Hemophilia and Hospitalization a Self Learning Program
Total Page:16
File Type:pdf, Size:1020Kb
Load more
										Recommended publications
									
								- 
												  Clinical Commissioning Policy: Susoctocog Alfa for Treating Bleeding Episodes in People with Acquired Haemophilia a (All Ages)Clinical Commissioning Policy: Susoctocog alfa for treating bleeding episodes in people with acquired haemophilia A (all ages) NHS England Reference: 170061P 1 NHS England INFORMATION READER BOX Directorate Medical Operations and Information Specialised Commissioning Nursing Trans. & Corp. Ops. Commissioning Strategy Finance Publications Gateway Reference: 07603 Document Purpose Policy Clinical commissioning policy: Susoctocog alfa for treating bleeding Document Name episodes in people with acquired haemophilia A (all ages) Author Specialised Commissioning Team Publication Date 29 June 2018 Target Audience CCG Clinical Leaders, Care Trust CEs, Foundation Trust CEs , Medical Directors, Directors of PH, Directors of Nursing, NHS England Regional Directors, NHS England Directors of Commissioning Operations, Directors of Finance, NHS Trust CEs Additional Circulation #VALUE! List Description Routinely Commissioned - NHS England will routinely commission this specialised treatment in accordance with the criteria described in this policy. Cross Reference 0 Superseded Docs 0 (if applicable) Action Required 0 Timing / Deadlines By 00 January 1900 (if applicable) Contact Details for [email protected] further information 0 0 0 0 0 0 Document Status This is a controlled document. Whilst this document may be printed, the electronic version posted on the intranet is the controlled copy. Any printed copies of this document are not controlled. As a controlled document, this document should not be saved onto local or network drives but should always be accessed from the intranet. 2 Standard Operating Procedure: Clinical Commissioning Policy: Susoctocog alfa for treating bleeding episodes in people with acquired haemophilia A (all ages) First published: June 2018 Prepared by the National Institute for Health and Care Excellence (NICE) Commissioning Support Programme Published by NHS England, in electronic format only.
- 
												  Pictures of Central Venous CathetersPictures of Central Venous Catheters Below are examples of central venous catheters. This is not an all inclusive list of either type of catheter or type of access device. Tunneled Central Venous Catheters. Tunneled catheters are passed under the skin to a separate exit point. This helps stabilize them making them useful for long term therapy. They can have one or more lumens. Power Hickman® Multi-lumen Hickman® or Groshong® Tunneled Central Broviac® Long-Term Tunneled Central Venous Catheter Dialysis Catheters Venous Catheter © 2013 C. R. Bard, Inc. Used with permission. Bard, are trademarks and/or registered trademarks of C. R. Bard, Inc. Implanted Ports. Inplanted ports are also tunneled under the skin. The port itself is placed under the skin and accessed as needed. When not accessed, they only need an occasional flush but otherwise do not require care. They can be multilumen as well. They are also useful for long term therapy. ` Single lumen PowerPort® Vue Implantable Port Titanium Dome Port Dual lumen SlimPort® Dual-lumen RosenblattTM Implantable Port © 2013 C. R. Bard, Inc. Used with permission. Bard, are trademarks and/or registered trademarks of C. R. Bard, Inc. Non-tunneled Central Venous Catheters. Non-tunneled catheters are used for short term therapy and in emergent situations. MAHURKARTM Elite Dialysis Catheter Image provided courtesy of Covidien. MAHURKAR is a trademark of Sakharam D. Mahurkar, MD. © Covidien. All rights reserved. Peripherally Inserted Central Catheters. A “PICC” is inserted in a large peripheral vein, such as the cephalic or basilic vein, and then advanced until the tip rests in the distal superior vena cava or cavoatrial junction.
