Rabbit Anti-Human APEH Polyclonal Antibody (DPABH-23563) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Rabbit Anti-Human APEH Polyclonal antibody (DPABH-23563) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Immunogen AARE fusion protein, sequence: AQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLMVAQFSTPSLPPTLKVGFLPSAGKE QSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVPMVVMPHG GPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVL QEEHFDASHVALMGGSHGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGF PFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRL LLYPKSTHALSEVEVESDSFMNAVLWLRTHLGS (381-732aa encoded by BC000362) Isotype IgG Source/Host Rabbit Species Reactivity Human, Mouse, Rat Purification Antigen affinity purification Conjugate Unconjugated Applications WB, IHC, ELISA Positive Control mouse liver tissue, COLO 320 cells, HeLa cells, Jurkat cells Format Liquid Size 50 uL; 100 uL Buffer PBS with 0.02% sodium azide and 50% glycerol pH 7.3. Preservative 0.02% Sodium Azide Storage Store at -20°C. Aliquoting is unnecessary for -20°C storage. BACKGROUND Introduction This gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma. Keywords APEH; acylaminoacyl-peptide hydrolase; APH; OPH; AARE; ACPH; D3S48E; D3F15S2; DNF15S2; acylamino-acid-releasing enzyme; acyl-peptide hydrolase; acylaminoacyl-peptidase; oxidized protein hydrolase; N-acylaminoacyl-peptide hydrolase; GENE INFORMATION Entrez Gene ID 327 UniProt ID A0A024R2U9 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Pharmacogenomic Characterization in Bipolar Spectrum Disorders
pharmaceutics Review Pharmacogenomic Characterization in Bipolar Spectrum Disorders Stefano Fortinguerra 1,2 , Vincenzo Sorrenti 1,2,3 , Pietro Giusti 2, Morena Zusso 2 and Alessandro Buriani 1,2,* 1 Maria Paola Belloni Center for Personalized Medicine, Data Medica Group (Synlab Limited), 35131 Padova, Italy; [email protected] (S.F.); [email protected] (V.S.) 2 Department of Pharmaceutical & Pharmacological Sciences, University of Padova, 35131 Padova, Italy; [email protected] (P.G.); [email protected] (M.Z.) 3 Bendessere™ Study Center, Solgar Italia Multinutrient S.p.A., 35131 Padova, Italy * Correspondence: [email protected] Received: 25 November 2019; Accepted: 19 December 2019; Published: 21 December 2019 Abstract: The holistic approach of personalized medicine, merging clinical and molecular characteristics to tailor the diagnostic and therapeutic path to each individual, is steadily spreading in clinical practice. Psychiatric disorders represent one of the most difficult diagnostic challenges, given their frequent mixed nature and intrinsic variability, as in bipolar disorders and depression. Patients misdiagnosed as depressed are often initially prescribed serotonergic antidepressants, a treatment that can exacerbate a previously unrecognized bipolar condition. Thanks to the use of the patient’s genomic profile, it is possible to recognize such risk and at the same time characterize specific genetic assets specifically associated with bipolar spectrum disorder, as well as with the individual response to the various therapeutic options. This provides the basis for molecular diagnosis and the definition of pharmacogenomic profiles, thus guiding therapeutic choices and allowing a safer and more effective use of psychotropic drugs. Here, we report the pharmacogenomics state of the art in bipolar disorders and suggest an algorithm for therapeutic regimen choice.
