Justification
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Clinical Commissioning Policy: Susoctocog Alfa for Treating Bleeding Episodes in People with Acquired Haemophilia a (All Ages)
Clinical Commissioning Policy: Susoctocog alfa for treating bleeding episodes in people with acquired haemophilia A (all ages) NHS England Reference: 170061P 1 NHS England INFORMATION READER BOX Directorate Medical Operations and Information Specialised Commissioning Nursing Trans. & Corp. Ops. Commissioning Strategy Finance Publications Gateway Reference: 07603 Document Purpose Policy Clinical commissioning policy: Susoctocog alfa for treating bleeding Document Name episodes in people with acquired haemophilia A (all ages) Author Specialised Commissioning Team Publication Date 29 June 2018 Target Audience CCG Clinical Leaders, Care Trust CEs, Foundation Trust CEs , Medical Directors, Directors of PH, Directors of Nursing, NHS England Regional Directors, NHS England Directors of Commissioning Operations, Directors of Finance, NHS Trust CEs Additional Circulation #VALUE! List Description Routinely Commissioned - NHS England will routinely commission this specialised treatment in accordance with the criteria described in this policy. Cross Reference 0 Superseded Docs 0 (if applicable) Action Required 0 Timing / Deadlines By 00 January 1900 (if applicable) Contact Details for [email protected] further information 0 0 0 0 0 0 Document Status This is a controlled document. Whilst this document may be printed, the electronic version posted on the intranet is the controlled copy. Any printed copies of this document are not controlled. As a controlled document, this document should not be saved onto local or network drives but should always be accessed from the intranet. 2 Standard Operating Procedure: Clinical Commissioning Policy: Susoctocog alfa for treating bleeding episodes in people with acquired haemophilia A (all ages) First published: June 2018 Prepared by the National Institute for Health and Care Excellence (NICE) Commissioning Support Programme Published by NHS England, in electronic format only. -
Coagulation Factor IX (Recombinant) - Drugbank
12/7/2017 Coagulation Factor IX (Recombinant) - DrugBank Coagulation Factor IX (Recombinant) Targets (7) Biointeractions (4) IDENTIFICATION Name Coagulation Factor IX (Recombinant) Accession Number DB00100 (BTD00038, BIOD00038) Type Biotech Groups Approved Biologic Classification Protein Based Therapies Blood factors Description Recombinant Coagulation Factor IX is a purified Factor IX glycoprotein produced by recombinant DNA technology. It has a primary amino acid sequence that is identical to the Ala148 allelic form of human factor IX, and has structural and functional characteristics similar to those of endogenous factor IX. It is not derived from human blood (unlike human Factor IX complex), and is instead produced by a genetically engineered Chinese hamster ovary (CHO) cell line that secretes recombinant Factor IX into cell medium that is then processed and purified for use as a pharmaceutical agent. Recombinant Factor IX is indicated for the control and prevention of bleeding episodes in adult and pediatric patients with congenital factor IX deficiency (Hemophilia B). Protein structure Protein chemical formula C2041H3136N558O641S25 Protein average weight 46548.2 Da https://www.drugbank.ca/drugs/DB00100 1/13 12/7/2017 Coagulation Factor IX (Recombinant) - DrugBank 46548.2 Da Sequences >DB00100 sequence YNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGG SCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAEN QKSCEPAVPFPCGRVSVSQTSKLTRAEAVFPDVDYVNSTEAETILDNITQSTQSFNDFTR VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEE -
Australian Public Assessment for Efmoroctocog Alfa (Rhu)
