DOCSLIB.ORG

Turoctocog Alfa in the Treatment of Individuals with Hemophilia A: Review of Quality of Life Data Collected in Phase III Trials

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Turoctocog Alfa in the Treatment of Individuals with Hemophilia A: Review of Quality of Life Data Collected in Phase III Trials Review: Clinical Trial Outcomes For reprint orders, please contact: [email protected] 5 Review: Clinical Trial Outcomes 2015/08/28 Turoctocog alfa in the treatment of individuals with hemophilia A: review of quality of life data collected in Phase III trials Clin. Invest. (Lond.) Hemophilia A is an X-linked recessive hereditary bleeding disorder resulting Stephanie Seremetis*,1, Roshni from a deficiency in coagulation factor VIII. Difficulties due to hemophilia and its Kulkarni2, Antoine Regnault3 management present challenges for patient’s quality of life. Turoctocog alfa, a & Elena Santagostino4 1 recombinant, B-domain truncated factor VIII, is a recent US FDA- and EMA-approved Hemophilia R&D Portfolio, Novo Nordisk Inc., Plainsboro, NJ 08536, USA replacement therapy shown to be an effective and safe option for the treatment of 2Department of Pediatrics & Human individuals with hemophilia A. Data collected throughout two Phase 3, multinational, Development, Michigan State University, open-label, non-randomized, non-comparative trials demonstrated that individuals MI, USA with hemophilia A, particularly young adults experienced improvements in health- 3Mapi, Patient-Centered Outcomes, Lyon, related quality of life when switched from an on-demand to a prophylactic regimen France 4Angelo Bianchi Bonomi Hemophilia & of turoctocog alfa. Thrombosis Center, IRCCS Cà Granda Foundation, Maggiore, Hospital Keywords: EQ-5D • factor VIII • health-related quality of life • hemophilia • HAEMO-QOL • Policlinico, Milan, Italy questionnaires • turoctocog alfa *Author for correspondence: Tel.: +1 609 786 8390 [email protected] Hemophilia A is an X-linked recessive hered- a reduced number of bleeds, a greater quality itary bleeding disorder resulting from a defi- of life (QOL) and may potentially reduce the ciency in coagulation factor VIII (FVIII). risk of developing long-term musculoskeletal The annual incidence of hemophilia A is complications. This has been observed both estimated at 1/5000 male births in the USA in adults and younger individuals with severe and in Europe [1,2]. The level of circulating hemophilia [6–8]. Using the Standard Gamble coagulation factor determines the severity of method, Naraine et al. showed that scenarios hemophilia and this may be mild (5–40% with prophylaxis treatment regimens were of normal), moderate (1–5% of normal) or preferred to scenarios with on-demand treat- severe (<1% of normal) [3]. Hemophilia is ment regimens not only by individuals with 9 characterized by bleeding episodes which hemophilia and their parents, but also by may occur spontaneously or following an members of the general public [9]. injury, trauma or surgical procedure. Recur- The US FDA defines patient’s health- rent bleeding episodes can lead to long-term related quality of life (HRQoL) as ‘a multi- 2015 musculoskeletal complications including domain concept that represents the patient’s synovitis, degenerative arthropathy and artic- general perception of the effect of illness and ular deformities [4]. Bleeding episodes are pri- treatment on physical, psychological and marily treated by coagulation factor replace- social aspects of life’ [10] . Individuals liv- ment as a bleed occurs (on-demand) or in a ing with hemophilia may experience several preventive manner (prophylaxis regimen). QOL issues, which may affect their physi- Current standards of care in severe hemo- cal, psychological, social and economic well philia support regular prophylaxis, charac- being on a daily basis. Some individuals need terized by self-infusion of either recombinant to limit their activities due to the potential or plasma-derived FVIII concentrate several risk of a bleeding incident, whereas others are times a week [5]. Prophylaxis, when compared limited in mobility and functional status due part of with on-demand treatment, is associated with to permanent and painful joint damage [11] . 