[Show full text]
Deubiquitinase UCHL1 Maintains Protein Homeostasis Through PSMA7-APEH- Proteasome Axis in High-Grade Serous Ovarian Carcinoma
bioRxiv preprint doi: https://doi.org/10.1101/2020.09.28.316810; this version posted October 9, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Deubiquitinase UCHL1 Maintains Protein Homeostasis through PSMA7-APEH- Proteasome Axis in High-Grade Serous Ovarian Carcinoma Apoorva Tangri1*, Kinzie Lighty1*, Jagadish Loganathan1, Fahmi Mesmar2, Ram Podicheti3, Chi Zhang1, Marcin Iwanicki4, Harikrishna Nakshatri1,5, Sumegha Mitra1,5,# 1 Indiana University School of Medicine, Indianapolis, IN, USA 2 Indiana University, Bloomington, IN, USA 3Center for Genomics and Bioinformatics, Indiana University, Bloomington, IN, USA 4Stevens Institute of Technology, Hoboken, NJ, USA 5Indiana University Melvin & Bren Simon Cancer Center, Indianapolis, USA *Equal contribution # corresponding author; to whom correspondence may be addressed. E-mail: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.09.28.316810; this version posted October 9, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract High-grade serous ovarian cancer (HGSOC) is characterized by chromosomal instability, DNA damage, oxidative stress, and high metabolic demand, which exacerbate misfolded, unfolded and damaged protein burden resulting in increased proteotoxicity. However, the underlying mechanisms that maintain protein homeostasis to promote HGSOC growth remain poorly understood. In this study, we report that the neuronal deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L1 (UCHL1) is overexpressed in HGSOC and maintains protein homeostasis. UCHL1 expression was markedly increased in HGSOC patient tumors and serous tubal intraepithelial carcinoma (HGSOC precursor lesions).
[Show full text]
Identification of Conserved Genes Triggering Puberty in European Sea
Blázquez et al. BMC Genomics (2017) 18:441 DOI 10.1186/s12864-017-3823-2 RESEARCHARTICLE Open Access Identification of conserved genes triggering puberty in European sea bass males (Dicentrarchus labrax) by microarray expression profiling Mercedes Blázquez1,2* , Paula Medina1,2,3, Berta Crespo1,4, Ana Gómez1 and Silvia Zanuy1* Abstract Background: Spermatogenesisisacomplexprocesscharacterized by the activation and/or repression of a number of genes in a spatio-temporal manner. Pubertal development in males starts with the onset of the first spermatogenesis and implies the division of primary spermatogonia and their subsequent entry into meiosis. This study is aimed at the characterization of genes involved in the onset of puberty in European sea bass, and constitutes the first transcriptomic approach focused on meiosis in this species. Results: European sea bass testes collected at the onset of puberty (first successful reproduction) were grouped in stage I (resting stage), and stage II (proliferative stage). Transition from stage I to stage II was marked by an increase of 11ketotestosterone (11KT), the main fish androgen, whereas the transcriptomic study resulted in 315 genes differentially expressed between the two stages. The onset of puberty induced 1) an up-regulation of genes involved in cell proliferation, cell cycle and meiosis progression, 2) changes in genes related with reproduction and growth, and 3) a down-regulation of genes included in the retinoic acid (RA) signalling pathway. The analysis of GO-terms and biological pathways showed that cell cycle, cell division, cellular metabolic processes, and reproduction were affected, consistent with the early events that occur during the onset of puberty.
[Show full text]
Snps) Distant from Xenobiotic Response Elements Can Modulate Aryl Hydrocarbon Receptor Function: SNP-Dependent CYP1A1 Induction S
Supplemental material to this article can be found at: http://dmd.aspetjournals.org/content/suppl/2018/07/06/dmd.118.082164.DC1 1521-009X/46/9/1372–1381$35.00 https://doi.org/10.1124/dmd.118.082164 DRUG METABOLISM AND DISPOSITION Drug Metab Dispos 46:1372–1381, September 2018 Copyright ª 2018 by The American Society for Pharmacology and Experimental Therapeutics Single Nucleotide Polymorphisms (SNPs) Distant from Xenobiotic Response Elements Can Modulate Aryl Hydrocarbon Receptor Function: SNP-Dependent CYP1A1 Induction s Duan Liu, Sisi Qin, Balmiki Ray,1 Krishna R. Kalari, Liewei Wang, and Richard M. Weinshilboum Division of Clinical Pharmacology, Department of Molecular Pharmacology and Experimental Therapeutics (D.L., S.Q., B.R., L.W., R.M.W.) and Division of Biomedical Statistics and Informatics, Department of Health Sciences Research (K.R.K.), Mayo Clinic, Rochester, Minnesota Received April 22, 2018; accepted June 28, 2018 ABSTRACT Downloaded from CYP1A1 expression can be upregulated by the ligand-activated aryl fashion. LCLs with the AA genotype displayed significantly higher hydrocarbon receptor (AHR). Based on prior observations with AHR-XRE binding and CYP1A1 mRNA expression after 3MC estrogen receptors and estrogen response elements, we tested treatment than did those with the GG genotype. Electrophoretic the hypothesis that single-nucleotide polymorphisms (SNPs) map- mobility shift assay (EMSA) showed that oligonucleotides with the ping hundreds of base pairs (bp) from xenobiotic response elements AA genotype displayed higher LCL nuclear extract binding after (XREs) might influence AHR binding and subsequent gene expres- 3MC treatment than did those with the GG genotype, and mass dmd.aspetjournals.org sion.