- 
												  Coagulation Factor IX (Recombinant) - Drugbank12/7/2017 Coagulation Factor IX (Recombinant) - DrugBank Coagulation Factor IX (Recombinant) Targets (7) Biointeractions (4) IDENTIFICATION Name Coagulation Factor IX (Recombinant) Accession Number DB00100 (BTD00038, BIOD00038) Type Biotech Groups Approved Biologic Classification Protein Based Therapies Blood factors Description Recombinant Coagulation Factor IX is a purified Factor IX glycoprotein produced by recombinant DNA technology. It has a primary amino acid sequence that is identical to the Ala148 allelic form of human factor IX, and has structural and functional characteristics similar to those of endogenous factor IX. It is not derived from human blood (unlike human Factor IX complex), and is instead produced by a genetically engineered Chinese hamster ovary (CHO) cell line that secretes recombinant Factor IX into cell medium that is then processed and purified for use as a pharmaceutical agent. Recombinant Factor IX is indicated for the control and prevention of bleeding episodes in adult and pediatric patients with congenital factor IX deficiency (Hemophilia B). Protein structure Protein chemical formula C2041H3136N558O641S25 Protein average weight 46548.2 Da https://www.drugbank.ca/drugs/DB00100 1/13 12/7/2017 Coagulation Factor IX (Recombinant) - DrugBank 46548.2 Da Sequences >DB00100 sequence YNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGG SCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAEN QKSCEPAVPFPCGRVSVSQTSKLTRAEAVFPDVDYVNSTEAETILDNITQSTQSFNDFTR VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEE
- 
												  Piccs, Ports and Lines: Clarifying the OptionsCurrent Concepts in Vascular Therapies 2011 Mid-Atlantic Conference PICCs, Ports and Lines: Clarifying the Options Babatunde Almaroof, MD April 2, 2011 Objectives • State the indications for central venous access • Discuss types of central venous catheters • “Clarifying the options”/indications for each kind of catheter. Need for central vascular access • There is an increasing need for vascular access as medical care has become more complex. • Most inpatients are able to get their needs served by a peripheral i.v access • Sometimes however, a central access will be needed due to limitations of a peripheral access – Infiltration, extravasation, thrombosis – Infection and sclerosis • This makes central venous access, the preferred choice for long term use as they allow a higher flow and tolerate hyperosmolar solutions not tolerated by peripheral veins Indications for central venous access • TPN • Chemotherapy • Long term antibiotics – Osteomyelitis, endocarditis, fungal infections • Patients with difficult peripheral vein access • Hemodynamic monitoring • Temporary hemodialysis access • Plasmapheresis Historical Background • The first i.v infusion was performed using a cannula made from quill in 1657 • First successful human blood transfusion was performed in 1667 • Seldinger described his technique for catheter insertion in 1953 • Percutaneous placement of a subclavian vein catheter was reported in 1956 Sites of central venous access • Internal Jugular vein • Subclavian vein – Higher risk of pneumothorax • Femoral vein – Higher risk of
- 
												  Infusaport Insertion in Patients with HaemophiliaInfusaport insertion in patients with haemophilia PURPOSE This guideline is designed to assist medical and nursing staff in the management of children with haemophilia having an infusaport inserted at the Royal Children’s Hospital. DEFINITIONS Infusaport or portacath is an implantable Central Venous Access Device. BACKGROUND Most children with severe haemophilia (<1% Factor VIII or IX) will require prophylactic intravenous clotting factor administration 2-3 times per week to prevent spontaneous bleeding. Accessing peripheral veins can be difficult and traumatic for children and in particular infants/toddlers where veins are often difficult to identify. A number of boys develop significant behavioural issues around treatment after traumatic experiences in their early years. Approximately 80% of children with severe haemophilia treated at the Royal Children’s Hospital will require an infusaport for venous access. Most families report that insertion of a “port” dramatically improves their quality of life in that venous access is no longer fearful and difficult and parents are able to administer clotting factor to their child at home for both prevention and treatment of bleeds. Ports are removed as soon as parents are able to administer clotting factor peripherally. In general ports are removed prior to commencement of primary school. PROCEDURE Once the need for a port has been identified and discussed with the family a referral is made. Mr Joe Crameri performs the majority of infusaport surgery in haemophilia patients at the Royal Children’s Hospital. Many families appreciate the opportunity to see a port (there is one in the haemophilia centre) and to speak with a family whose child is established on home prophylaxis via a port.