10.4155/cli.15.43 © 2015 Future Science Ltd Clin. Invest. (Lond.) (Epub ahead of print) ISSN 2041-6792 Review: Clinical Trial Outcomes Seremetis, Kulkarni, Regnault & Santagostino For reprint orders, please contact: [email protected] Using standard generic HRQoL questionnaires, the In both trials, HRQoL was a secondary endpoint. Short Form 36 health survey (SF-36) and EuroQol Patients completed two patient-reported question- (EQ-5D), Miners et al. showed that individuals with naires at baseline prior to treatment initiation and severe hemophilia who were not receiving primary at the end-of-treatment visit: the EQ-5D and the prophylaxis with coagulation factor, reported poorer hemophilia quality of life (HAEMO-QOL/HAEM- HRQoL scores compared with individuals with mild- A-QOL) questionnaires. to-moderate hemophilia and members of the UK gen- The EQ-5D is a 5-dimensional generic standard eral population [12] . utility instrument for measurement of health out- Since the introduction of factor replacement ther- come [23]. The EQ-5D includes the following domains: apy, life expectancy and reported HRQoL of indi- Mobility; Self-Care; Usual Activity; Pain/Discomfort viduals with hemophilia have seen noticeable improve- and Anxiety/Depression. In addition, a 10 cm visual ments [13] . In addition, the promise of further potential analog scale (VAS) also enables recording of individ- benefits arises from a number of new drugs that are ual’s rating for their current HRQoL; the VAS ranges currently in development. Coagulation factor concen- from 0-worst to 100-best imaginable health state. The trates with prolonged bioavailability require less fre- single index score is derived from application of coun- quent injections and can therefore minimize venous try-specific value sets (the UK value set in the case of access problems and infusion-related pain [14] . Patients the guardian trials) to responses from each domain. An may also benefit in the future from drugs that can index score of 0.0 represents a state approximately as overcome the barrier of immunogenicity, since the desirable as ‘death’ while an index score of 1.0 repre- development of inhibitory antibodies to factor concen- sents ‘perfect health.’ trates (inhibitors) continues to be a major complication The HAEMO-QOL is a disease-specific HRQoL in hemophilia treatment [15] . family of questionnaires that consists of four age- There is recognition that perceived benefits for specific instruments (4–7 years, 8–12 years, 13–16 patients, in particular the balance between therapeutic years and the HAEM-A-QOL for 17 years and efficacy, treatment risks (such as experience of adverse above) specifically designed to assess HRQoL in events) and treatment constraints are of key concern individuals with hemophilia [24,25]. HAEMO-QOL for patients, physicians and health authorities, as they questionnaires cover various domains of HRQoL may impact adherence to treatment [16–18]. including: psychological, physical and social factors. Turoctocog alfa (NovoEight®) is an FDA- and EMA- For all HAEMO-QOL questionnaires, a score for approved replacement therapy option for the treatment each domain as well as a total score summarizing the of individuals with hemophilia A. Turoctocog alfa is global HRQoL of individuals with hemophilia can be a human, recombinant, B-domain truncated FVIII, calculated. Scores range from 0 to 100; lower scores produced in Chinese hamster ovary cells without addi- indicate better HRQoL (and thus a negative change tion of any human- or animal-derived materials [19,20]. in this score should be interpreted as improvement). As part of its development, two Phase 3, multinational, The present review compiles existing available open-label, non-randomized, non-comparative trials data complemented with as yet unpublished patient- demonstrated that turoctocog alfa administered as a reported outcome data collected throughout the turoc- prophylaxis treatment was both effective and safe to tocog alfa development program (guardian trials) to treat bleeding episodes in 24 adolescents and 126 adults provide a comprehensive picture of the impact of pro- with hemophilia A (guardian™ 1) and in 63 