CTNNBIP1 (NM 020248) Human Tagged ORF Clone – RC216082 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC216082

CTNNBIP1 (NM_020248) Human Tagged ORF Clone Product data:

Product Type: Expression Plasmids Product Name: CTNNBIP1 (NM_020248) Human Tagged ORF Clone Tag: Myc-DDK Symbol: CTNNBIP1 Synonyms: ICAT Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC216082 representing NM_020248 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC

ATGAACCGCGAGGGAGCTCCCGGGAAGAGTCCGGAGGAGATGTACATTCAGCAGAAGGTCCGAGTGCTGC TCATGCTGCGGAAGATGGGATCAAACCTGACAGCCAGCGAGGAGGAGTTCCTGCGCACCTATGCAGGGGT GGTCAACAGCCAGCTCAGCCAGCTGCCTCCGCACTCCATCGACCAGGGTGCAGAGGACGTGGTGATGGCG TTTTCCAGGTCGGAGACGGAAGACCGGAGGCAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC216082 representing NM_020248 Red=Cloning site Green=Tags(s)

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA FSRSETEDRRQ

myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6484_h07.zip Restriction Sites: SgfI-MluI

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 CTNNBIP1 (NM_020248) Human Tagged ORF Clone – RC216082

Cloning Scheme:

Plasmid Map:

ACCN: NM_020248 ORF Size: 243 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 CTNNBIP1 (NM_020248) Human Tagged ORF Clone – RC216082

OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_020248.3 RefSeq Size: 2995 bp RefSeq ORF: 246 bp Locus ID: 56998 UniProt ID: Q9NSA3, A0A024R4D7 Protein Families: Druggable Genome, Transcription Factors

Protein Pathways: Wnt signaling pathway MW: 9 kDa Gene Summary: The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Product images:

Western blot validation of overexpression lysate (Cat# [LY412546]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC216082 using transfection reagent MegaTran 2.0 (Cat# [TT210002]).

Coomassie blue staining of purified CTNNBIP1 protein (Cat# [TP316082]). The protein was produced from HEK293T cells transfected with CTNNBIP1 cDNA clone (Cat# RC216082) using MegaTran 2.0 (Cat# [TT210002]).