olamide T. Olaoba , Sultan Kadasah, Stefan W. Vetter and Estelle Leclerc * Department of Pharmaceutical Sciences, School of Pharmacy, North Dakota State University, Fargo, ND 58105, USA; [email protected] (O.T.O.); [email protected] (S.K.); [email protected] (S.W.V.) * Correspondence: [email protected]; Tel.: +1-701-231-5187 Received: 30 October 2020; Accepted: 23 November 2020; Published: 26 November 2020 Abstract: Despite recent progresses in its treatment, malignant cutaneous melanoma remains a cancer with very poor prognosis. Emerging evidences suggest that the receptor for advance glycation end products (RAGE) plays a key role in melanoma progression through its activation in both cancer and stromal cells. In tumors, RAGE activation is fueled by numerous ligands, S100B and HMGB1 being the most notable, but the role of many other ligands is not well understood and should not be underappreciated. Here, we provide a review of the current role of RAGE in melanoma and conclude that targeting RAGE in melanoma could be an approach to improve the outcomes of melanoma patients. Keywords: melanoma; RAGE; receptor for advanced glycation end products; S100 proteins; HMGB1; inflammation; tumorigenesis; melanomagenesis 1. Melanoma Melanoma originates from the abnormal growth of melanocytes, and it can become very invasive and aggressive [1]. Despite being relatively rare among cutaneous cancers (<5%), melanoma is the leading cause of skin cancer-related mortality [2,3]. Melanocytes are part of a complex of three cell types that constitute the keratinocyte, Langerhans cells, and melanocyte (KLM) unit of the epidermis, and they are critical for melanin production [4].
    [Show full text]
  • Zimmer Cell Calcium 2013 Mammalian S100 Evolution.Pdf
    Cell Calcium 53 (2013) 170–179 Contents lists available at SciVerse ScienceDirect Cell Calcium jo urnal homepage: www.elsevier.com/locate/ceca Evolution of the S100 family of calcium sensor proteins a,∗ b b,1 b Danna B. Zimmer , Jeannine O. Eubanks , Dhivya Ramakrishnan , Michael F. Criscitiello a Center for Biomolecular Therapeutics and Department of Biochemistry & Molecular Biology, University of Maryland School of Medicine, 108 North Greene Street, Baltimore, MD 20102, United States b Comparative Immunogenetics Laboratory, Department of Veterinary Pathobiology, College of Veterinary Medicine & Biomedical Sciences, Texas A&M University, College Station, TX 77843-4467, United States a r t i c l e i n f o a b s t r a c t 2+ Article history: The S100s are a large group of Ca sensors found exclusively in vertebrates. Transcriptomic and genomic Received 4 October 2012 data from the major radiations of mammals were used to derive the evolution of the mammalian Received in revised form 1 November 2012 S100s genes. In human and mouse, S100s and S100 fused-type proteins are in a separate clade from Accepted 3 November 2012 2+ other Ca sensor proteins, indicating that an ancient bifurcation between these two gene lineages Available online 14 December 2012 has occurred. Furthermore, the five genomic loci containing S100 genes have remained largely intact during the past 165 million years since the shared ancestor of egg-laying and placental mammals. Keywords: Nonetheless, interesting births and deaths of S100 genes have occurred during mammalian evolution. Mammals The S100A7 loci exhibited the most plasticity and phylogenetic analyses clarified relationships between Phylogenetic analyses the S100A7 proteins encoded in the various mammalian genomes.
    [Show full text]
  • Global Identification of MLL2-Targeted Loci Reveals Mll2ts Role in Diverse Signaling Pathways
    Global identification of MLL2-targeted loci reveals MLL2’s role in diverse signaling pathways Changcun Guoa,b,c,1, Chun-Chi Changa,b,c,1, Matthew Worthama,b,c, Lee H. Chena,b,c, Dawn N. Kernagisc, Xiaoxia Qind, Young-Wook Choe,2, Jen-Tsan Chid, Gerald A. Granta,b,f, Roger E. McLendona,b,c, Hai Yana,b,c, Kai Gee, Nickolas Papadopoulosg, Darell D. Bignera,b,c, and Yiping Hea,b,c,3 aThe Preston Robert Tisch Brain Tumor Center at Duke, bPediatric Brain Tumor Foundation Institute, cDepartment of Pathology, dInstitute for Genome Sciences and Policy, and fDepartment of Surgery, Duke University, Durham, NC 27710; eLaboratory of Endocrinology and Receptor Biology, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD 20892; and gLudwig Center for Cancer Genetics and Therapeutics, Sidney Kimmel Comprehensive Cancer Center, Baltimore, MD 21231 Edited* by Bert Vogelstein, Johns Hopkins University, Baltimore, MD, and approved September 14, 2012 (received for review June 1, 2012) Myeloid/lymphoid or mixed-lineage leukemia (MLL)-family genes SWI/SNF, the MLL2 or MLL3 (hereafter referred to as MLL2/ encode histone lysine methyltransferases that play important 3) complex has been found to play essential roles as a coactivator roles in epigenetic regulation of gene transcription. MLL genes for transcriptional activation by nuclear hormone receptors (11). are frequently mutated in human cancers. Unlike MLL1, MLL2 (also Consistent with this notion, previous studies have shown that known as ALR/MLL4) and its homolog MLL3 are not well-under- MLL2/3 complexes regulate Hox gene transcription in an es- stood.
    [Show full text]
  • S100 Subunits in Vestibular End Organs of the Rat
    MOJ Anatomy & Physiology Research Article Open Access Subcellular localization of the “classic” s100 subunits in vestibular end organs of the rat Abstract Volume 4 Issue 5 - 2017 Using immunohistochemical techniques, the distribution of the “classic” S100 calcium binding proteins, α (A1) and β (B), was determined in the mammalian vestibular end James D Foster organs. An affinity-purified polyclonal antibody which recognized both the A1 and Division of Anatomy and Molecular Medicine, Alabama College B subunits and two monoclonal antibodies specific for either the A1 or the B subunit of Osteopathic, USA were used in this study. S100A1 was localized specifically to the basal region of the sensory epithelium (saccular macula, cristae ampullaris and utricular macula) when a Correspondence: James D Foster, Division of Anatomy and cross-linking fixative (4% paraformaldehyde) was utilized. Using a fixation protocol Molecular Medicine, Alabama College of Osteopathic, 445 including paraformaldehyde and a precipitating fixative revealed an additional Health Sciences Boulevard, Dothan, Alabama, 36303, USA, Tel localization of S100A1 to the apical region of the saccular macula, cristae ampullaris (334) 944-4012, Fax (334) 944-2268, and utricular macula. This indicates the presence of two populations of S100A1 in these Email [email protected] cells: a cytosolic (soluble) component; and a membrane-bound fraction. In contrast, Received: October 28, 2017 | Published: November 28, S100B was localized to the layer of the vestibular nerve fibers. Immunoreactivity for 2017 S100B was not observed in the sensory epithelium of the saccular or utricular macula or in the cristae ampullaris. The preferential distribution of S100B to the nerve fibers and S100A1 to cells of the sensory epithelium, in two forms (cytosolic and membrane- bound), may be important in the functional roles of S100 proteins in the vestibular sensory end organs.
    [Show full text]