children phylactic turoctocog alfa in the treatment of individu- with hemophilia A (guardian 3) [21,22]. In these trials, als with hemophilia A. most children received prophylaxis in the 12 months preceding the trial (68% in the 4–7 years; 67% in the Individuals with hemophilia A treated with 8–12 years groups). Among adolescents, 44% received prophylactic turoctocog alfa maintained on-demand regimen, 22% received prophylaxis and their level of HRQoL 33% received a mixed regimen. Among adults, 39% Overall, the mean HAEMO-QOL/HAEM-A-QOL received on-demand regimen, 36% received prophy- total score did not change between baseline and end- laxis and 26% received a mixed regimen. The observed of-treatment assessments [26,27]. This indicated that in success rate defined as ‘excellent’ or ‘good’ hamostatic the overall population, individuals who were prophy- response was 81% in guardian 1 and 92% in guard- lactically administered turoctocog alfa maintained ian 3. The estimated median annualized bleeding rates their level of HRQoL. As shown in Table 1, only were 3.7 bleeds/patient/year in adolescents and adults, children aged 4–7 years reported a small worsening and 3.0 in children. None of the patients enrolled (1.4, SD = 13.4) in the HEMO-QOL total score in developed FVIII inhibitors during the trials. the version completed by their parents between base- 10.4155/cli.15.43 Clin. Invest. (Lond.) (Epub ahead of print) future science group Turoctocog alfa in the treatment of individuals with hemophilia A Review: Clinical Trial Outcomes For reprint orders, please contact: [email protected] line and the end-of-trial visit; all other age groups were observed, suggesting that the transition to this reported an improvement, -2.6 (SD = 10.7) for the recombinant FVIII compound is not detrimental 8–12 years, -5.8 (SD = 10.0) for the 13–16 years and for patient HRQoL from the patients’ perspective. -1.6 (SD = 8.9) for the adults. Only minor changes Despite the absence of evidence of statistical signifi- in HRQoL of patients treated with turoctocog alfa cance of the change in scores from baseline to end-of- Table 1.
Load more

Recommended publications
  • Clinical Commissioning Policy: Susoctocog Alfa for Treating Bleeding Episodes in People with Acquired Haemophilia a (All Ages)
    Clinical Commissioning Policy: Susoctocog alfa for treating bleeding episodes in people with acquired haemophilia A (all ages) NHS England Reference: 170061P 1 NHS England INFORMATION READER BOX Directorate Medical Operations and Information Specialised Commissioning Nursing Trans. & Corp. Ops. Commissioning Strategy Finance Publications Gateway Reference: 07603 Document Purpose Policy Clinical commissioning policy: Susoctocog alfa for treating bleeding Document Name episodes in people with acquired haemophilia A (all ages) Author Specialised Commissioning Team Publication Date 29 June 2018 Target Audience CCG Clinical Leaders, Care Trust CEs, Foundation Trust CEs , Medical Directors, Directors of PH, Directors of Nursing, NHS England Regional Directors, NHS England Directors of Commissioning Operations, Directors of Finance, NHS Trust CEs Additional Circulation #VALUE! List Description Routinely Commissioned - NHS England will routinely commission this specialised treatment in accordance with the criteria described in this policy. Cross Reference 0 Superseded Docs 0 (if applicable) Action Required 0 Timing / Deadlines By 00 January 1900 (if applicable) Contact Details for [email protected] further information 0 0 0 0 0 0 Document Status This is a controlled document. Whilst this document may be printed, the electronic version posted on the intranet is the controlled copy. Any printed copies of this document are not controlled. As a controlled document, this document should not be saved onto local or network drives but should always be accessed from the intranet. 2 Standard Operating Procedure: Clinical Commissioning Policy: Susoctocog alfa for treating bleeding episodes in people with acquired haemophilia A (all ages) First published: June 2018 Prepared by the National Institute for Health and Care Excellence (NICE) Commissioning Support Programme Published by NHS England, in electronic format only.