- 
												  Venous Access and PortsVenous Access and Ports Helen Starosta Venous access and ports Peripheral IV access Arterio-Venous Fistula Central venous access Peripherally Inserted Central Catheter (PICC) Non Tunnelled Central Venous Catheter (CVC) Tunnelled (e.g. Hickman) Central Venous Access Device Implanted Central Venous Access Device e.g. Infusaport Jesse’s Story Charles’s Story Vein Training Why do we need venous access Treatment for bleeding disorders involves intravenous therapy Therefore reliable venous access is essential to make effective treatment possible The choices for IV access Peripheral IV access Arterio-Venous Fistula Central venous access Peripherally Inserted Central Catheter (PICC) Non Tunnelled Central Venous Catheter (CVC) Tunnelled (e.g. Hickman) Central Venous Access Device Implanted Central Venous Access Device e.g. Infusaport Peripheral Venous Access Butterfly & IV Short term (days) or intermittent therapy Short catheters generally placed in forearm, hand or scalp veins Arterio-Venous Fistula Can last many years Connects an artery directly to a vein → results in more blood flow to the vein → the vein grows larger and stronger Fistula takes a while after surgery to develop (as long as 24 months) Properly formed fistula is less likely than other kinds of vascular access to form clots or become infected Peripherally Inserted Central Catheters (PICC) Short term use (days to several weeks) Peripheral central venous catheter inserted at or above the antecubital space and the distal tip of the catheter is positioned
- 
												  A Guide for People Living with Von Willebrand Disorder CONTENTSA guide for people living with von Willebrand disorder CONTENTS What is von Willebrand disorder (VWD)?................................... 3 Symptoms............................................................................................... 5 Types of VWD...................................................................................... 6 How do you get VWD?...................................................................... 7 VWD and blood clotting.................................................................... 11 Diagnosis................................................................................................. 13 Treatment............................................................................................... 15 Taking care of yourself or your child.............................................. 19 (Education, information, first aid/medical emergencies, medication to avoid) Living well with VWD......................................................................... 26 (Sport, travel, school, telling others, work) Special issues for women and girls.................................................. 33 Connecting with others..................................................................... 36 Can I live a normal life with von Willebrand disorder?............. 37 More information................................................................................. 38 2 WHAT IS VON WILLEBRAND DISORDER (VWD)? Von Willebrand disorder (VWD) is an inherited bleeding disorder. People with VWD have a problem with a protein
- 
												  ER Guide to Bleeding DisordersBleeding disorders ER guide to bleeding disorders 1 Table of contents 4 General Guidelines 4–5 national Hemophilia Foundation guidelines 5–10 Treatment options 10 HemopHilia a Name:__________________________________________________________________________________________________ 10–11 national Hemophilia Foundation guidelines Address:________________________________________________________________________________________________ 12 dosage chart Phone:__________________________________________________________________________________________________ 14–15 Treatment products 16 HemopHilia B In case of emergency, contact: ______________________________________________________________________________ 16 national Hemophilia Foundation guidelines Relation to patient:________________________________________________________________________________________ 17 dosage chart 18 Treatment products 19 HemopHilia a or B with inHiBiTors Diagnosis: Hemophilia A: Mild Moderate Severe 20 national Hemophilia Foundation guidelines Inhibitors Inhibitors Bethesda units (if known) ____________________________________ 21 Treatment products Hemophilia B: Mild Moderate Severe 22–23 Von willeBrand disease Inhibitors Inhibitors Bethesda units (if known) ____________________________________ 23–24 national Hemophilia Foundation guidelines von Willebrand disease: Type 1 Type 2 Type 3 Platelet type 25 Treatment products 27 Bibliography Preferred product:_________________________________________________________________________________________ Dose for life-threatening
- 
												  JustificationJustification to the Resolution of the Federal Joint Committee (G-BA) on an Amendment of the Pharmaceuticals Directive (AM ‑ RL): Annex XII – Resolutions on the Benefit Assessment of Medicinal Products with New Active Ingredients in Accordance with Section 35a SGB V Damoctocog alfa pegol From 20 June 2019 Contents 1. Legal basis ................................................................................................................ 2 2. Key points of the resolution ..................................................................................... 2 2.1 Additional benefit of the medicinal product in relation to the appropriate comparator therapy ..................................................................................................... 3 2.1.1 Approved therapeutic indication of damoctocog alfa pegol (Jivi®) in accordance with the summary of product characteristics ............................................ 3 2.1.2 Appropriate comparator therapy ................................................................... 3 2.1.3 Extent and probability of the additional benefit .............................................. 5 2.1.4 Summary of the assessment ........................................................................ 6 2.2 Number of patients or demarcation of patient groups eligible for treatment ...... 6 2.3 Requirements for a quality-assured application ................................................ 7 2.4 Treatment costs ..............................................................................................