Australian Public Assessment Report 1 for efmoroctocog alfa (rhu) Proprietary Product Name: Eloctate Sponsor: Biogen Idec Australia Pty Ltd January 2015 1 The non-proprietary name has changed post registration from efraloctocog alfa to efmoroctocog afla to harmonise with the International Non-proprietary Name. Therapeutic Goods Administration About the Therapeutic Goods Administration (TGA) · The Therapeutic Goods Administration (TGA) is part of the Australian Government Department of Health and is responsible for regulating medicines and medical devices. · The TGA administers the Therapeutic Goods Act 1989 (the Act), applying a risk management approach designed to ensure therapeutic goods supplied in Australia meet acceptable standards of quality, safety and efficacy (performance), when necessary. · The work of the TGA is based on applying scientific and clinical expertise to decision- making, to ensure that the benefits to consumers outweigh any risks associated with the use of medicines and medical devices. · The TGA relies on the public, healthcare professionals and industry to report problems with medicines or medical devices. TGA investigates reports received by it to determine any necessary regulatory action. · To report a problem with a medicine or medical device, please see the information on the TGA website <http://www.tga.gov.au>. About AusPARs · An Australian Public Assessment Record (AusPAR) provides information about the evaluation of a prescription medicine and the considerations that led the TGA to approve or not approve a prescription medicine submission. · AusPARs are prepared and published by the TGA. · An AusPAR is prepared for submissions that relate to new chemical entities, generic medicines, major variations, and extensions of indications. · An AusPAR is a static document, in that it will provide information that relates to a submission at a particular point in time. -
List of Patented Medicines 2018
Patented Medicine Annual Report List 02 Apr 2019 Prices Review Board Protected A DIN Brand Chemical Name ATC Dosage Comments Status ABBVIE 02436027 HOLKIRA PAK 12.5/75/50/250 ombitasvir/paritaprevir/ritonavir/dasabuvir J05AX Oral Solid /Tablet Within Guidelines 02258595 HUMIRA - 40 MG/SYRINGE adalimumab L04AA Parenteral /Solution Within Guidelines 02312301 KALETRA 100/25 MG/TABLET lopinavir/ritonavir J05AE Oral Solid /Tablet Within Guidelines 02285533 KALETRA 200/50 MG/TABLET lopinavir/ritonavir J05AE Oral Solid /Tablet Within Guidelines 02243644 KALETRA 80/20 MG/MILLILITER lopinavir/ritonavir J05AE Oral Liquid /Solution Does Not Trigger 00884502 LUPRON DEPOT - 3.75 MG/VIAL leuprolide acetate L02AE Parenteral /Modified release injections Within Guidelines 00836273 LUPRON DEPOT - 7.5 MG/VIAL leuprolide acetate L02AE Parenteral /Modified release injections Within Guidelines 02239834 LUPRON DEPOT - 11.25 MG/VIAL leuprolide acetate L02AE Parenteral /Modified release injections Within Guidelines 02230248 LUPRON DEPOT - 22.5 MG/VIAL leuprolide acetate L02AE Parenteral /Modified release injections Within Guidelines 02239833 LUPRON DEPOT - 30 MG/VIAL leuprolide acetate L02AE Parenteral /Modified release injections Within Guidelines 02467550 MAVIRET 100/40 MG/TABLET glecaprevir/pibrentasvir J05AP Oral Solid /Tablet Subj. Investigation 02229145 NORVIR - 80 MG/MILLILITER ritonavir J05AE Oral Liquid /Solution Within Guidelines 02357593 NORVIR - 100 MG/TABLET ritonavir J05AE Oral Solid /Tablet Within Guidelines 02481332 ORILISSA - 150 MG/TABLET elagolix -
Human and Recombinat Coagulation Factor VIII
08 July 2016 EMA/PRAC/471535/2016 PRAC List of questions To be addressed by the marketing authorisation holder(s) for human and recombinant coagulation factor VIII containing medicinal products Referral under Article 31 of Directive 2001/83/EC resulting from pharmacovigilance data Procedure number: EMEA/H/A-31/1448 Advate EMEA/H/C/0520/A31/0078 Elocta EMEA/H/C/3964/A31/0006 Helixate Nexgen EMEA/H/C/0276/A31/0178 Iblias EMEA/H/C/4147/A31/0002 Kogenate EMEA/H/C/0275/A31/0185 Kovaltry EMEA/H/C/3825/A31/0004 Novoeight EMEA/H/C/2719/A31/0014 Nuwiq EMEA/H/C/2813/A31/0015 Obizur EMEA/H/C/2792/A31/0003 Refacto AF EMEA/H/C/0232/A31/0134 Voncento EMEA/H/C/2493/A31/0022 Active substances: human coagulation factor VIII; efmoroctocog alfa; moroctocog alfa; octocog alfa; simoctocog alfa; susoctocog alfa; turoctocog alfa 30 Churchill Place ● Canary Wharf ● London E14 5EU ● United Kingdom Telephone +44 (0)20 3660 6000 Facsimile +44 (0)20 3660 5555 Send a question via our website www.ema.europa.eu/contact An agency of the European Union © European Medicines Agency, 2016. Reproduction is authorised provided the source is acknowledged. 1. Background Today’s standard treatment of congenital haemophilia (and acquired haemophilia A) is based on prophylactic or on-demand replacement therapy with coagulation factor VIII (FVIII), either with plasma derived or with recombinant FVIII products. Principally both substance classes may be used for prophylactic treatment as well as for therapeutic treatment in case of spontaneous bleedings. Inhibitor development in haemophilia A patients receiving FVIII products mostly occurs in previously untreated or minimally treated patients (PUPs), who are still within the first 50 days of exposure to the treatment. -