    [Show full text]
  • Coagulation Factor IX (Recombinant) - Drugbank
    12/7/2017 Coagulation Factor IX (Recombinant) - DrugBank Coagulation Factor IX (Recombinant) Targets (7) Biointeractions (4) IDENTIFICATION Name Coagulation Factor IX (Recombinant) Accession Number DB00100 (BTD00038, BIOD00038) Type Biotech Groups Approved Biologic Classification Protein Based Therapies Blood factors Description Recombinant Coagulation Factor IX is a purified Factor IX glycoprotein produced by recombinant DNA technology. It has a primary amino acid sequence that is identical to the Ala148 allelic form of human factor IX, and has structural and functional characteristics similar to those of endogenous factor IX. It is not derived from human blood (unlike human Factor IX complex), and is instead produced by a genetically engineered Chinese hamster ovary (CHO) cell line that secretes recombinant Factor IX into cell medium that is then processed and purified for use as a pharmaceutical agent. Recombinant Factor IX is indicated for the control and prevention of bleeding episodes in adult and pediatric patients with congenital factor IX deficiency (Hemophilia B). Protein structure Protein chemical formula C2041H3136N558O641S25 Protein average weight 46548.2 Da https://www.drugbank.ca/drugs/DB00100 1/13 12/7/2017 Coagulation Factor IX (Recombinant) - DrugBank 46548.2 Da Sequences >DB00100 sequence YNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGG SCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAEN QKSCEPAVPFPCGRVSVSQTSKLTRAEAVFPDVDYVNSTEAETILDNITQSTQSFNDFTR VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEE
    [Show full text]
  • Nye Legemidler Som Ikke Har Markedsføringstillatelse for Legemidler Oppført På Listen Gjelder Retningslinjens Vilkår Uavhengig Av Indikasjon for Bruken
    Nye legemidler som ikke har markedsføringstillatelse For legemidler oppført på listen gjelder retningslinjens vilkår uavhengig av indikasjon for bruken. Oppdatert: 13.11.2018 Orphan medicinal Indikasjon per nå. product (* Se (Samt mulig andre indikasjoner i informasjon Oppført på Virkestoff fremtiden.) nederst) listen Depatuximab mafodotin Treatment of glioblastoma (GBM) nov.18 Alpelisib Breast cancer; advanced hormone receptor positive (HR+), HER2-negative in men and postmenopausal women - second-line with fulvestrant okt.18 Omadacycline tosylate Treatment of community-acquired bacterial pneumonia (CABP) and acute bacterial skin and skin structure okt.18 Siponimod Treatmentinfections (ABSSSI) of secondary in adults progressive multiple sclerosis (SPMS) okt.18 autologous cd34+ cell enriched Treatment of transfusion-dependent β- population that contains thalassaemia (TDT) hematopoietic stem cells transduced with lentiglobin bb305 lentiviral vector encoding the beta-a-t87q-globin gene x okt.18 Fostamatinib Indicated for the treatment of thrombocytopenia okt.18 Dolutegravir / lamivudine Treatment of Human Immunodeficiency Virus type 1 (HIV-1) okt.18 Adeno-associated viral vector Treatment of paediatric patients serotype 9 containing the diagnosed with spinal muscular atrophy human SMN gene (AVXS-101) Type 1 okt.18 Treatment of non-neurological manifestations of acid sphingomyelinase Olipudase alfa deficiency okt.18 Treatment of adult and paediatric patients with locally advanced or Larotrectinib metastatic solid tumours x sep.18 Treatment
    [Show full text]
  • F.No: QA/02/Central Inspection Plan/CT/Rdna/2018 Director
    F.No: QA/02/Central Inspection Plan/CT/rDNA/2018 Director General of Health Services Central Drugs Standard Control Organisation Office of Drugs Controller General (India) FDA Bhawan, Kotla Road, New Delhi-110002 (QA Division) Dated: Office Memorandum As a process of Clinical trial oversight. CDSCO-HQ has prepared tentative Central Inspection Plan for the Year 2018 for inspections of the clinical trials permitted with respect tor-DNA products in accordance with the elements of SOP QA-INS-004. You are requested to conduct clinical trial inspections as per plan with the team comprising of inspectors trained in GCP. along with subject expert and an officer from CDSCO-HQ. Drugs inspectors from respecti ve states may also join the inspection team. The concerned COSCO Zonal officers are also requested to confirm the status of clinical trial site before planning the inspection at respective site. The clinical trial inspection report shall be submitted after completion of inspection to this office along with your recommendations for further action by this office. Drugs Controller G neral (India) Encl: 1. Central Inspection Plan for cl inical trial inspections for year 2018 for r-DNA products To: All DDC(l)s of North Zone, West Zone, South Zone, East Zone, Ahmedabad Zone, Hyderabad Zone. Varanasi Sub Zone, Jarnmu Sub Zone, Bangalore Sub zone and Baddi Sub Zone. Copy to: Guard fi le (QA Division & Biological division) PS to DCGI Central Drugs Standard Control Organization Directorate General of Health Services, Ministry of Health and Family Welfare, Government of India FDA Bhavan, ITO, Kotla Road, New Delhi -110002 List of Clinical Trials (rDNA Products) to be inspected in the year 2018 Name of Investigational Sr.