- 
												  Australian PIAUSTRALIAN PRODUCT INFORMATION OBIZUR® (susoctocog alfa) 1 NAME OF THE MEDICINE Susoctocog alfa (bhk). 2 QUALITATIVE AND QUANTITATIVE COMPOSITION Each OBIZUR vial contains nominally 500 units (U) of susoctocog alfa, which is a B domain deleted recombinant derived antihaemophilic factor VIII (rpFVIII), porcine sequence. After reconstitution, OBIZUR contains nominally 500 U/mL susoctocog alfa. Each vial of OBIZUR is labelled with the actual rpFVIII activity expressed in units determined by a one-stage clotting assay, using a reference rpFVIII material calibrated against the World Health Organization (WHO) 8th International Standard for human factor VIII concentrates. The specific activity of OBIZUR is in the range of 11000 - 18000 Units per milligram of protein. The potency values of OBIZUR determined by the chromogenic assay vary and are approximately 20-50 % lower than those of the one-stage clotting assay. Susoctocog alfa is expressed in a genetically engineered baby hamster kidney (BHK) cell line and secreted into the cell culture medium, and the protein is purified using a series of chromatography and filtration steps. The production process includes two dedicated viral clearance steps - a solvent/detergent treatment step for viral inactivation and a nanofiltration step through a series of two 15-nm filters for removal of viruses. No additives of human or animal origin are used in the formulation of OBIZUR. Excipient(s) with known effect Each vial of OBIZUR contains maximally 4.4 mg (198 mM) sodium per mL of reconstituted solution (see Section 4.4 SPECIAL WARNINGS AND PRECAUTIONS FOR USE). For the full list of excipients, see Section 6.1 LIST OF EXCIPIENTS.
- 
												  Novoeight HCP Brochure® READY UpUp to to Novoeight is ready to go TO GO when your patients are forfor up upto to ADMINIS- A recombinant factor VIII for today’s generation TRATION months 1 3 months of people living with hemophilia A Please see Prescribing Information for complete storage conditions. EFFICACY AND SAFETY Dylan lives with hemophilia A. PRODUCT ATTRIBUTES SUPPORT Indications and Usage • Novoeight® (antihemophilic factor, recombinant) is indicated for use in adults and children with hemophilia A for on-demand treatment and control of bleeding episodes, perioperative management, and routine prophylaxis to reduce the frequency of bleeding episodes • Novoeight® is not indicated for the treatment of von Willebrand disease SUMMARY Important Safety Information Contraindications • Do not use in patients who have had life-threatening hypersensitivity reactions, including anaphylaxis, to Novoeight® or its components, including hamster proteins ISI PI Please tap the ISI tab for additional Important Safety Information and tap the PI tab for Prescribing Information. Blerim lives with hemophilia A. READY WITH NOVOEIGHT® TO GO YOUR PATIENTS ARE ADMINIS- ready to go TRATION EFFICACY AND SAFETY “I’m planning on working as a camp counselor this summer. PRODUCT ATTRIBUTES Having a factor I can store and take with me is a huge relief.” —Patient with hemophilia A SUPPORT Important Safety Information SUMMARY Warnings and Precautions • Anaphylaxis and severe hypersensitivity reactions are possible. Patients may develop hypersensitivity to hamster proteins, which are present in trace amounts in the product. Should symptoms occur, discontinue Novoeight® and administer appropriate treatment ISI PI Please tap the ISI tab for additional Important Safety Information and tap the PI tab for Prescribing Information.
- 
												  Living with Von Willebrand Disease This Booklet Has Been Prepared to Help You Understand Von Willebrand DiseaseFocused Care for Bleeding Disorders Living with von Willebrand disease This booklet has been prepared to help you understand von Willebrand disease. It contains general educational material and is not intended to constitute medical advice or the rendering of medical care. Accredo is not licensed to practice medicine. The diagnosis and treatment of bleeding disorders should only be done by, or under the direction of, a qualified doctor. The patient’s doctor should always be consulted with regard to the patient’s medical treatment. You’ve been diagnosed with a bleeding disorder. You may be scared, confused or uncertain about where to go for the information you need. We understand ... and we’re here to help. At Accredo, a specialty pharmacy, our team of specialty-trained pharmacists, nurses and care advocates are solely focused on treating bleeding disorders and Leslie, RN understand how to help you manage your diagnosis. That’s why we’ve Bleeding Disorders provided this comprehensive guide to living with von Willebrand Educator disease – it’s just one more way we’re here to support you and help you live your best life. What is von Willebrand disease? Common symptoms .................................................................................. 3 How von Willebrand disease affects the body .............................................. 3 Types of von Willebrand disease ................................................................ 4 How did I get von Willebrand disease? ....................................................... 4 How is