PASS) Information
Reference Number: RD-SOP-1214 Supplement Version: 14 Post Authorization Safety Study (PASS) Information HA-SAFE: Observational study evaluating long-term safety Acronym/Title of real-world treatment with damoctocog alfa pegol in previously treated patients with hemophilia A Protocol version and date v 1.0, 13 JAN 2020 IMPACT study number 20904 Study type / Study phase Observational, post-approval PASS Joint PASS: YES NO EU PAS register number Study not yet registered Active substance ATC code: B02BD02/Hematological/Damoctocog alfa pegol Medicinal product Jivi EU/1/18/1324/001 Jivi 250 IU; Product reference EU/1/18/1324/002 Jivi 500 IU; EU/1/18/1324/003 Jivi 1000 IU; EU/1/18/1324/004 Jivi 2000 IU; EU/1/18/1324/005 Jivi 3000 IU Procedure number EMEA/H/C/004054 Study Initiator and Funder Bayer Consumer Care AG, Basel, Switzerland Research question and objectives The aim of this study is to characterize in a real-world setting the long-term safety of damoctocog alfa pegol drug usage. The primary objective of this study is to assess the long- term safety of prophylaxis with damoctocog alfa pegol in patients with hemophilia A in the real-world setting through the collection and analysis of adverse events (AEs) of special interest including those potentially indicative of PEG accumulation (hypersensitivity reactions, loss of drug effect, renal impairment, neurocognitive disorders, and inhibitor development), AEs, serious adverse events (SAEs), and adverse reactions (ARs). The secondary objective is to monitor the clinical effects of long-term exposure of prophylaxis damoctocog alfa pegol in 20904; HA-SAFE; v 1.0, 13 JAN 2020 Page 1 of 48 Reference Number: RD-SOP-1214 Supplement Version: 14 patients with hemophilia A, including assessments of kidney and liver function parameters, neurological function and patients’ PEG plasma levels. -
CHMP/565731/2018 Rev.1 Inspections, Human Medicines Pharmacovigilance and Committees Division
21 August 2018 EMA/CHMP/565731/2018 Rev.1 Inspections, Human Medicines Pharmacovigilance and Committees Division Committee for medicinal products for human use (CHMP) Agenda of CHMP written procedure* 20-23 August 2018 Chair: Tomas Salmonson – Vice-Chair: Harald Enzmann * Written Procedure - comments on the draft documents should be forwarded to the Product Manager (PM) as identified in the CHMP agenda. Disclaimers Some of the information contained in this agenda is considered commercially confidential or sensitive and therefore not disclosed. With regard to intended therapeutic indications or procedure scopes listed against products, it must be noted that these may not reflect the full wording proposed by applicants and may also vary during the course of the review. Of note, this agenda is a working document primarily designed for CHMP members and the work the Committee undertakes. Note on access to documents Some documents mentioned in the agenda cannot be released at present following a request for access to documents within the framework of Regulation (EC) No 1049/2001 as they are subject to on- going procedures for which a final decision has not yet been adopted. They will become public when adopted or considered public according to the principles stated in the Agency policy on access to documents (EMA/127362/2006). 30 Churchill Place ● Canary Wharf ● London E14 5EU ● United Kingdom Telephone +44 (0)20 3660 6000 Facsimile +44 (0)20 3660 5520 Send a question via our website www.ema.europa.eu/contact An agency of the European Union © European Medicines Agency, 2018. Reproduction is authorised provided the source is acknowledged. -
Nye Legemidler Som Ikke Har Markedsføringstillatelse for Legemidler Oppført På Listen Gjelder Retningslinjens Vilkår Uavhengig Av Indikasjon for Bruken