    [Show full text]
  • A Guide for People Living with Von Willebrand Disorder CONTENTS
    A guide for people living with von Willebrand disorder CONTENTS What is von Willebrand disorder (VWD)?................................... 3 Symptoms............................................................................................... 5 Types of VWD...................................................................................... 6 How do you get VWD?...................................................................... 7 VWD and blood clotting.................................................................... 11 Diagnosis................................................................................................. 13 Treatment............................................................................................... 15 Taking care of yourself or your child.............................................. 19 (Education, information, first aid/medical emergencies, medication to avoid) Living well with VWD......................................................................... 26 (Sport, travel, school, telling others, work) Special issues for women and girls.................................................. 33 Connecting with others..................................................................... 36 Can I live a normal life with von Willebrand disorder?............. 37 More information................................................................................. 38 2 WHAT IS VON WILLEBRAND DISORDER (VWD)? Von Willebrand disorder (VWD) is an inherited bleeding disorder. People with VWD have a problem with a protein
    [Show full text]
  • PRAC Draft Agenda of Meeting 4 -7 March 2013
    4 March 2013 EMA/PRAC/141813/2013 Pharmacovigilance Risk Assessment Committee (PRAC) Pharmacovigilance Risk Assessment Committee (PRAC) Agenda of the meeting on 4-7 March 2013 Explanatory notes The Notes give a brief explanation of relevant agenda items and should be read in conjunction with the agenda. EU Referral procedures for safety reasons: Urgent EU procedures and Other EU referral procedures (Items 2 and 3 of the PRAC agenda) A referral is a procedure used to resolve issues such as concerns over the safety or benefit-risk balance of a medicine or a class of medicines. In a referral, the EMA is requested to conduct a scientific assessment of a particular medicine or class of medicines on behalf of the European Union (EU). For further detailed information on safety related referrals please see: http://www.ema.europa.eu/ema/index.jsp?curl=pages/regulation/general/general_content_000150.jsp&mid =WC0b01ac05800240d0 Signals assessment and prioritisation (Item 4 of the PRAC agenda) A safety signal is information on a new or incompletely documented adverse event that is potentially caused by a medicine and that warrants further investigation. Signals are generated from several sources such as spontaneous reports, clinical studies and the scientific literature. The evaluation of safety signals is a routine part of pharmacovigilance and is essential to ensuring that regulatory authorities have a comprehensive knowledge of a medicine’s benefits and risks. The presence of a safety signal does not mean that a medicine has caused the reported adverse event. The adverse event could be a symptom of another illness or caused by another medicine taken by the patient.