[Show full text]
Supplemental Information
Supplemental information Dissection of the genomic structure of the miR-183/96/182 gene. Previously, we showed that the miR-183/96/182 cluster is an intergenic miRNA cluster, located in a ~60-kb interval between the genes encoding nuclear respiratory factor-1 (Nrf1) and ubiquitin-conjugating enzyme E2H (Ube2h) on mouse chr6qA3.3 (1). To start to uncover the genomic structure of the miR- 183/96/182 gene, we first studied genomic features around miR-183/96/182 in the UCSC genome browser (http://genome.UCSC.edu/), and identified two CpG islands 3.4-6.5 kb 5’ of pre-miR-183, the most 5’ miRNA of the cluster (Fig. 1A; Fig. S1 and Seq. S1). A cDNA clone, AK044220, located at 3.2-4.6 kb 5’ to pre-miR-183, encompasses the second CpG island (Fig. 1A; Fig. S1). We hypothesized that this cDNA clone was derived from 5’ exon(s) of the primary transcript of the miR-183/96/182 gene, as CpG islands are often associated with promoters (2). Supporting this hypothesis, multiple expressed sequences detected by gene-trap clones, including clone D016D06 (3, 4), were co-localized with the cDNA clone AK044220 (Fig. 1A; Fig. S1). Clone D016D06, deposited by the German GeneTrap Consortium (GGTC) (http://tikus.gsf.de) (3, 4), was derived from insertion of a retroviral construct, rFlpROSAβgeo in 129S2 ES cells (Fig. 1A and C). The rFlpROSAβgeo construct carries a promoterless reporter gene, the β−geo cassette - an in-frame fusion of the β-galactosidase and neomycin resistance (Neor) gene (5), with a splicing acceptor (SA) immediately upstream, and a polyA signal downstream of the β−geo cassette (Fig.
[Show full text]
In This Table Protein Name, Uniprot Code, Gene Name P-Value
Supplementary Table S1: In this table protein name, uniprot code, gene name p-value and Fold change (FC) for each comparison are shown, for 299 of the 301 significantly regulated proteins found in both comparisons (p-value<0.01, fold change (FC) >+/-0.37) ALS versus control and FTLD-U versus control. Two uncharacterized proteins have been excluded from this list Protein name Uniprot Gene name p value FC FTLD-U p value FC ALS FTLD-U ALS Cytochrome b-c1 complex P14927 UQCRB 1.534E-03 -1.591E+00 6.005E-04 -1.639E+00 subunit 7 NADH dehydrogenase O95182 NDUFA7 4.127E-04 -9.471E-01 3.467E-05 -1.643E+00 [ubiquinone] 1 alpha subcomplex subunit 7 NADH dehydrogenase O43678 NDUFA2 3.230E-04 -9.145E-01 2.113E-04 -1.450E+00 [ubiquinone] 1 alpha subcomplex subunit 2 NADH dehydrogenase O43920 NDUFS5 1.769E-04 -8.829E-01 3.235E-05 -1.007E+00 [ubiquinone] iron-sulfur protein 5 ARF GTPase-activating A0A0C4DGN6 GIT1 1.306E-03 -8.810E-01 1.115E-03 -7.228E-01 protein GIT1 Methylglutaconyl-CoA Q13825 AUH 6.097E-04 -7.666E-01 5.619E-06 -1.178E+00 hydratase, mitochondrial ADP/ATP translocase 1 P12235 SLC25A4 6.068E-03 -6.095E-01 3.595E-04 -1.011E+00 MIC J3QTA6 CHCHD6 1.090E-04 -5.913E-01 2.124E-03 -5.948E-01 MIC J3QTA6 CHCHD6 1.090E-04 -5.913E-01 2.124E-03 -5.948E-01 Protein kinase C and casein Q9BY11 PACSIN1 3.837E-03 -5.863E-01 3.680E-06 -1.824E+00 kinase substrate in neurons protein 1 Tubulin polymerization- O94811 TPPP 6.466E-03 -5.755E-01 6.943E-06 -1.169E+00 promoting protein MIC C9JRZ6 CHCHD3 2.912E-02 -6.187E-01 2.195E-03 -9.781E-01 Mitochondrial 2-
[Show full text]