Nye legemidler som ikke har markedsføringstillatelse For legemidler oppført på listen gjelder retningslinjens vilkår uavhengig av indikasjon for bruken. Oppdatert: 13.11.2018 Orphan medicinal Indikasjon per nå. product (* Se (Samt mulig andre indikasjoner i informasjon Oppført på Virkestoff fremtiden.) nederst) listen Depatuximab mafodotin Treatment of glioblastoma (GBM) nov.18 Alpelisib Breast cancer; advanced hormone receptor positive (HR+), HER2-negative in men and postmenopausal women - second-line with fulvestrant okt.18 Omadacycline tosylate Treatment of community-acquired bacterial pneumonia (CABP) and acute bacterial skin and skin structure okt.18 Siponimod Treatmentinfections (ABSSSI) of secondary in adults progressive multiple sclerosis (SPMS) okt.18 autologous cd34+ cell enriched Treatment of transfusion-dependent β- population that contains thalassaemia (TDT) hematopoietic stem cells transduced with lentiglobin bb305 lentiviral vector encoding the beta-a-t87q-globin gene x okt.18 Fostamatinib Indicated for the treatment of thrombocytopenia okt.18 Dolutegravir / lamivudine Treatment of Human Immunodeficiency Virus type 1 (HIV-1) okt.18 Adeno-associated viral vector Treatment of paediatric patients serotype 9 containing the diagnosed with spinal muscular atrophy human SMN gene (AVXS-101) Type 1 okt.18 Treatment of non-neurological manifestations of acid sphingomyelinase Olipudase alfa deficiency okt.18 Treatment of adult and paediatric patients with locally advanced or Larotrectinib metastatic solid tumours x sep.18 Treatment -
PRESS RELEASE Stockholm, Sweden, 8 July 2020
PRESS RELEASE Stockholm, Sweden, 8 July 2020 Data to be presented at ISTH Virtual Congress highlights Sobi´s commitment to advancing rare haematology treatments Sobi™ will present data at the ISTH Virtual Congress (International Society on Thrombosis and Haemostasis), 12 – 14 July 2020, strengthening evidence for the efficacy and safety of Elocta® (efmoroctocog alfa) and Alprolix® (eftrenonacog alfa), for haemophilia A and B respectively, as well as pharmacokinetic data on BIVV001 (rFVIIIFc-VWF-XTEN). Data for Doptelet® (avatrombopag) in treatment for thrombocytopenia within Chronic Liver Disease (CLD) and Chronic Immune Thrombocytopenia (ITP) will be presented. Final data in previously untreated patients with haemophilia Final data from the long-term studies: PUPs A-LONG and PUPs B-LONG in previously untreated patients (PUP) with haemophilia A and B, treated with Elocta and Alprolix will be presented in collaboration with Sanofi. Factor replacement therapy remains a cornerstone of haemophilia management and data shared in presentations will add to a growing body of clinical evidence for rFVIIIFc and rFIXFc, extended half-life factor therapies for haemophilia A and B, respectively. Oral Communication • Final results of the PUPs A-LONG Study: Evaluating Safety and Efficacy of rFVIIIFc in Previously Untreated Patients with Haemophilia A. Oral communication #OC 03.2. Sunday, July 12, 2020 from 10:15 – 11:30 EDT (16.15-17.30 CET) (Joint with Sanofi) Abstracts • Final Results of PUPs B-LONG Study: Evaluating Safety and Efficacy of rFIXFc in Previously Untreated Patients with Haemophilia B. Poster presentation # PB0956. (Joint with Sanofi) • A French Multicentre Prospective, Non-Interventional Study (B-SURE) Evaluating Real-World Usage and Effectiveness of Recombinant Factor IX Fc Fusion Protein (rFIXFc) in People with Haemophilia B: Baseline Data. -
F.No: QA/02/Central Inspection Plan/CT/Rdna/2018 Director
F.No: QA/02/Central Inspection Plan/CT/rDNA/2018 Director General of Health Services Central Drugs Standard Control Organisation Office of Drugs Controller General (India) FDA Bhawan, Kotla Road, New Delhi-110002 (QA Division) Dated: Office Memorandum As a process of Clinical trial oversight. CDSCO-HQ has prepared tentative Central Inspection Plan for the Year 2018 for inspections of the clinical trials permitted with respect tor-DNA products in accordance with the elements of SOP QA-INS-004. You are requested to conduct clinical trial inspections as per plan with the team comprising of inspectors trained in GCP. along with subject expert and an officer from CDSCO-HQ. Drugs inspectors from respecti ve states may also join the inspection team. The concerned COSCO Zonal officers