    [Show full text]
  • ER Guide to Bleeding Disorders
    Bleeding disorders ER guide to bleeding disorders 1 Table of contents 4 General Guidelines 4–5 national Hemophilia Foundation guidelines 5–10 Treatment options 10 HemopHilia a Name:__________________________________________________________________________________________________ 10–11 national Hemophilia Foundation guidelines Address:________________________________________________________________________________________________ 12 dosage chart Phone:__________________________________________________________________________________________________ 14–15 Treatment products 16 HemopHilia B In case of emergency, contact: ______________________________________________________________________________ 16 national Hemophilia Foundation guidelines Relation to patient:________________________________________________________________________________________ 17 dosage chart 18 Treatment products 19 HemopHilia a or B with inHiBiTors Diagnosis: Hemophilia A: Mild Moderate Severe 20 national Hemophilia Foundation guidelines Inhibitors Inhibitors Bethesda units (if known) ____________________________________ 21 Treatment products Hemophilia B: Mild Moderate Severe 22–23 Von willeBrand disease Inhibitors Inhibitors Bethesda units (if known) ____________________________________ 23–24 national Hemophilia Foundation guidelines von Willebrand disease: Type 1 Type 2 Type 3 Platelet type 25 Treatment products 27 Bibliography Preferred product:_________________________________________________________________________________________ Dose for life-threatening
    [Show full text]
  • Justification
    Justification to the Resolution of the Federal Joint Committee (G-BA) on an Amendment of the Pharmaceuticals Directive (AM ‑ RL): Annex XII – Resolutions on the Benefit Assessment of Medicinal Products with New Active Ingredients in Accordance with Section 35a SGB V Damoctocog alfa pegol From 20 June 2019 Contents 1. Legal basis ................................................................................................................ 2 2. Key points of the resolution ..................................................................................... 2 2.1 Additional benefit of the medicinal product in relation to the appropriate comparator therapy ..................................................................................................... 3 2.1.1 Approved therapeutic indication of damoctocog alfa pegol (Jivi®) in accordance with the summary of product characteristics ............................................ 3 2.1.2 Appropriate comparator therapy ................................................................... 3 2.1.3 Extent and probability of the additional benefit .............................................. 5 2.1.4 Summary of the assessment ........................................................................ 6 2.2 Number of patients or demarcation of patient groups eligible for treatment ...... 6 2.3 Requirements for a quality-assured application ................................................ 7 2.4 Treatment costs ..............................................................................................
    [Show full text]
  • Australian PI
    AUSTRALIAN PRODUCT INFORMATION OBIZUR® (susoctocog alfa) 1 NAME OF THE MEDICINE Susoctocog alfa (bhk). 2 QUALITATIVE AND QUANTITATIVE COMPOSITION Each OBIZUR vial contains nominally 500 units (U) of susoctocog alfa, which is a B domain deleted recombinant derived antihaemophilic factor VIII (rpFVIII), porcine sequence. After reconstitution, OBIZUR contains nominally 500 U/mL susoctocog alfa. Each vial of OBIZUR is labelled with the actual rpFVIII activity expressed in units determined by a one-stage clotting assay, using a reference rpFVIII material calibrated against the World Health Organization (WHO) 8th International Standard for human factor VIII concentrates. The specific activity of OBIZUR is in the range of 11000 - 18000 Units per milligram of protein. The potency values of OBIZUR determined by the chromogenic assay vary and are approximately 20-50 % lower than those of the one-stage clotting assay. Susoctocog alfa is expressed in a genetically engineered baby hamster kidney (BHK) cell line and secreted into the cell culture medium, and the protein is purified using a series of chromatography and filtration steps. The production process includes two dedicated viral clearance steps - a solvent/detergent treatment step for viral inactivation and a nanofiltration step through a series of two 15-nm filters for removal of viruses. No additives of human or animal origin are used in the formulation of OBIZUR. Excipient(s) with known effect Each vial of OBIZUR contains maximally 4.4 mg (198 mM) sodium per mL of reconstituted solution (see Section 4.4 SPECIAL WARNINGS AND PRECAUTIONS FOR USE). For the full list of excipients, see Section 6.1 LIST OF EXCIPIENTS.