A Master Autoantigen-Ome Links Alternative Splicing, Female Predilection, and COVID-19 to Autoimmune Diseases
bioRxiv preprint doi: https://doi.org/10.1101/2021.07.30.454526; this version posted August 4, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. A Master Autoantigen-ome Links Alternative Splicing, Female Predilection, and COVID-19 to Autoimmune Diseases Julia Y. Wang1*, Michael W. Roehrl1, Victor B. Roehrl1, and Michael H. Roehrl2* 1 Curandis, New York, USA 2 Department of Pathology, Memorial Sloan Kettering Cancer Center, New York, USA * Correspondence: [email protected] or [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.07.30.454526; this version posted August 4, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Abstract Chronic and debilitating autoimmune sequelae pose a grave concern for the post-COVID-19 pandemic era. Based on our discovery that the glycosaminoglycan dermatan sulfate (DS) displays peculiar affinity to apoptotic cells and autoantigens (autoAgs) and that DS-autoAg complexes cooperatively stimulate autoreactive B1 cell responses, we compiled a database of 751 candidate autoAgs from six human cell types. At least 657 of these have been found to be affected by SARS-CoV-2 infection based on currently available multi-omic COVID data, and at least 400 are confirmed targets of autoantibodies in a wide array of autoimmune diseases and cancer.
[Show full text]
Deubiquitinase UCHL1 Maintains Protein Homeostasis Through the PSMA7-APEH- Proteasome Axis in High-Grade Serous Ovarian Carcinoma
Author Manuscript Published OnlineFirst on March 22, 2021; DOI: 10.1158/1541-7786.MCR-20-0883 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Deubiquitinase UCHL1 Maintains Protein Homeostasis through the PSMA7-APEH- Proteasome Axis in High-Grade Serous Ovarian Carcinoma Apoorva Tangri1*, Kinzie Lighty1*, Jagadish Loganathan1, Fahmi Mesmar2, Ram Podicheti3, Chi Zhang4, Marcin Iwanicki5, Ronny Drapkin6, Harikrishna Nakshatri7,8, Sumegha Mitra1,8,# 1Department of Obstetrics and Gynecology, Indiana University School of Medicine, Indianapolis, IN, USA 2Department of Intelligent Systems Engineering, Indiana University, Bloomington, IN, USA 3Center for Genomics and Bioinformatics, Indiana University, Bloomington, IN, USA 4Department of Medical and Molecular Genetics, Indiana University School of Medicine, Indianapolis, IN, USA 5Department of Chemistry and Chemical Biology, Stevens Institute of Technology, Hoboken, NJ, USA 6Perelman School of Medicine, University of Pennsylvania, Philadelphia, PA, USA 7Department of Surgery, Indiana University School of Medicine, Indianapolis, IN, USA 8Indiana University Simon Comprehensive Cancer Center, Indianapolis, USA *Equal contribution Running title: UCHL1 mediates protein homeostasis in HGSOC Conflict of interest disclosure statement: None #Corresponding author Sumegha Mitra, Ph.D. Assistant Professor of Obstetrics and Gynecology Indiana University School of Medicine C547 Joseph E. Walther Hall (R3) 980 W Walnut Street, Indianapolis, IN 46202 317-274-3967 (office) 317-944-7417 (fax) [email protected] 1 Downloaded from mcr.aacrjournals.org on October 1, 2021. © 2021 American Association for Cancer Research. Author Manuscript Published OnlineFirst on March 22, 2021; DOI: 10.1158/1541-7786.MCR-20-0883 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited.