are also requested to confirm the status of clinical trial site before planning the inspection at respective site. The clinical trial inspection report shall be submitted after completion of inspection to this office along with your recommendations for further action by this office. Drugs Controller G neral (India) Encl: 1. Central Inspection Plan for cl inical trial inspections for year 2018 for r-DNA products To: All DDC(l)s of North Zone, West Zone, South Zone, East Zone, Ahmedabad Zone, Hyderabad Zone. Varanasi Sub Zone, Jarnmu Sub Zone, Bangalore Sub zone and Baddi Sub Zone. Copy to: Guard fi le (QA Division & Biological division) PS to DCGI Central Drugs Standard Control Organization Directorate General of Health Services, Ministry of Health and Family Welfare, Government of India FDA Bhavan, ITO, Kotla Road, New Delhi -110002 List of Clinical Trials (rDNA Products) to be inspected in the year 2018 Name of Investigational Sr. -
A Guide for People Living with Von Willebrand Disorder CONTENTS
A guide for people living with von Willebrand disorder CONTENTS What is von Willebrand disorder (VWD)?................................... 3 Symptoms............................................................................................... 5 Types of VWD...................................................................................... 6 How do you get VWD?...................................................................... 7 VWD and blood clotting.................................................................... 11 Diagnosis................................................................................................. 13 Treatment............................................................................................... 15 Taking care of yourself or your child.............................................. 19 (Education, information, first aid/medical emergencies, medication to avoid) Living well with VWD......................................................................... 26 (Sport, travel, school, telling others, work) Special issues for women and girls.................................................. 33 Connecting with others..................................................................... 36 Can I live a normal life with von Willebrand disorder?............. 37 More information................................................................................. 38 2 WHAT IS VON WILLEBRAND DISORDER (VWD)? Von Willebrand disorder (VWD) is an inherited bleeding disorder. People with VWD have a problem with a protein -
PRAC Draft Agenda of Meeting 4 -7 March 2013
4 March 2013 EMA/PRAC/141813/2013 Pharmacovigilance Risk Assessment Committee (PRAC) Pharmacovigilance Risk Assessment Committee (PRAC) Agenda of the meeting on 4-7 March 2013 Explanatory notes The Notes give a brief explanation of relevant agenda items and should be read in conjunction with the agenda. EU Referral procedures for safety reasons: Urgent EU procedures and Other EU referral procedures (Items 2 and 3 of the PRAC agenda) A referral is a procedure used to resolve issues such as concerns over the safety or benefit-risk balance of a medicine or a class of medicines. In a referral, the EMA is requested to conduct a scientific assessment of a particular medicine or class of medicines on behalf of the European Union (EU). For further detailed information on safety related referrals please see: http://www.ema.europa.eu/ema/index.jsp?curl=pages/regulation/general/general_content_000150.jsp&mid =WC0b01ac05800240d0 Signals assessment and prioritisation (Item 4 of the PRAC agenda) A safety signal is information on a new or incompletely documented adverse event that is potentially caused by a medicine and that warrants further investigation. Signals are generated from several sources such as spontaneous reports, clinical studies and the scientific literature. The evaluation of safety signals is a routine part of pharmacovigilance and is essential to ensuring that regulatory authorities have a comprehensive knowledge of a medicine’s benefits and risks. The presence of a safety signal does not mean that a medicine has caused the reported adverse event. The adverse event could be a symptom of another illness or caused by another medicine taken by the patient.