    [Show full text]
  • Novoeight HCP Brochure
    ® READY UpUp to to Novoeight is ready to go TO GO when your patients are forfor up upto to ADMINIS- A recombinant factor VIII for today’s generation TRATION months 1 3 months of people living with hemophilia A Please see Prescribing Information for complete storage conditions. EFFICACY AND SAFETY Dylan lives with hemophilia A. PRODUCT ATTRIBUTES SUPPORT Indications and Usage • Novoeight® (antihemophilic factor, recombinant) is indicated for use in adults and children with hemophilia A for on-demand treatment and control of bleeding episodes, perioperative management, and routine prophylaxis to reduce the frequency of bleeding episodes • Novoeight® is not indicated for the treatment of von Willebrand disease SUMMARY Important Safety Information Contraindications • Do not use in patients who have had life-threatening hypersensitivity reactions, including anaphylaxis, to Novoeight® or its components, including hamster proteins ISI PI Please tap the ISI tab for additional Important Safety Information and tap the PI tab for Prescribing Information. Blerim lives with hemophilia A. READY WITH NOVOEIGHT® TO GO YOUR PATIENTS ARE ADMINIS- ready to go TRATION EFFICACY AND SAFETY “I’m planning on working as a camp counselor this summer. PRODUCT ATTRIBUTES Having a factor I can store and take with me is a huge relief.” —Patient with hemophilia A SUPPORT Important Safety Information SUMMARY Warnings and Precautions • Anaphylaxis and severe hypersensitivity reactions are possible. Patients may develop hypersensitivity to hamster proteins, which are present in trace amounts in the product. Should symptoms occur, discontinue Novoeight® and administer appropriate treatment ISI PI Please tap the ISI tab for additional Important Safety Information and tap the PI tab for Prescribing Information.
    [Show full text]
  • Cover Page for Protocol
    Cover Page for Protocol Sponsor name: Novo Nordisk A/S NCT number NCT03588741 Sponsor trial ID: NN7170-4345 Official title of study: Evaluation of safety following Immune Tolerance Induction treatment with turoctocog alfa in patients with haemophilia A following inhibitor development in NN7170-4213 trial. Document date: 20-December-2018 Protocol Date: 20 December 2018 Novo Nordisk Trial ID: NN7170-4345 Version: 2.0 CONFIDENTIAL UTN: U1111-1187-7323 Status: Final EudraCT no.: 2016-003821-40 Page: 1 of 74 Protocol Trial ID: NN7170-4345 Evaluation of safety following Immune Tolerance Induction treatment with turoctocog alfa in patients with haemophilia A following inhibitor development in NN7170-4213 trial Final Protocol version 1.0 (18 November 2016), Final Global Protocol Amendment no 1 (19 Dec 2018) Redacted protocol Includes redaction of personal identifiable information only. Trial phase: 3b Protocol originator . This confidential document is the property of Novo Nordisk. No unpublished information contained herein may be disclosed without prior written approval from Novo Nordisk. Access to this document must be restricted to relevant parties.This confidential document is the property of Novo Nordisk. No unpublished information contained herein may be disclosed without prior written approval from Novo Nordisk. Access to this document must be restricted to relevant parties. Protocol Date: 20 December 2018 Novo Nordisk Trial ID: NN7170-4345 Version: 2.0 CONFIDENTIAL UTN: U1111-1187-7323 Status: Final EudraCT no.: 2016-003821-40 Page:
    [Show full text]
  • Living with Von Willebrand Disease This Booklet Has Been Prepared to Help You Understand Von Willebrand Disease
    Focused Care for Bleeding Disorders Living with von Willebrand disease This booklet has been prepared to help you understand von Willebrand disease. It contains general educational material and is not intended to constitute medical advice or the rendering of medical care. Accredo is not licensed to practice medicine. The diagnosis and treatment of bleeding disorders should only be done by, or under the direction of, a qualified doctor. The patient’s doctor should always be consulted with regard to the patient’s medical treatment. You’ve been diagnosed with a bleeding disorder. You may be scared, confused or uncertain about where to go for the information you need. We understand ... and we’re here to help. At Accredo, a specialty pharmacy, our team of specialty-trained pharmacists, nurses and care advocates are solely focused on treating bleeding disorders and Leslie, RN understand how to help you manage your diagnosis. That’s why we’ve Bleeding Disorders provided this comprehensive guide to living with von Willebrand Educator disease – it’s just one more way we’re here to support you and help you live your best life. What is von Willebrand disease? Common symptoms .................................................................................. 3 How von Willebrand disease affects the body .............................................. 3 Types of von Willebrand disease ................................................................ 4 How did I get von Willebrand disease? ....................................................... 4 How is
    [Show full text]