[Show full text]
APEH (B-2): Sc-393452
SAN TA C RUZ BI OTEC HNOL OG Y, INC . APEH (B-2): sc-393452 BACKGROUND APPLICATIONS APEH (acyl-peptide hydrolase), also known as APH, OPH or ACPH, is a 732 APEH (B-2) is recommended for detection of APEH of human origin by amino acid cytoplasmic protein that exists as a homotetramer and functions Western Blotting (starting dilution 1:100, dilution range 1:100-1:1000), to catalyze the hydrolysis of N-terminal acetylated amino acids from small immunoprecipitation [1-2 µg per 100-500 µg of total protein (1 ml of cell acetylated peptides. Once hydrolyzed from the target peptide, the acetyl lysate)], immunofluorescence (starting dilution 1:50, dilution range 1:50- amino acid is further processed by an aminoacylase to produce acetate and 1:500) and solid phase ELISA (starting dilution 1:30, dilution range 1:30- a free amino acid. The gene encoding human APEH maps to a region on 1:3000). chromosome 3 that is deleted in various types of cancers, including renal Suitable for use as control antibody for APEH siRNA (h): sc-78303, APEH cell carcinoma and small cell lung carcinoma, suggesting that APEH may be shRNA Plasmid (h): sc-78303-SH and APEH shRNA (h) Lentiviral Particles: involved in tumor transformation events. Chromosome 3 is made up of about sc-78303-V. 214 million bases encoding over 1,100 genes, including a chemokine receptor (CKR) gene cluster and a variety of human cancer-related gene loci. Key tumor Molecular Weight (predicted) of APEH: 81 kDa. suppressing genes on chromosome 3 include those that encode the apoptosis Molecular Weight (observed) of APEH: 84-90 kDa.
[Show full text]
Variation in Genomic Landscape of Clear Cell Renal Cell Carcinoma
ARTICLE Received 30 May 2014 | Accepted 3 Sep 2014 | Published 29 Oct 2014 DOI: 10.1038/ncomms6135 Variation in genomic landscape of clear cell renal cell carcinoma across Europe Ghislaine Scelo1,*, Yasser Riazalhosseini2,3,*, Liliana Greger4,*, Louis Letourneau3,*, Mar Gonza`lez-Porta4,*, Magdalena B. Wozniak1, Mathieu Bourgey3, Patricia Harnden5, Lars Egevad6, Sharon M. Jackson5, Mehran Karimzadeh2,3, Madeleine Arseneault2,3, Pierre Lepage3, Alexandre How-Kit7, Antoine Daunay7, Victor Renault7,He´le`ne Blanche´7, Emmanuel Tubacher7, Jeremy Sehmoun7, Juris Viksna8, Edgars Celms8, Martins Opmanis8, Andris Zarins8, Naveen S. Vasudev5, Morag Seywright9, Behnoush Abedi-Ardekani1, Christine Carreira1, Peter J. Selby5, Jon J. Cartledge10, Graham Byrnes1, Jiri Zavadil1, Jing Su4, Ivana Holcatova11, Antonin Brisuda12, David Zaridze13, Anush Moukeria13, Lenka Foretova14, Marie Navratilova14, Dana Mates15, Viorel Jinga16, Artem Artemov17, Artem Nedoluzhko18, Alexander Mazur17, Sergey Rastorguev18, Eugenia Boulygina18, Simon Heath19, Marta Gut19, Marie-Therese Bihoreau20, Doris Lechner20, Mario Foglio20, Ivo G. Gut19, Konstantin Skryabin17,18, Egor Prokhortchouk17,18, Anne Cambon-Thomsen21, Johan Rung4, Guillaume Bourque2,3, Paul Brennan1,Jo¨rg Tost20, Rosamonde E. Banks5,AlvisBrazma4 & G. Mark Lathrop2,3,7,20,w The incidence of renal cell carcinoma (RCC) is increasing worldwide, and its prevalence is particularly high in some parts of Central Europe. Here we undertake whole-genome and transcriptome sequencing of clear cell RCC (ccRCC), the most common form of the disease, in patients from four different European countries with contrasting disease incidence to explore the underlying genomic architecture of RCC. Our ﬁndings support previous reports on frequent aberrations in the epigenetic machinery and PI3K/mTOR signalling, and uncover novel pathways and genes affected by recurrent mutations and abnormal transcriptome patterns including focal adhesion, components of extracellular matrix (ECM) and genes encoding FAT cadherins.
[Show full text]
Anti-APEH Antibody (ARG57339)
Product datasheet [email protected] ARG57339 Package: 100 μl anti-APEH antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes APEH Tested Reactivity Hu, Ms, Rat Tested Application ICC/IF, IP, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name APEH Antigen Species Human Immunogen Recombinant Protein of Human APEH. Conjugation Un-conjugated Alternate Names D3S48E; OPH; EC 3.4.19.1; Oxidized protein hydrolase; D3F15S2; APH; Acylaminoacyl-peptidase; Acylamino-acid-releasing enzyme; DNF15S2; Acyl-peptide hydrolase; ACPH; AARE Application Instructions Application table Application Dilution ICC/IF 1:10 - 1:100 IP Assay-dependent WB 1:500 - 1:2000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control Jurkat Calculated Mw 81 kDa Properties Form Liquid Purification Affinity purification with immunogen. Buffer PBS (pH 7.3), 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. www.arigobio.com 1/3 Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Gene Symbol APEH Gene Full Name acylaminoacyl-peptide hydrolase Background This gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides.
[Show full text]
Genomic Portrait of a Sporadic Amyotrophic Lateral Sclerosis Case in a Large Spinocerebellar Ataxia Type 1 Family
Journal of Personalized Medicine Article Genomic Portrait of a Sporadic Amyotrophic Lateral Sclerosis Case in a Large Spinocerebellar Ataxia Type 1 Family Giovanna Morello 1,2, Giulia Gentile 1 , Rossella Spataro 3, Antonio Gianmaria Spampinato 1,4, 1 2 3 5, , Maria Guarnaccia , Salvatore Salomone , Vincenzo La Bella , Francesca Luisa Conforti * y 1, , and Sebastiano Cavallaro * y 1 Institute for Research and Biomedical Innovation (IRIB), Italian National Research Council (CNR), Via Paolo Gaifami, 18, 95125 Catania, Italy; [email protected] (G.M.); [email protected] (G.G.); [email protected] (A.G.S.); [email protected] (M.G.) 2 Department of Biomedical and Biotechnological Sciences, Section of Pharmacology, University of Catania, 95123 Catania, Italy; [email protected] 3 ALS Clinical Research Center and Neurochemistry Laboratory, BioNeC, University of Palermo, 90127 Palermo, Italy; [email protected] (R.S.); [email protected] (V.L.B.) 4 Department of Mathematics and Computer Science, University of Catania, 95123 Catania, Italy 5 Department of Pharmacy, Health and Nutritional Sciences, University of Calabria, Arcavacata di Rende, 87036 Rende, Italy * Correspondence: [email protected] (F.L.C.); [email protected] (S.C.); Tel.: +39-0984-496204 (F.L.C.); +39-095-7338111 (S.C.); Fax: +39-0984-496203 (F.L.C.); +39-095-7338110 (S.C.) F.L.C. and S.C. are co-last authors on this work. y Received: 6 November 2020; Accepted: 30 November 2020; Published: 2 December 2020 Abstract: Background: Repeat expansions in the spinocerebellar ataxia type 1 (SCA1) gene ATXN1 increases the risk for amyotrophic lateral sclerosis (ALS), supporting a relationship between these disorders.
[Show full text]